F416513

General Info

Members Datasets Scaffolds Average Seq Length
345 198 310 286

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0011603|Ga0495672_0011603_4529_5584
Length 322
Sequence MSFPRWREPIERIRRHLSTNSRLRERRWVAVFFAPGLGFLWVSPATGIMRIKRARSLPMKRNLHLLIIDPQNDFCDLPSAYLPDNPATKAAHAPALPVNGAHQDMLRLAGIINRGRHGLSAISVTLDSHHRYDIAHPTFWLGADGTAPAPFTQITAAEVRAATYLPRDGAALPRVLAYLDALEQNGRYQLMIWPVHCEIGSWGHNVHEDVREAYNRWEDASRGIVTKIPELIASLAKSDLIYIAGEAGSHCVKATTEHIAEQLEAQFGVEAFSRLVLITDCMSPVAGFCDQYQDFLEDMEERGVRLAQSGEVLQELLVNAGR

Samples

Sample ID Description Type Environment
1 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
2 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
3 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
4 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
5 2738541280 Massilia sp. GV090 Isolate Unclassified
6 2738541297 Duganella sp. GV083 Isolate Unclassified
7 2738541300 Massilia sp. GV016 Isolate Unclassified
8 2738541357 Duganella sp. GV053 Isolate Unclassified
9 2738543003 Duganella sp. GV066 Isolate Unclassified
10 2738543018 Massilia sp. GV045 Isolate Unclassified
11 2738543026 Duganella sp. GV089 Isolate Unclassified
12 2738543029 Duganella sp. GV039 Isolate Unclassified
13 2738543030 Massilia sp. GV097 Isolate Unclassified
14 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
15 2821131069 Duganella sp. 1224 Isolate Unclassified
16 2842711865 Duganella sp. R-73148 Isolate Unclassified
17 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
18 2857553236 Duganella sp. R-74557 Isolate Unclassified
19 2857558681 Duganella sp. R-74565 Isolate Unclassified
20 2857564685 Duganella sp. R-74599 Isolate Unclassified
21 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
22 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
23 2904424332 Duganella sp. 1411 Isolate Rhizosphere
24 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
25 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
26 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
27 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
28 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
29 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
30 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
31 2919476304 Duganella sp. 3397 Isolate Unclassified
32 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
33 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
34 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
35 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
36 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
37 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
38 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
39 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
40 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
41 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
42 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
43 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
44 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
45 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
46 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
47 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
48 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
49 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
61 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
75 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
108 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
109 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
110 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
111 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
112 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
113 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
116 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
124 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
132 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
136 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
140 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
145 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
146 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
147 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
150 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
157 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
166 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
167 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
168 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
169 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
170 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
179 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
180 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
184 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
185 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
190 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
191 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
192 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
193 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
194 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
195 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
198 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.86
Metatranscriptomes 0
