F416509

General Info

Members Datasets Scaffolds Average Seq Length
345 211 331 258

Family's Representative Sequence

Representative Sequence 3300046679|Ga0495623_0223489|Ga0495623_0223489_80_994
Length 304
Sequence MKWMQWNKSQTAAANPPVWKCWPFIYVKIPSWSEPSTAADGAGGVLLKRANRYWRVLATGFSFVLFAVGGLLLRVTVFPVMNLLIWERQLRISAARRVIRLAFRGFVGCMRWLGVLNYEISGLERLERQGLLILANHPTLIDTVFLMAFVKRADCIVKDRLWDNPFTRGPVSAAGYISNDRGSGLIEDCISSLRRGSNLIVFPEGTRTDGDGQISLKRGAANIAVRSLSNVTPVVIRCLPPTLGKGSKWWQVPPVAAHFSIEVKEDIDVHEFLAKAGSEVLAARHLTAHLQDYFRKESQGYAAA

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
3 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
4 2818991436 Collimonas arenae 515 Isolate Unclassified
5 2842711865 Duganella sp. R-73148 Isolate Unclassified
6 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
7 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
8 2857553236 Duganella sp. R-74557 Isolate Unclassified
9 2857558681 Duganella sp. R-74565 Isolate Unclassified
10 2857564685 Duganella sp. R-74599 Isolate Unclassified
11 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
12 2904424332 Duganella sp. 1411 Isolate Rhizosphere
13 2919476304 Duganella sp. 3397 Isolate Unclassified
14 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
15 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
16 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
17 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
18 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
22 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
23 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
24 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
50 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
79 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
82 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
83 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
84 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
97 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
98 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
99 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
121 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
125 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
129 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
130 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
133 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
140 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
160 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
161 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
173 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
174 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
197 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
198 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
199 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
206 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
207 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
208 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
209 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
211 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.94
Metatranscriptomes 0
Isolates 4.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.01
Nodule 0.58
Rhizoplane 2.9
Rhizosphere 78.55
Stem 0
Stem Tuber 0
Unclassified 6.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000015 3300002737 Bacteria 316381