Isolates 10.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.52
Nodule 1.16
Rhizoplane 0.58
Rhizosphere 66.96
Stem 0
Stem Tuber 0
Unclassified 14.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000271 3300002737 Bacteria 49990
2 rootL2_10005365 3300003322 Bacteria 9351
3 rootH1_10046276 3300003323 Bacteria 4562
4 Ga0055538_1000024 3300003751 Bacteria 241526
5 Ga0055539_1000031 3300003752 Bacteria 241526
6 Ga0055533_1000041 3300003756 Bacteria 241526
7 Ga0055525_1000049 3300003759 Bacteria 241526
8 Ga0055529_1000119 3300003763 Bacteria 115765
9 Ga0055526_1000096 3300003771 Bacteria 80897
10 Ga0055526_1000176 3300003771 Bacteria 56708
11 Ga0055526_1000209 3300003771 Bacteria 50344
12 Ga0055526_1003187 3300003771 Bacteria 10619
13 Ga0055537_1000004 3300003773 Bacteria 167383
14 Ga0055537_1000211 3300003773 Bacteria 43102
15 Ga0055524_1000049 3300003775 Bacteria 149383
16 Ga0055534_1000266 3300003784 Bacteria 36308
17 Ga0055528_1000203 3300003790 Bacteria 50129
18 Ga0055541_1000022 3300003841 Bacteria 241526
19 Ga0065165_1002659 3300005262 Bacteria 14440
20 Ga0065714_10006304 3300005288 Bacteria 3701
21 Ga0070682_100009855 3300005337 Bacteria 5410
22 Ga0070661_100245204 3300005344 Bacteria 1381
23 Ga0068855_100000235 3300005563 Bacteria 70600
24 Ga0068854_100016532 3300005578 Bacteria 4920
25 Ga0075365_10028387 3300006038 Bacteria 3569
26 Ga0075363_100035378 3300006048 Bacteria 2613
27 Ga0075362_10018627 3300006177 Bacteria 2876
28 Ga0075366_10002051 3300006195 Bacteria 10221
29 Ga0079104_1004792 3300006946 Bacteria 5639
30 Ga0079104_1009752 3300006946 Bacteria 3227
31 Ga0099826_10000005 3300006948 Bacteria 465206
32 Ga0105244_10009071 3300009036 Bacteria 6148
33 Ga0105244_10009884 3300009036 Bacteria 5821
34 Ga0105243_10041468 3300009148 Bacteria 3600
35 Ga0105238_10000355 3300009551 Bacteria 49268
36 Ga0182008_10009515 3300014497 Bacteria 5242
37 Ga0182006_1000004 3300015261 Bacteria 622190
38 Ga0182006_1000211 3300015261 Bacteria 57444
39 Ga0182006_1009547 3300015261 Bacteria 4342
40 Ga0182006_1020621 3300015261 Bacteria 2759
41 Ga0182007_10000018 3300015262 Bacteria 198916
42 Ga0182007_10079803 3300015262 Bacteria 1073
43 Ga0182005_1000005 3300015265 Bacteria 537378
44 Ga0182005_1000011 3300015265 Bacteria 420605
45 Ga0213872_10000094 3300021361 Bacteria 82769
46 Ga0213872_10001281 3300021361 Bacteria 16820
47 Ga0213872_10004485 3300021361 Bacteria 7405
48 Ga0213872_10009586 3300021361 Bacteria 4639
49 Ga0213872_10030778 3300021361 Bacteria 2459
50 Ga0209784_100018 3300025224 Bacteria 456816
51 Ga0209566_100016 3300025225 Bacteria 456824
52 Ga0209674_100030 3300025226 Bacteria 456824
53 Ga0209563_100034 3300025230 Bacteria 456824
54 Ga0209646_1000036 3300025246 Bacteria 358864
55 Ga0209677_100019 3300025253 Bacteria 456824
56 Ga0209565_1000018 3300025263 Bacteria 460940
57 Ga0209565_1007675 3300025263 Bacteria 2886
58 Ga0209455_1000047 3300025272 Bacteria 379709
59 Ga0209673_1000090 3300025273 Bacteria 202223
60 Ga0209673_1008032 3300025273 Bacteria 4753
61 Ga0209675_1000005 3300025291 Bacteria 849192
62 Ga0209676_1012769 3300025292 Bacteria 3270
63 Ga0209564_1000027 3300025295 Bacteria 518458
64 Ga0209564_1000060 3300025295 Bacteria 325890
65 Ga0209564_1000078 3300025295 Bacteria 275766
66 Ga0209564_1000348 3300025295 Bacteria 86984
67 Ga0209758_1000895 3300025297 Bacteria 40555
68 Ga0209050_1021670 3300025298 Bacteria 2334
69 Ga0209256_1000040 3300025299 Bacteria 366839
70 Ga0209256_1000070 3300025299 Bacteria 245034
71 Ga0209257_1017542 3300025304 Bacteria 2812
72 Ga0207655_1005724 3300025728 Bacteria 8386
73 Ga0207655_1010164 3300025728 Bacteria 5744
74 Ga0207695_10001464 3300025913 Bacteria 39554
75 Ga0207649_10150990 3300025920 Bacteria 1600
76 Ga0207694_10000236 3300025924 Bacteria 52960
77 Ga0207709_10014227 3300025935 Bacteria 4391
78 Ga0207667_10000110 3300025949 Bacteria 131872
79 Ga0207667_10016063 3300025949 Bacteria 8478
80 Ga0207640_10006452 3300025981 Bacteria 6438
81 Ga0207674_10163052 3300026116 Bacteria 2183
82 Ga0209281_1015013 3300027111 Bacteria 1624
83 Ga0307515_10057685 3300028794 Bacteria 5614
84 Ga0307515_10177553 3300028794 Bacteria 2094
85 Ga0265327_10000116 3300031251 Bacteria 173745
86 Ga0265316_10018525 3300031344 Bacteria 5979
87 Ga0307513_10101054 3300031456 Bacteria 2907
88 Ga0307513_10104246 3300031456 Bacteria 2850
89 Ga0307513_10143869 3300031456 Bacteria 2306
90 Ga0307408_100001741 3300031548 Bacteria 15904
91 Ga0307408_100239109 3300031548 Bacteria 1491
92 Ga0307514_10000921 3300031649 Bacteria 44956
93 Ga0265314_10020332 3300031711 Bacteria 5125
94 Ga0307406_10000381 3300031901 Bacteria 25600
95 Ga0373925_0075160 3300037068 Bacteria 2560
96 Ga0395900_0000322 3300037418 Bacteria 70864
97 Ga0395901_0000332 3300038443 Bacteria 57814
98 Ga0436361_0230276 3300039447 Bacteria 20142
99 Ga0436361_0398531 3300039447 Bacteria 34158
100 Ga0436361_0512044 3300039447 Bacteria 3233
101 Ga0436361_0582636 3300039447 Bacteria 7795
102 Ga0436361_0643209 3300039447 Bacteria 7874
103 Ga0439436_0074688 3300041404 Bacteria 944
104 Ga0439465_0016194 3300041413 Bacteria 2325
105 Ga0439433_0020963 3300041999 Bacteria 1460
106 Ga0439448_0039288 3300042005 Bacteria 1525
107 Ga0439449_0002351 3300042007 Bacteria 7419
108 Ga0439458_0018762 3300042157 Bacteria 1587
109 Ga0450893_0005577 3300042532 Bacteria 2022