2 JGI25154J39366_1004259 3300002738 Bacteria 2624
3 JGI25163J39215_1001995 3300002771 Bacteria 2504
4 JGI25152J39213_1000052 3300002773 Bacteria 77690
5 JGI25150J39212_1000260 3300002774 Bacteria 28066
6 JGI25150J39212_1005558 3300002774 Bacteria 2681
7 JGI25165J46597_1000001 3300003214 Bacteria 1111887
8 JGI25153J46596_10005812 3300003215 Bacteria 6414
9 Ga0055538_1000001 3300003751 Bacteria 1111887
10 Ga0055539_1000001 3300003752 Bacteria 1111887
11 Ga0055533_1000003 3300003756 Bacteria 1111887
12 Ga0055525_1000087 3300003759 Bacteria 149803
13 Ga0055526_1000100 3300003771 Bacteria 76578
14 Ga0055524_1001361 3300003775 Bacteria 14184
15 Ga0055541_1000001 3300003841 Bacteria 1111887
16 Ga0070682_100005736 3300005337 Bacteria 6925
17 Ga0070660_100151996 3300005339 Bacteria 1862
18 Ga0070661_100004150 3300005344 Bacteria 9993
19 Ga0070659_100008146 3300005366 Bacteria 7642
20 Ga0070708_100011230 3300005445 Bacteria 7282
21 Ga0070663_100202007 3300005455 Bacteria 1552
22 Ga0070662_100060360 3300005457 Unclassified 2765
23 Ga0070706_100046532 3300005467 Bacteria 4005
24 Ga0070707_100210488 3300005468 Bacteria 1895
25 Ga0070697_100007952 3300005536 Bacteria 8265
26 Ga0068855_100028435 3300005563 Bacteria 6688
27 Ga0070664_100185253 3300005564 Bacteria 1852
28 Ga0070716_100021742 3300006173 Bacteria 3383
29 Ga0079104_1009935 3300006946 Bacteria 3178
30 Ga0105244_10004503 3300009036 Bacteria 9568
31 Ga0105244_10020520 3300009036 Bacteria 3669
32 Ga0114129_10002450 3300009147 Bacteria 25774
33 Ga0105241_10088450 3300009174 Bacteria 2439
34 Ga0105242_10009643 3300009176 Bacteria 7399
35 Ga0157374_10034738 3300013296 Bacteria 4608
36 Ga0163162_10268593 3300013306 Bacteria 1837
37 Ga0182008_10000203 3300014497 Bacteria 46755
38 Ga0182006_1000002 3300015261 Bacteria 887990
39 Ga0182005_1000013 3300015265 Bacteria 396391
40 Ga0182005_1000070 3300015265 Bacteria 85687
41 Ga0182005_1000227 3300015265 Bacteria 37208
42 Ga0163161_10100817 3300017792 Bacteria 2149
43 Ga0209760_101839 3300025207 Bacteria 2102
44 Ga0209784_100004 3300025224 Bacteria 1378156
45 Ga0209566_100004 3300025225 Bacteria 1531866
46 Ga0209674_100006 3300025226 Bacteria 1531866
47 Ga0209672_101805 3300025228 Bacteria 6548
48 Ga0209563_100009 3300025230 Bacteria 1378156
49 Ga0207427_100459 3300025231 Bacteria 22499
50 Ga0209437_100004 3300025233 Bacteria 1378156
51 Ga0207425_1000001 3300025245 Bacteria 2525432
52 Ga0207425_1000484 3300025245 Bacteria 25043
53 Ga0209646_1000010 3300025246 Bacteria 573803
54 Ga0209026_1004451 3300025250 Bacteria 4141
55 Ga0209677_100005 3300025253 Bacteria 1378156
56 Ga0209129_1000001 3300025258 Bacteria 1452436
57 Ga0209233_1000005 3300025261 Bacteria 1531866
58 Ga0209025_1003379 3300025294 Bacteria 15255
59 Ga0209564_1000009 3300025295 Bacteria 950196
60 Ga0209564_1000045 3300025295 Bacteria 376549
61 Ga0209758_1000166 3300025297 Bacteria 151104
62 Ga0209758_1000489 3300025297 Bacteria 64758
63 Ga0209256_1000350 3300025299 Bacteria 74944
64 Ga0207654_10050086 3300025911 Bacteria 2398
65 Ga0207657_10020487 3300025919 Bacteria 6247
66 Ga0207657_10056977 3300025919 Bacteria 3370
67 Ga0207649_10008040 3300025920 Bacteria 5743
68 Ga0207649_10488926 3300025920 Bacteria 934
69 Ga0207690_10017184 3300025932 Bacteria 4414
70 Ga0207686_10244790 3300025934 Bacteria 1307