110 Ga0451577_0170524 3300042876 Bacteria 1961
111 Ga0466972_0034289 3300044658 Bacteria 2488
112 Ga0466965_0062630 3300044683 Bacteria 1861
113 Ga0466964_0018490 3300044706 Bacteria 2675
114 Ga0453684_0013542 3300044712 Bacteria 13229
115 Ga0466970_0245245 3300044765 Bacteria 1003
116 Ga0466957_0072213 3300044842 Bacteria 2136
117 Ga0451576_0001125 3300045051 Bacteria 48618
118 Ga0451576_0149280 3300045051 Bacteria 2437
119 Ga0466967_0595963 3300045976 Bacteria 1090
120 Ga0495617_000005 3300046452 Bacteria 404687
121 Ga0495617_008947 3300046452 Bacteria 3444
122 Ga0495617_027449 3300046452 Bacteria 1915
123 Ga0495627_029242 3300046453 Bacteria 1755
124 Ga0495592_0027271 3300046454 Bacteria 4331
125 Ga0495590_0000011 3300046457 Bacteria 307470
126 Ga0495590_0009581 3300046457 Bacteria 3675
127 Ga0495638_0000058 3300046460 Bacteria 192656
128 Ga0495638_0009778 3300046460 Bacteria 6698
129 Ga0495638_0103349 3300046460 Bacteria 1701
130 Ga0495638_0131354 3300046460 Bacteria 1470
131 Ga0495651_0039301 3300046462 Bacteria 3684
132 Ga0495651_0262170 3300046462 Bacteria 1175
133 Ga0495653_0000008 3300046463 Bacteria 307868
134 Ga0495653_0008157 3300046463 Bacteria 8576
135 Ga0495650_0000109 3300046471 Bacteria 199925
136 Ga0495650_0000464 3300046471 Bacteria 62788
137 Ga0495650_0001067 3300046471 Bacteria 30383
138 Ga0495650_0005944 3300046471 Bacteria 7742
139 Ga0495650_0006328 3300046471 Bacteria 7403
140 Ga0495650_0011518 3300046471 Bacteria 4837
141 Ga0495605_0015965 3300046474 Bacteria 4074
142 Ga0495639_0040034 3300046475 Bacteria 2107
143 Ga0495584_0000789 3300046491 Bacteria 20899
144 Ga0495585_0001913 3300046492 Bacteria 15621
145 Ga0495585_0014969 3300046492 Bacteria 4510
146 Ga0495585_0136160 3300046492 Bacteria 1289
147 Ga0495585_0154286 3300046492 Bacteria 1195
148 Ga0495585_0166167 3300046492 Bacteria 1142
149 Ga0495607_0003081 3300046501 Bacteria 12953
150 Ga0495607_0012604 3300046501 Bacteria 5571
151 Ga0495607_0044789 3300046501 Bacteria 2606
152 Ga0495607_0084206 3300046501 Bacteria 1740
153 Ga0495607_0092976 3300046501 Bacteria 1630
154 Ga0495607_0120542 3300046501 Bacteria 1378
155 Ga0495583_0000016 3300046506 Bacteria 312691
156 Ga0495583_0000886 3300046506 Bacteria 35906
157 Ga0495606_0000048 3300046507 Bacteria 207840
158 Ga0495606_0000276 3300046507 Bacteria 90441
159 Ga0495606_0000711 3300046507 Bacteria 51509
160 Ga0495606_0001095 3300046507 Bacteria 38829
161 Ga0495606_0001130 3300046507 Bacteria 38068
162 Ga0495606_0001538 3300046507 Bacteria 30447
163 Ga0495606_0014741 3300046507 Bacteria 6074
164 Ga0495606_0022444 3300046507 Bacteria 4598
165 Ga0495608_0007994 3300046511 Bacteria 7436
166 Ga0495610_0000007 3300046512 Bacteria 820919
167 Ga0495610_0006360 3300046512 Bacteria 8152
168 Ga0495610_0007211 3300046512 Bacteria 7460
169 Ga0495610_0019972 3300046512 Bacteria 3733
170 Ga0495610_0027821 3300046512 Bacteria 2999
171 Ga0495610_0040365 3300046512 Bacteria 2353
172 Ga0495610_0046727 3300046512 Bacteria 2134
173 Ga0495616_0002853 3300046513 Bacteria 11266
174 Ga0495628_0454806 3300046516 Bacteria 929
175 Ga0495637_0000132 3300046520 Bacteria 55556
176 Ga0495643_0000230 3300046522 Bacteria 84299
177 Ga0495643_0000257 3300046522 Bacteria 78156
178 Ga0495643_0073077 3300046522 Bacteria 1798
179 Ga0495643_0098371 3300046522 Bacteria 1502
180 Ga0495644_0000229 3300046523 Bacteria 26515
181 Ga0495644_0000330 3300046523 Bacteria 21608
182 Ga0495644_0011375 3300046523 Bacteria 3427
183 Ga0495648_0000082 3300046524 Bacteria 123682
184 Ga0495648_0000593 3300046524 Bacteria 38760
185 Ga0495648_0010565 3300046524 Bacteria 7020
186 Ga0495648_0015927 3300046524 Bacteria 5433
187 Ga0495648_0046923 3300046524 Bacteria 2674
188 Ga0495648_0100804 3300046524 Bacteria 1594
189 Ga0495642_0026876 3300046528 Bacteria 2288
190 Ga0495654_0000046 3300046530 Bacteria 150178
191 Ga0495654_0009968 3300046530 Bacteria 5189
192 Ga0495654_0029444 3300046530 Bacteria 2800
193 Ga0495609_0000684 3300046538 Bacteria 26188
194 Ga0495609_0001829 3300046538 Bacteria 13630
195 Ga0495609_0027800 3300046538 Bacteria 2583
196 Ga0495609_0105374 3300046538 Bacteria 1219
197 Ga0495597_0000351 3300046542 Bacteria 41202
198 Ga0495597_0001433 3300046542 Bacteria 17158
199 Ga0495597_0002345 3300046542 Bacteria 12238
200 Ga0495622_0000036 3300046557 Bacteria 122551
201 Ga0495622_0000304 3300046557 Bacteria 36890
202 Ga0495633_0000204 3300046558 Bacteria 75182
203 Ga0495633_0000261 3300046558 Bacteria 62581
204 Ga0495633_0000342 3300046558 Bacteria 51832
205 Ga0495633_0000689 3300046558 Bacteria 30869
206 Ga0495633_0004503 3300046558 Bacteria 8829
207 Ga0495633_0004610 3300046558 Bacteria 8685
208 Ga0495633_0005107 3300046558 Bacteria 8150
209 Ga0495633_0015247 3300046558 Bacteria 3992
210 Ga0495633_0119751 3300046558 Bacteria 1219
211 Ga0495656_0026025 3300046615 Bacteria 2325
212 Ga0495656_0054987 3300046615 Bacteria 1714
213 Ga0495656_0125875 3300046615 Bacteria 1215
214 Ga0495668_0000266 3300046616 Bacteria 73736
215 Ga0495668_0000388 3300046616 Bacteria 58021
216 Ga0495668_0000919 3300046616 Bacteria 32883
217 Ga0495668_0009177 3300046616 Bacteria 6089
218 Ga0495611_0001023 3300046648 Bacteria 14802
219 Ga0495611_0013402 3300046648 Bacteria 3490
220 Ga0495625_0000530 3300046660 Bacteria 56134
221 Ga0495625_0001918 3300046660 Bacteria 23512
222 Ga0495625_0005084 3300046660 Bacteria 12171
223 Ga0495625_0006041 3300046660 Bacteria 10875
224 Ga0495625_0013189 3300046660 Bacteria 6655
225 Ga0495625_0017660 3300046660 Bacteria 5583
226 Ga0495625_0138115 3300046660 Bacteria 1646
227 Ga0495625_0278229 3300046660 Bacteria 1077
228 Ga0495659_0000030 3300046664 Bacteria 66492
229 Ga0495659_0000569 3300046664 Bacteria 13563
230 Ga0495646_0010736 3300046680 Bacteria 5820
231 Ga0495670_0000767 3300046691 Bacteria 15390
232 Ga0495671_0000086 3300046692 Bacteria 87499
233 Ga0495671_0000639 3300046692 Bacteria 25474
234 Ga0495671_0017757 3300046692 Bacteria 3784
235 Ga0495649_0020208 3300046694 Bacteria 3736
236 Ga0495649_0202895 3300046694 Bacteria 1029
237 Ga0495600_0124232 3300046809 Bacteria 1678
238 Ga0495660_0000002 3300046810 Bacteria 1229481
239 Ga0495660_0000537 3300046810 Bacteria 31055
240 Ga0495660_0002136 3300046810 Bacteria 12758
241 Ga0495660_0004624 3300046810 Bacteria 8301
242 Ga0495660_0024558 3300046810 Bacteria 3432
243 Ga0495660_0090882 3300046810 Bacteria 1587
244 Ga0495660_0098277 3300046810 Bacteria 1510
245 Ga0495636_0001332 3300047318 Bacteria 9376
246 Ga0495672_0000458 3300047320 Bacteria 48213
247 Ga0495672_0000887 3300047320 Bacteria 31459
248 Ga0495672_0011603 3300047320 Bacteria 6206
249 Ga0495672_0013455 3300047320 Bacteria 5645
250 Ga0495683_0010492 3300047323 Bacteria 4893
251 Ga0495683_0055133 3300047323 Bacteria 1979
252 Ga0495687_002998 3300047443 Bacteria 12761
253 Ga0495687_003198 3300047443 Bacteria 12150
254 Ga0495687_003375 3300047443 Bacteria 11653
255 Ga0495677_0033733 3300047445 Bacteria 1865
256 Ga0495679_007839 3300047446 Bacteria 4403
257 Ga0495673_0000057 3300047469 Bacteria 239715
258 Ga0495673_0000060 3300047469 Bacteria 231642
259 Ga0495673_0000098 3300047469 Bacteria 182002
260 Ga0495673_0013098 3300047469 Bacteria 4368
261 Ga0495673_0121580 3300047469 Bacteria 1033
262 Ga0495673_0131877 3300047469 Bacteria 981
263 Ga0495681_0014125 3300047470 Bacteria 4597
264 Ga0495686_0000658 3300047472 Bacteria 46922
265 Ga0495686_0007719 3300047472 Bacteria 8029
266 Ga0495686_0010051 3300047472 Bacteria 6760
267 Ga0495686_0192594 3300047472 Bacteria 1174
268 Ga0495602_0182931 3300048088 Bacteria 1614
269 Ga0495602_0356335 3300048088 Bacteria 1054
270 Ga0496107_0115138 3300048910 Bacteria 1979
271 Ga0496116_0017018 3300048919 Bacteria 5664
272 Ga0496116_0041328 3300048919 Bacteria 3164
273 Ga0496117_0000011 3300048920 Bacteria 610930
274 Ga0496118_0000010 3300048921 Bacteria 610930
275 Ga0496121_0004768 3300048924 Bacteria 17890
276 Ga0496121_0005730 3300048924 Bacteria 15773
277 Ga0496121_0230792 3300048924 Bacteria 1296
278 Ga0496122_0010071 3300048925 Bacteria 9816
279 Ga0496122_0244685 3300048925 Bacteria 1008
280 Ga0496123_0002270 3300048926 Bacteria 24213
281 Ga0496123_0176231 3300048926 Bacteria 1122
282 Ga0496124_0008817 3300048927 Bacteria 10473
283 Ga0496124_0056265 3300048927 Bacteria 3318
284 Ga0496125_0057967 3300048928 Bacteria 3131
285 Ga0496126_0048215 3300048929 Bacteria 3894
286 Ga0496126_0225539 3300048929 Bacteria 1572
287 Ga0495678_000001 3300049459 Bacteria 1060340
288 Ga0495678_000656 3300049459 Bacteria 31738
289 Ga0495678_008773 3300049459 Bacteria 5066
290 Ga0495682_0000545 3300049460 Bacteria 25994
291 Ga0495682_0000858 3300049460 Bacteria 18899
292 Ga0495682_0005199 3300049460 Bacteria 5436
293 Ga0501269_000077 3300049766 Bacteria 30388
294 Ga0501035_0000359 3300049822 Bacteria 52585
295 Ga0501044_0169850 3300049823 Bacteria 2153
296 nmdc:mga0k408_1591_c1 3300050493 Bacteria 12285
297 Ga0500644_0003531 3300053088 Bacteria 3878
298 Ga0500644_0008355 3300053088 Bacteria 2731
299 Ga0500562_018466 3300053108 Bacteria 1801
300 Ga0500593_000217 3300053117 Bacteria 23712
301 Ga0500594_0019834 3300053118 Bacteria 1670
302 Ga0500595_001521 3300053119 Bacteria 12313
303 Ga0500618_000107 3300053125 Bacteria 67707
304 Ga0500618_000384 3300053125 Bacteria 30501
305 Ga0500618_011559 3300053125 Bacteria 2338
306 Ga0500586_000056 3300053145 Bacteria 20046
307 Ga0500586_006588 3300053145 Bacteria 3032
308 Ga0500616_0063769 3300053153 Bacteria 1899
309 Ga0500619_000818 3300053154 Bacteria 5293
310 Ga0500661_003868 3300055283 Bacteria 2810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10046276 rootH1_100462762 247
2 3300003771 Ga0055526_1000096 Ga0055526_100009651 248
3 3300025295 Ga0209564_1000060 Ga0209564_100006034 248
4 3300046558 Ga0495633_0000342 Ga0495633_0000342_15081_15974 249
5 3300047472 Ga0495686_0000658 Ga0495686_0000658_29000_29980 249
6 3300025246 Ga0209646_1000036 Ga0209646_1000036235 250
7 3300046460 Ga0495638_0103349 Ga0495638_0103349_724_1632 250
8 3300046501 Ga0495607_0012604 Ga0495607_0012604_3800_4720 251
9 3300046507 Ga0495606_0000711 Ga0495606_0000711_6146_7033 251
10 3300046512 Ga0495610_0019972 Ga0495610_0019972_1904_2812 252
11 3300046522 Ga0495643_0000257 Ga0495643_0000257_12968_13876 252
12 3300046524 Ga0495648_0046923 Ga0495648_0046923_1173_2081 252
13 3300046538 Ga0495609_0027800 Ga0495609_0027800_972_1880 252
14 3300046694 Ga0495649_0020208 Ga0495649_0020208_747_1655 252
15 3300047320 Ga0495672_0000887 Ga0495672_0000887_6204_7112 252
16 3300049459 Ga0495678_000656 Ga0495678_000656_24397_25305 252
17 3300046460 Ga0495638_0009778 Ga0495638_0009778_5659_6570 253
18 3300046474 Ga0495605_0015965 Ga0495605_0015965_2223_3278 253