71 Ga0207665_10039518 3300025939 Bacteria 3145
72 Ga0207689_10055231 3300025942 Bacteria 3269
73 Ga0207667_10022603 3300025949 Bacteria 6941
74 Ga0209281_1007260 3300027111 Bacteria 2793
75 Ga0209973_1000747 3300027252 Bacteria 2597
76 Ga0307515_10008778 3300028794 Bacteria 19640
77 Ga0307515_10154267 3300028794 Bacteria 2381
78 Ga0316177_1172584 3300030731 Bacteria 1139
79 Ga0314311_1188587 3300030733 Bacteria 1091
80 Ga0316181_1155464 3300030744 Bacteria 8057
81 Ga0316182_1353000 3300030745 Bacteria 2076
82 Ga0307408_100098769 3300031548 Bacteria 2220
83 Ga0307516_10003778 3300031730 Bacteria 19239
84 Ga0307405_10105091 3300031731 Bacteria 1901
85 Ga0307412_10132058 3300031911 Bacteria 1815
86 Ga0307416_100213961 3300032002 Bacteria 1841
87 Ga0307411_10043757 3300032005 Bacteria 2867
88 Ga0395899_0075534 3300037312 Bacteria 2460
89 Ga0395900_0014151 3300037418 Bacteria 8147
90 Ga0395900_0072494 3300037418 Bacteria 3540
91 Ga0395898_0111616 3300037466 Bacteria 2620
92 Ga0395898_0124368 3300037466 Bacteria 2471
93 Ga0395898_0315936 3300037466 Bacteria 1490
94 Ga0395905_0034540 3300037471 Bacteria 4748
95 Ga0395905_0384510 3300037471 Bacteria 1297
96 Ga0395901_0000033 3300038443 Bacteria 232357
97 Ga0395901_0301110 3300038443 Bacteria 1662
98 Ga0395901_0499498 3300038443 Bacteria 1238
99 Ga0436361_0715686 3300039447 Bacteria 8398
100 Ga0439448_0001668 3300042005 Bacteria 5823
101 Ga0439448_0017001 3300042005 Bacteria 2218
102 Ga0439455_0004502 3300042012 Bacteria 2764
103 Ga0439458_0057199 3300042157 Bacteria 969
104 Ga0466965_0006865 3300044683 Bacteria 5202
105 Ga0466965_0037658 3300044683 Bacteria 2375
106 Ga0466966_0048702 3300044684 Bacteria 2699
107 Ga0466961_0036223 3300044693 Bacteria 3167
108 Ga0466964_0000157 3300044706 Bacteria 18655
109 Ga0466970_0179137 3300044765 Bacteria 1176
110 Ga0466957_0005776 3300044842 Bacteria 6953
111 Ga0466957_0035160 3300044842 Bacteria 3007
112 Ga0466959_0037085 3300045049 Bacteria 3601
113 Ga0466958_0087841 3300045836 Bacteria 1920
114 Ga0466967_0022665 3300045976 Bacteria 5131
115 Ga0495603_0025584 3300046455 Bacteria 3569
116 Ga0495590_0000003 3300046457 Bacteria 478593
117 Ga0495590_0024568 3300046457 Bacteria 2123
118 Ga0495638_0000091 3300046460 Bacteria 146548
119 Ga0495638_0032890 3300046460 Bacteria 3319
120 Ga0495638_0048943 3300046460 Bacteria 2644
121 Ga0495651_0006021 3300046462 Bacteria 9260
122 Ga0495653_0000013 3300046463 Bacteria 250453
123 Ga0495653_0001055 3300046463 Bacteria 21226
124 Ga0495653_0038844 3300046463 Bacteria 3734
125 Ga0495650_0000097 3300046471 Bacteria 216051
126 Ga0495650_0001058 3300046471 Bacteria 30529
127 Ga0495650_0003792 3300046471 Bacteria 10770
128 Ga0495650_0005750 3300046471 Bacteria 7919
129 Ga0495650_0036146 3300046471 Bacteria 2165
130 Ga0495580_0043058 3300046472 Bacteria 3214
131 Ga0495605_0000237 3300046474 Bacteria 66607
132 Ga0495605_0004340 3300046474 Bacteria 8343
133 Ga0495605_0019984 3300046474 Bacteria 3565
134 Ga0495584_0000021 3300046491 Bacteria 130377
135 Ga0495584_0018503 3300046491 Bacteria 3541
136 Ga0495584_0092989 3300046491 Bacteria 1521
137 Ga0495584_0105372 3300046491 Bacteria 1425
138 Ga0495585_0002213 3300046492 Bacteria 14101
139 Ga0495585_0033332 3300046492 Bacteria 2915
140 Ga0495585_0043835 3300046492 Bacteria 2500
141 Ga0495585_0180986 3300046492 Bacteria 1083
142 Ga0495594_0001115 3300046499 Bacteria 14012