19 3300046491 Ga0495584_0000789 Ga0495584_0000789_2236_3147 253
20 3300046492 Ga0495585_0014969 Ga0495585_0014969_781_1743 253
21 3300046506 Ga0495583_0000016 Ga0495583_0000016_197009_197920 253
22 3300046512 Ga0495610_0046727 Ga0495610_0046727_412_1320 253
23 3300046523 Ga0495644_0000229 Ga0495644_0000229_17476_18387 253
24 3300046524 Ga0495648_0000593 Ga0495648_0000593_606_1517 253
25 3300046538 Ga0495609_0001829 Ga0495609_0001829_10028_10939 253
26 3300046558 Ga0495633_0000689 Ga0495633_0000689_5852_6760 253
27 3300046558 Ga0495633_0004610 Ga0495633_0004610_5558_6520 253
28 3300046648 Ga0495611_0013402 Ga0495611_0013402_599_1510 253
29 3300046660 Ga0495625_0278229 Ga0495625_0278229_129_1040 253
30 3300046664 Ga0495659_0000569 Ga0495659_0000569_10314_11225 253
31 3300046691 Ga0495670_0000767 Ga0495670_0000767_4471_5382 253
32 3300047318 Ga0495636_0001332 Ga0495636_0001332_8076_8987 253
33 3300047443 Ga0495687_002998 Ga0495687_002998_8768_9679 253
34 3300047445 Ga0495677_0033733 Ga0495677_0033733_779_1690 253
35 3300049459 Ga0495678_008773 Ga0495678_008773_3238_4293 253
36 3300049460 Ga0495682_0000858 Ga0495682_0000858_17478_18389 253
37 3300053145 Ga0500586_000056 Ga0500586_000056_14432_15340 253
38 3300003771 Ga0055526_1000209 Ga0055526_100020936 255
39 3300003775 Ga0055524_1000049 Ga0055524_1000049115 255
40 3300025263 Ga0209565_1007675 Ga0209565_10076753 255
41 3300025295 Ga0209564_1000027 Ga0209564_1000027205 255
42 3300025299 Ga0209256_1000040 Ga0209256_1000040218 255
43 3300031456 Ga0307513_10104246 Ga0307513_101042463 255
44 3300046492 Ga0495585_0154286 Ga0495585_0154286_214_1095 255
45 3300046492 Ga0495585_0166167 Ga0495585_0166167_245_1126 255
46 3300046512 Ga0495610_0027821 Ga0495610_0027821_1225_2187 255
47 3300046513 Ga0495616_0002853 Ga0495616_0002853_4328_5290 255
48 3300046523 Ga0495644_0011375 Ga0495644_0011375_1008_1874 255
49 3300046615 Ga0495656_0054987 Ga0495656_0054987_25_936 255
50 3300047469 Ga0495673_0121580 Ga0495673_0121580_45_926 255
51 3300046457 Ga0495590_0009581 Ga0495590_0009581_132_1043 256
52 3300046501 Ga0495607_0084206 Ga0495607_0084206_219_1130 256
53 3300047320 Ga0495672_0011603 Ga0495672_0011603_4529_5584 256
54 3300047323 Ga0495683_0010492 Ga0495683_0010492_2777_3832 256
55 3300047469 Ga0495673_0013098 Ga0495673_0013098_2368_3423 256
56 3300025292 Ga0209676_1012769 Ga0209676_10127691 257
57 3300025298 Ga0209050_1021670 Ga0209050_10216702 257
58 3300025304 Ga0209257_1017542 Ga0209257_10175422 257
59 3300046452 Ga0495617_008947 Ga0495617_008947_1107_2018 257
60 3300046492 Ga0495585_0136160 Ga0495585_0136160_322_1233 257
61 3300046501 Ga0495607_0044789 Ga0495607_0044789_778_1689 257
62 3300046523 Ga0495644_0000330 Ga0495644_0000330_9971_10942 257
63 3300046538 Ga0495609_0105374 Ga0495609_0105374_238_1119 257
64 3300046558 Ga0495633_0004503 Ga0495633_0004503_685_1596 257
65 3300046615 Ga0495656_0026025 Ga0495656_0026025_802_1773 257
66 3300046648 Ga0495611_0001023 Ga0495611_0001023_753_1724 257
67 3300046810 Ga0495660_0000537 Ga0495660_0000537_8018_8899 257
68 3300047320 Ga0495672_0013455 Ga0495672_0013455_4614_5525 257
69 3300047472 Ga0495686_0010051 Ga0495686_0010051_62_943 257
70 3300049460 Ga0495682_0000545 Ga0495682_0000545_19387_20298 257
71 3300046501 Ga0495607_0120542 Ga0495607_0120542_263_1129 258
72 3300041999 Ga0439433_0020963 Ga0439433_0020963_358_1212 260
73 3300042007 Ga0439449_0002351 Ga0439449_0002351_6063_6917 260
74 3300042532 Ga0450893_0005577 Ga0450893_0005577_1076_1939 260
75 3300046660 Ga0495625_0005084 Ga0495625_0005084_6117_6986 260
76 3300046810 Ga0495660_0000002 Ga0495660_0000002_750165_751034 261
77 3300053088 Ga0500644_0003531 Ga0500644_0003531_778_1641 261
78 3300006195 Ga0075366_10002051 Ga0075366_100020518 262
79 3300006948 Ga0099826_10000005 Ga0099826_10000005226 262
80 3300048925 Ga0496122_0244685 Ga0496122_0244685_94_945 262
81 3300048926 Ga0496123_0176231 Ga0496123_0176231_259_1110 262
82 3300050493 nmdc:mga0k408_1591_c1 nmdc:mga0k408_1591_c1_3275_4141 262
83 3300046542 Ga0495597_0001433 Ga0495597_0001433_5086_5994 263
84 3300048927 Ga0496124_0008817 Ga0496124_0008817_7804_8670 264
85 3300055283 Ga0500661_003868 Ga0500661_003868_1174_2037 264
86 3300005344 Ga0070661_100245204 Ga0070661_1002452041 265
87 3300025920 Ga0207649_10150990 Ga0207649_101509903 265
88 3300042005 Ga0439448_0039288 Ga0439448_0039288_406_1257 265
89 3300042157 Ga0439458_0018762 Ga0439458_0018762_564_1415 265
90 3300053125 Ga0500618_011559 Ga0500618_011559_1059_1952 267
91 3300053154 Ga0500619_000818 Ga0500619_000818_4233_5090 267
92 3300009148 Ga0105243_10041468 Ga0105243_100414684 272
93 3300025935 Ga0207709_10014227 Ga0207709_100142274 272
94 iso_pu_bacteria 2526164512 2526212024 272
95 3300046660 Ga0495625_0017660 Ga0495625_0017660_3341_4252 273
96 3300048927 Ga0496124_0056265 Ga0496124_0056265_63_914 274
97 3300046501 Ga0495607_0092976 Ga0495607_0092976_193_1074 275
98 iso_pu_bacteria 2600255292 2601669488 275
99 iso_pu_bacteria 2857547612 2857549608 275
100 iso_pu_bacteria 2885080285 2885081419 275
101 iso_pu_bacteria 2932410948 2932414756 275
102 iso_pu_bacteria 2932416698 2932420724 275
103 3300005262 Ga0065165_1002659 Ga0065165_10026598 276
104 3300025273 Ga0209673_1008032 Ga0209673_10080322 276
105 3300046471 Ga0495650_0006328 Ga0495650_0006328_3075_3944 277
106 3300046501 Ga0495607_0003081 Ga0495607_0003081_930_1799 277
107 3300046520 Ga0495637_0000132 Ga0495637_0000132_50358_51227 277
108 3300046530 Ga0495654_0000046 Ga0495654_0000046_144980_145849 277
109 3300046810 Ga0495660_0098277 Ga0495660_0098277_554_1423 277
110 3300046457 Ga0495590_0000011 Ga0495590_0000011_57667_58551 278
111 3300046460 Ga0495638_0000058 Ga0495638_0000058_127572_128456 278
112 3300046471 Ga0495650_0011518 Ga0495650_0011518_3087_3971 278
113 3300046475 Ga0495639_0040034 Ga0495639_0040034_292_1176 278
114 3300046506 Ga0495583_0000886 Ga0495583_0000886_7359_8243 278
115 3300046522 Ga0495643_0000230 Ga0495643_0000230_27438_28322 278
116 3300046524 Ga0495648_0000082 Ga0495648_0000082_59246_60130 278
117 3300046542 Ga0495597_0000351 Ga0495597_0000351_27441_28325 278
118 3300046557 Ga0495622_0000304 Ga0495622_0000304_21078_21962 278
119 3300046558 Ga0495633_0000261 Ga0495633_0000261_3850_4734 278
120 3300046616 Ga0495668_0000266 Ga0495668_0000266_16123_17007 278
121 3300046660 Ga0495625_0000530 Ga0495625_0000530_27702_28586 278
122 3300046810 Ga0495660_0024558 Ga0495660_0024558_1008_1892 278
123 3300047443 Ga0495687_003198 Ga0495687_003198_562_1446 278
124 3300047443 Ga0495687_003375 Ga0495687_003375_562_1446 278
125 3300003771 Ga0055526_1003187 Ga0055526_10031874 279
126 3300003773 Ga0055537_1000004 Ga0055537_100000458 279
127 3300003784 Ga0055534_1000266 Ga0055534_100026626 279
128 3300003790 Ga0055528_1000203 Ga0055528_100020311 279
129 3300014497 Ga0182008_10009515 Ga0182008_100095153 279
130 3300015261 Ga0182006_1000004 Ga0182006_1000004324 279
131 3300015262 Ga0182007_10000018 Ga0182007_1000001847 279
132 3300015265 Ga0182005_1000011 Ga0182005_100001157 279
133 3300025263 Ga0209565_1000018 Ga0209565_100001873 279
134 3300025273 Ga0209673_1000090 Ga0209673_1000090104 279
135 3300025291 Ga0209675_1000005 Ga0209675_100000573 279
136 3300025295 Ga0209564_1000078 Ga0209564_1000078191 279
137 3300025299 Ga0209256_1000070 Ga0209256_1000070212 279
138 3300031548 Ga0307408_100001741 Ga0307408_1000017416 279
139 3300031901 Ga0307406_10000381 Ga0307406_1000038115 279
140 3300044706 Ga0466964_0018490 Ga0466964_0018490_639_1490 279
141 3300045051 Ga0451576_0001125 Ga0451576_0001125_19233_20108 279
142 3300045051 Ga0451576_0149280 Ga0451576_0149280_245_1120 279
143 3300045976 Ga0466967_0595963 Ga0466967_0595963_89_940 279
144 3300046558 Ga0495633_0000204 Ga0495633_0000204_27859_28722 279
145 3300048919 Ga0496116_0041328 Ga0496116_0041328_656_1570 279
146 3300048920 Ga0496117_0000011 Ga0496117_0000011_367111_368025 279
147 3300048921 Ga0496118_0000010 Ga0496118_0000010_242906_243820 279
148 3300048924 Ga0496121_0004768 Ga0496121_0004768_3535_4449 279
149 3300048924 Ga0496121_0005730 Ga0496121_0005730_4281_5144 279
150 3300048925 Ga0496122_0010071 Ga0496122_0010071_3645_4559 279
151 3300048926 Ga0496123_0002270 Ga0496123_0002270_13586_14500 279
152 3300048928 Ga0496125_0057967 Ga0496125_0057967_1821_2735 279
153 3300048929 Ga0496126_0225539 Ga0496126_0225539_385_1248 279
154 3300049460 Ga0495682_0005199 Ga0495682_0005199_1022_1885 279
155 3300003322 rootL2_10005365 rootL2_100053652 280
156 3300031344 Ga0265316_10018525 Ga0265316_100185251 280
157 3300044712 Ga0453684_0013542 Ga0453684_0013542_5919_6782 280
158 iso_pu_bacteria 2857553236 2857558566 280
159 iso_pu_bacteria 2919476304 2919480821 280
160 3300006946 Ga0079104_1009752 Ga0079104_10097522 281
161 3300027111 Ga0209281_1015013 Ga0209281_10150132 281
162 3300053125 Ga0500618_000107 Ga0500618_000107_52102_52953 281
163 iso_pu_bacteria 2521172590 2521560497 281
164 iso_pu_bacteria 2551306416 2553005612 281
165 iso_pu_bacteria 2738541280 2738742664 281
166 iso_pu_bacteria 2738541297 2738827250 281
167 iso_pu_bacteria 2738541300 2738846578 281
168 iso_pu_bacteria 2738541357 2739151047 281
169 iso_pu_bacteria 2738543003 2739192966 281
170 iso_pu_bacteria 2738543018 2739277220 281
171 iso_pu_bacteria 2738543026 2739319443 281
172 iso_pu_bacteria 2738543029 2739337684 281
173 iso_pu_bacteria 2738543030 2739346220 281
174 iso_pu_bacteria 2818991449 2819617174 281
175 iso_pu_bacteria 2821131069 2821134608 281
176 iso_pu_bacteria 2842711865 2842715152 281
177 iso_pu_bacteria 2857558681 2857560480 281
178 iso_pu_bacteria 2857564685 2857568939 281
179 iso_pu_bacteria 2857576091 2857576833 281
180 iso_pu_bacteria 2904424332 2904430237 281
181 iso_pu_bacteria 2904439833 2904442805 281
182 iso_pu_bacteria 2904530477 2904534982 281
183 iso_pu_bacteria 2904584206 2904588680 281
184 iso_pu_bacteria 2904589729 2904594246 281
185 iso_pu_bacteria 2904601388 2904604914 281
186 iso_pu_bacteria 2919046199 2919048684 281
187 iso_pu_bacteria 2919079590 2919083150 281
188 iso_pu_bacteria 2923510766 2923514281 281
189 iso_pu_bacteria 2928130867 2928133004 281
190 3300046615 Ga0495656_0125875 Ga0495656_0125875_280_1140 282
191 3300031251 Ga0265327_10000116 Ga0265327_1000011661 283
192 3300042876 Ga0451577_0170524 Ga0451577_0170524_778_1638 283
193 3300005337 Ga0070682_100009855 Ga0070682_1000098553 284
194 3300006946 Ga0079104_1004792 Ga0079104_10047926 284
195 3300015261 Ga0182006_1000211 Ga0182006_100021113 284
196 3300015262 Ga0182007_10079803 Ga0182007_100798032 284
197 3300015265 Ga0182005_1000005 Ga0182005_1000005249 284
198 3300028794 Ga0307515_10057685 Ga0307515_100576856 284
199 3300031456 Ga0307513_10101054 Ga0307513_101010542 284