143 Ga0495594_0001246 3300046499 Bacteria 13339
144 Ga0495594_0036691 3300046499 Bacteria 2673
145 Ga0495594_0051830 3300046499 Bacteria 2258
146 Ga0495607_0002140 3300046501 Bacteria 16475
147 Ga0495607_0005541 3300046501 Bacteria 9007
148 Ga0495607_0016045 3300046501 Bacteria 4840
149 Ga0495607_0019369 3300046501 Bacteria 4324
150 Ga0495607_0027873 3300046501 Bacteria 3487
151 Ga0495607_0059960 3300046501 Bacteria 2167
152 Ga0495583_0000155 3300046506 Bacteria 114870
153 Ga0495583_0000197 3300046506 Bacteria 101236
154 Ga0495583_0002755 3300046506 Bacteria 14519
155 Ga0495583_0028812 3300046506 Bacteria 2725
156 Ga0495606_0000141 3300046507 Bacteria 123586
157 Ga0495606_0000266 3300046507 Bacteria 92444
158 Ga0495606_0000371 3300046507 Bacteria 76806
159 Ga0495606_0000696 3300046507 Bacteria 52177
160 Ga0495606_0001419 3300046507 Bacteria 32193
161 Ga0495606_0002432 3300046507 Bacteria 21688
162 Ga0495608_0020505 3300046511 Bacteria 4543
163 Ga0495610_0000003 3300046512 Bacteria 1203910
164 Ga0495610_0002073 3300046512 Bacteria 17105
165 Ga0495610_0003707 3300046512 Bacteria 11708
166 Ga0495610_0004426 3300046512 Bacteria 10394
167 Ga0495610_0011693 3300046512 Bacteria 5339
168 Ga0495610_0020097 3300046512 Bacteria 3715
169 Ga0495616_0007652 3300046513 Bacteria 6462
170 Ga0495618_0062649 3300046514 Bacteria 2360
171 Ga0495628_0004418 3300046516 Bacteria 12467
172 Ga0495628_0193575 3300046516 Bacteria 1535
173 Ga0495637_0000087 3300046520 Bacteria 72113
174 Ga0495637_0001405 3300046520 Bacteria 14249
175 Ga0495643_0000179 3300046522 Bacteria 100406
176 Ga0495643_0006330 3300046522 Bacteria 7823
177 Ga0495643_0007639 3300046522 Bacteria 6942
178 Ga0495644_0003276 3300046523 Bacteria 6403
179 Ga0495644_0015254 3300046523 Bacteria 2942
180 Ga0495648_0000058 3300046524 Bacteria 156717
181 Ga0495648_0003974 3300046524 Bacteria 12794
182 Ga0495648_0040255 3300046524 Bacteria 2965
183 Ga0495666_0002872 3300046526 Bacteria 8631
184 Ga0495666_0092058 3300046526 Bacteria 1430
185 Ga0495666_0162966 3300046526 Bacteria 1033
186 Ga0495642_0003894 3300046528 Bacteria 5850
187 Ga0495652_0004031 3300046529 Bacteria 14208
188 Ga0495652_0017800 3300046529 Bacteria 6341
189 Ga0495654_0000074 3300046530 Bacteria 114325
190 Ga0495654_0025930 3300046530 Bacteria 3018
191 Ga0495665_0045193 3300046531 Bacteria 2339
192 Ga0495665_0128725 3300046531 Bacteria 1325
193 Ga0495665_0148888 3300046531 Bacteria 1222
194 Ga0495586_0016407 3300046535 Bacteria 3939
195 Ga0495586_0027395 3300046535 Bacteria 3050
196 Ga0495586_0257877 3300046535 Bacteria 995
197 Ga0495587_0074097 3300046536 Bacteria 1977
198 Ga0495609_0000039 3300046538 Bacteria 179384
199 Ga0495609_0005728 3300046538 Bacteria 6465
200 Ga0495609_0042363 3300046538 Bacteria 2044
201 Ga0495597_0000209 3300046542 Bacteria 53295
202 Ga0495597_0000242 3300046542 Bacteria 49561
203 Ga0495645_0050901 3300046543 Bacteria 3014
204 Ga0495645_0353001 3300046543 Bacteria 947
205 Ga0495622_0006805 3300046557 Bacteria 5304
206 Ga0495622_0060418 3300046557 Bacteria 1755
207 Ga0495633_0000249 3300046558 Bacteria 64232
208 Ga0495633_0002342 3300046558 Bacteria 13463
209 Ga0495633_0035907 3300046558 Bacteria 2377
210 Ga0495633_0053237 3300046558 Bacteria 1905
211 Ga0495633_0089332 3300046558 Bacteria 1432
212 Ga0495656_0004425 3300046615 Bacteria 4813