200 3300031456 Ga0307513_10143869 Ga0307513_101438693 284
201 3300037418 Ga0395900_0000322 Ga0395900_0000322_49089_49967 284
202 3300038443 Ga0395901_0000332 Ga0395901_0000332_7671_8537 284
203 3300044658 Ga0466972_0034289 Ga0466972_0034289_633_1499 284
204 3300044683 Ga0466965_0062630 Ga0466965_0062630_707_1573 284
205 3300044765 Ga0466970_0245245 Ga0466970_0245245_113_979 284
206 3300046522 Ga0495643_0073077 Ga0495643_0073077_490_1356 284
207 3300046522 Ga0495643_0098371 Ga0495643_0098371_371_1237 284
208 3300046538 Ga0495609_0000684 Ga0495609_0000684_22198_23064 284
209 3300046694 Ga0495649_0202895 Ga0495649_0202895_65_931 284
210 3300046810 Ga0495660_0002136 Ga0495660_0002136_3045_3911 284
211 3300047470 Ga0495681_0014125 Ga0495681_0014125_709_1575 284
212 3300049459 Ga0495678_000001 Ga0495678_000001_197223_198089 284
213 3300049822 Ga0501035_0000359 Ga0501035_0000359_41493_42371 284
214 3300049823 Ga0501044_0169850 Ga0501044_0169850_301_1167 284
215 3300053088 Ga0500644_0008355 Ga0500644_0008355_1007_1879 284
216 3300053108 Ga0500562_018466 Ga0500562_018466_837_1709 284
217 3300053145 Ga0500586_006588 Ga0500586_006588_597_1469 284
218 3300053153 Ga0500616_0063769 Ga0500616_0063769_388_1260 284
219 3300002737 JGI25162J39368_1000271 JGI25162J39368_100027143 285
220 3300003751 Ga0055538_1000024 Ga0055538_1000024200 285
221 3300003752 Ga0055539_1000031 Ga0055539_1000031200 285
222 3300003756 Ga0055533_1000041 Ga0055533_1000041200 285
223 3300003759 Ga0055525_1000049 Ga0055525_1000049200 285
224 3300003763 Ga0055529_1000119 Ga0055529_100011984 285
225 3300003771 Ga0055526_1000176 Ga0055526_100017624 285
226 3300003773 Ga0055537_1000211 Ga0055537_100021111 285
227 3300003841 Ga0055541_1000022 Ga0055541_1000022200 285
228 3300005288 Ga0065714_10006304 Ga0065714_100063043 285
229 3300005563 Ga0068855_100000235 Ga0068855_10000023544 285
230 3300005578 Ga0068854_100016532 Ga0068854_1000165323 285
231 3300006038 Ga0075365_10028387 Ga0075365_100283873 285
232 3300006048 Ga0075363_100035378 Ga0075363_1000353782 285
233 3300006177 Ga0075362_10018627 Ga0075362_100186272 285
234 3300009036 Ga0105244_10009071 Ga0105244_100090717 285
235 3300009036 Ga0105244_10009884 Ga0105244_100098842 285
236 3300009551 Ga0105238_10000355 Ga0105238_1000035510 285
237 3300015261 Ga0182006_1009547 Ga0182006_10095473 285
238 3300015261 Ga0182006_1020621 Ga0182006_10206212 285
239 3300021361 Ga0213872_10000094 Ga0213872_1000009470 285
240 3300021361 Ga0213872_10001281 Ga0213872_100012815 285
241 3300021361 Ga0213872_10004485 Ga0213872_100044856 285
242 3300021361 Ga0213872_10009586 Ga0213872_100095864 285
243 3300021361 Ga0213872_10030778 Ga0213872_100307782 285
244 3300025224 Ga0209784_100018 Ga0209784_100018198 285
245 3300025225 Ga0209566_100016 Ga0209566_100016198 285
246 3300025226 Ga0209674_100030 Ga0209674_100030198 285
247 3300025230 Ga0209563_100034 Ga0209563_100034198 285
248 3300025253 Ga0209677_100019 Ga0209677_100019198 285
249 3300025272 Ga0209455_1000047 Ga0209455_1000047143 285
250 3300025295 Ga0209564_1000348 Ga0209564_100034832 285
251 3300025297 Ga0209758_1000895 Ga0209758_100089527 285
252 3300025728 Ga0207655_1005724 Ga0207655_10057242 285
253 3300025728 Ga0207655_1010164 Ga0207655_10101645 285
254 3300025913 Ga0207695_10001464 Ga0207695_1000146423 285
255 3300025924 Ga0207694_10000236 Ga0207694_1000023644 285
256 3300025949 Ga0207667_10000110 Ga0207667_1000011019 285
257 3300025949 Ga0207667_10016063 Ga0207667_1001606311 285
258 3300025981 Ga0207640_10006452 Ga0207640_100064526 285
259 3300026116 Ga0207674_10163052 Ga0207674_101630522 285
260 3300028794 Ga0307515_10177553 Ga0307515_101775532 285
261 3300031548 Ga0307408_100239109 Ga0307408_1002391092 285
262 3300031649 Ga0307514_10000921 Ga0307514_1000092114 285
263 3300031711 Ga0265314_10020332 Ga0265314_100203322 285
264 3300037068 Ga0373925_0075160 Ga0373925_0075160_122_1000 285
265 3300039447 Ga0436361_0230276 Ga0436361_0230276_1590_2459 285
266 3300039447 Ga0436361_0398531 Ga0436361_0398531_5837_6706 285
267 3300039447 Ga0436361_0512044 Ga0436361_0512044_2243_3112 285
268 3300039447 Ga0436361_0582636 Ga0436361_0582636_6881_7750 285
269 3300039447 Ga0436361_0643209 Ga0436361_0643209_3956_4825 285
270 3300041404 Ga0439436_0074688 Ga0439436_0074688_22_933 285
271 3300041413 Ga0439465_0016194 Ga0439465_0016194_76_987 285
272 3300044842 Ga0466957_0072213 Ga0466957_0072213_1056_1916 285
273 3300046452 Ga0495617_000005 Ga0495617_000005_201542_202441 285
274 3300046452 Ga0495617_027449 Ga0495617_027449_717_1625 285
275 3300046453 Ga0495627_029242 Ga0495627_029242_309_1205 285
276 3300046454 Ga0495592_0027271 Ga0495592_0027271_1049_1906 285
277 3300046460 Ga0495638_0131354 Ga0495638_0131354_59_955 285
278 3300046462 Ga0495651_0039301 Ga0495651_0039301_2532_3422 285
279 3300046462 Ga0495651_0262170 Ga0495651_0262170_77_934 285
280 3300046463 Ga0495653_0000008 Ga0495653_0000008_6564_7478 285
281 3300046463 Ga0495653_0008157 Ga0495653_0008157_3174_4031 285
282 3300046471 Ga0495650_0000109 Ga0495650_0000109_14299_15168 285
283 3300046471 Ga0495650_0000464 Ga0495650_0000464_5223_6119 285
284 3300046471 Ga0495650_0001067 Ga0495650_0001067_27700_28599 285
285 3300046471 Ga0495650_0005944 Ga0495650_0005944_5523_6419 285
286 3300046492 Ga0495585_0001913 Ga0495585_0001913_6996_7895 285
287 3300046507 Ga0495606_0000048 Ga0495606_0000048_203318_204232 285
288 3300046507 Ga0495606_0000276 Ga0495606_0000276_57362_58255 285
289 3300046507 Ga0495606_0001095 Ga0495606_0001095_31969_32877 285
290 3300046507 Ga0495606_0001130 Ga0495606_0001130_13178_14119 285
291 3300046507 Ga0495606_0001538 Ga0495606_0001538_13214_14083 285
292 3300046507 Ga0495606_0014741 Ga0495606_0014741_2100_3008 285
293 3300046507 Ga0495606_0022444 Ga0495606_0022444_97_978 285
294 3300046511 Ga0495608_0007994 Ga0495608_0007994_2447_3304 285
295 3300046512 Ga0495610_0000007 Ga0495610_0000007_16444_17340 285
296 3300046512 Ga0495610_0006360 Ga0495610_0006360_2615_3523 285
297 3300046512 Ga0495610_0007211 Ga0495610_0007211_710_1603 285
298 3300046512 Ga0495610_0040365 Ga0495610_0040365_585_1454 285
299 3300046516 Ga0495628_0454806 Ga0495628_0454806_49_906 285
300 3300046524 Ga0495648_0010565 Ga0495648_0010565_163_1059 285
301 3300046524 Ga0495648_0015927 Ga0495648_0015927_4372_5271 285
302 3300046524 Ga0495648_0100804 Ga0495648_0100804_557_1471 285
303 3300046528 Ga0495642_0026876 Ga0495642_0026876_1379_2248 285
304 3300046530 Ga0495654_0009968 Ga0495654_0009968_221_1120 285
305 3300046530 Ga0495654_0029444 Ga0495654_0029444_925_1806 285
306 3300046542 Ga0495597_0002345 Ga0495597_0002345_7480_8361 285
307 3300046557 Ga0495622_0000036 Ga0495622_0000036_53542_54411 285
308 3300046558 Ga0495633_0005107 Ga0495633_0005107_2291_3184 285
309 3300046558 Ga0495633_0015247 Ga0495633_0015247_788_1657 285
310 3300046558 Ga0495633_0119751 Ga0495633_0119751_273_1166 285
311 3300046616 Ga0495668_0000388 Ga0495668_0000388_31225_32118 285
312 3300046616 Ga0495668_0000919 Ga0495668_0000919_3671_4570 285
313 3300046616 Ga0495668_0009177 Ga0495668_0009177_76_972 285
314 3300046660 Ga0495625_0001918 Ga0495625_0001918_19133_20029 285
315 3300046660 Ga0495625_0006041 Ga0495625_0006041_9159_10040 285
316 3300046660 Ga0495625_0013189 Ga0495625_0013189_1131_2039 285
317 3300046660 Ga0495625_0138115 Ga0495625_0138115_66_965 285
318 3300046664 Ga0495659_0000030 Ga0495659_0000030_6597_7478 285
319 3300046680 Ga0495646_0010736 Ga0495646_0010736_2585_3442 285
320 3300046692 Ga0495671_0000086 Ga0495671_0000086_68482_69363 285
321 3300046692 Ga0495671_0000639 Ga0495671_0000639_5366_6262 285
322 3300046692 Ga0495671_0017757 Ga0495671_0017757_634_1533 285
323 3300046809 Ga0495600_0124232 Ga0495600_0124232_745_1602 285
324 3300046810 Ga0495660_0004624 Ga0495660_0004624_124_1023 285
325 3300046810 Ga0495660_0090882 Ga0495660_0090882_319_1200 285
326 3300047320 Ga0495672_0000458 Ga0495672_0000458_35067_35948 285
327 3300047323 Ga0495683_0055133 Ga0495683_0055133_65_964 285
328 3300047446 Ga0495679_007839 Ga0495679_007839_512_1411 285
329 3300047469 Ga0495673_0000057 Ga0495673_0000057_217206_218108 285
330 3300047469 Ga0495673_0000060 Ga0495673_0000060_183475_184353 285
331 3300047469 Ga0495673_0000098 Ga0495673_0000098_176960_177859 285
332 3300047469 Ga0495673_0131877 Ga0495673_0131877_23_901 285
333 3300047472 Ga0495686_0007719 Ga0495686_0007719_2050_2943 285
334 3300047472 Ga0495686_0192594 Ga0495686_0192594_59_958 285
335 3300048088 Ga0495602_0182931 Ga0495602_0182931_214_1071 285
336 3300048088 Ga0495602_0356335 Ga0495602_0356335_121_978 285
337 3300048910 Ga0496107_0115138 Ga0496107_0115138_977_1873 285
338 3300048919 Ga0496116_0017018 Ga0496116_0017018_3529_4452 285
339 3300048924 Ga0496121_0230792 Ga0496121_0230792_38_934 285
340 3300048929 Ga0496126_0048215 Ga0496126_0048215_1987_2889 285
341 3300049766 Ga0501269_000077 Ga0501269_000077_21505_22404 285
342 3300053117 Ga0500593_000217 Ga0500593_000217_13511_14374 285
343 3300053118 Ga0500594_0019834 Ga0500594_0019834_340_1239 285
344 3300053119 Ga0500595_001521 Ga0500595_001521_3671_4528 285
345 3300053125 Ga0500618_000384 Ga0500618_000384_10513_11412 285

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wt9-assembly1.cif.gz_A acinetobacter baumanii nicotinamidase pyrazinamidease 0.8416 3 279
2wt9-assembly1.cif.gz_A acinetobacter baumanii nicotinamidase pyrazinamidease 0.8228 3 279
3r2j-assembly2.cif.gz_C crystal structure of pnc1 from l. infantum in complex with nicotinate 0.8182 1 277
1im5-assembly1.cif.gz_A crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc 0.7975 4 275
3hb7-assembly4.cif.gz_H the crystal structure of an isochorismatase-like hydrolase from alkaliphilus metalliredigens to 2.3a 0.7969 4 282
ID Description Score Start End Superfamily
2wt9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8416 3 279 3.40.50.850
2wt9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8228 3 279 3.40.50.850
af_Q54BH7_1_207_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8152 5 282 3.40.50.850
3r2jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8094 1 277 3.40.50.850
af_Q54BH7_1_207_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8041 5 282 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A5B8E9J5-F1-model_v4 deleted 0.9874 1 284
AF-A0A846T4B1-F1-model_v4 Isochorismatase-like domain-containing protein 0.9841 4 277 GO:0016787
AF-A0A1I4KTG7-F1-model_v4 Nicotinamidase-related amidase 0.9814 1 283 GO:0016787
AF-A0A7H0T830-F1-model_v4 deleted 0.9811 2 276
AF-A0A5B8E9J5-F1-model_v4 deleted 0.9806 1 284

Feature Viewer

pLDDT pTM Quality
94.13 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map