213 Ga0495668_0000466 3300046616 Bacteria 51377
214 Ga0495668_0000935 3300046616 Bacteria 32582
215 Ga0495611_0013556 3300046648 Bacteria 3472
216 Ga0495611_0022007 3300046648 Bacteria 2756
217 Ga0495611_0068446 3300046648 Bacteria 1620
218 Ga0495611_0075700 3300046648 Bacteria 1542
219 Ga0495625_0000132 3300046660 Bacteria 115728
220 Ga0495625_0000139 3300046660 Bacteria 112271
221 Ga0495625_0002129 3300046660 Bacteria 22079
222 Ga0495625_0026955 3300046660 Bacteria 4332
223 Ga0495625_0042210 3300046660 Bacteria 3316
224 Ga0495625_0049280 3300046660 Bacteria 3029
225 Ga0495635_0298565 3300046663 Bacteria 1080
226 Ga0495659_0012250 3300046664 Bacteria 2775
227 Ga0495661_0000094 3300046665 Bacteria 109394
228 Ga0495661_0000638 3300046665 Bacteria 35563
229 Ga0495661_0009088 3300046665 Bacteria 6832
230 Ga0495661_0022165 3300046665 Bacteria 4134
231 Ga0495588_0000110 3300046674 Bacteria 142825
232 Ga0495588_0008482 3300046674 Bacteria 4720
233 Ga0495588_0073884 3300046674 Bacteria 1775
234 Ga0495657_0006419 3300046675 Bacteria 9204
235 Ga0495599_0006988 3300046678 Bacteria 6829
236 Ga0495623_0009654 3300046679 Bacteria 6266
237 Ga0495623_0223489 3300046679 Bacteria 1071
238 Ga0495646_0000446 3300046680 Bacteria 21847
239 Ga0495646_0011782 3300046680 Bacteria 5560
240 Ga0495658_0279998 3300046683 Bacteria 1052
241 Ga0495669_0162219 3300046684 Bacteria 1061
242 Ga0495624_0012831 3300046690 Bacteria 5719
243 Ga0495670_0001500 3300046691 Bacteria 11387
244 Ga0495670_0017044 3300046691 Bacteria 3572
245 Ga0495671_0000582 3300046692 Bacteria 27065
246 Ga0495671_0025498 3300046692 Bacteria 3072
247 Ga0495671_0108534 3300046692 Bacteria 1355
248 Ga0495671_0121470 3300046692 Bacteria 1274
249 Ga0495649_0006737 3300046694 Bacteria 7118
250 Ga0495649_0030801 3300046694 Bacteria 2961
251 Ga0495649_0186241 3300046694 Bacteria 1081
252 Ga0495589_0000019 3300046794 Bacteria 200814
253 Ga0495589_0000596 3300046794 Bacteria 24656
254 Ga0495600_0030154 3300046809 Bacteria 3512
255 Ga0495600_0132649 3300046809 Bacteria 1619
256 Ga0495660_0000056 3300046810 Bacteria 134518
257 Ga0495660_0000245 3300046810 Bacteria 53011
258 Ga0495660_0005974 3300046810 Bacteria 7246
259 Ga0495581_0077960 3300047315 Bacteria 1917
260 Ga0495581_0090888 3300047315 Bacteria 1771
261 Ga0495636_0000998 3300047318 Bacteria 10579
262 Ga0495636_0003923 3300047318 Bacteria 5806
263 Ga0495636_0010948 3300047318 Bacteria 3591
264 Ga0495674_0015849 3300047319 Bacteria 7036
265 Ga0495672_0000896 3300047320 Bacteria 31234
266 Ga0495672_0005588 3300047320 Bacteria 9932
267 Ga0495672_0006771 3300047320 Bacteria 8783
268 Ga0495680_0313058 3300047322 Bacteria 1100
269 Ga0495687_000059 3300047443 Bacteria 179357
270 Ga0495687_000296 3300047443 Bacteria 65626
271 Ga0495687_001460 3300047443 Bacteria 21684
272 Ga0495687_001591 3300047443 Bacteria 20510
273 Ga0495687_076877 3300047443 Bacteria 1320
274 Ga0495675_0014947 3300047444 Bacteria 4908
275 Ga0495675_0028444 3300047444 Bacteria 3562
276 Ga0495677_0000006 3300047445 Bacteria 199230
277 Ga0495677_0007529 3300047445 Bacteria 4065
278 Ga0495677_0017435 3300047445 Bacteria 2603
279 Ga0495677_0030461 3300047445 Bacteria 1963
280 Ga0495685_000076 3300047447 Bacteria 37313
281 Ga0495673_0000024 3300047469 Bacteria 521349
282 Ga0495686_0007184 3300047472 Bacteria 8385
283 Ga0495686_0040141 3300047472 Bacteria 2987
284 Ga0495593_0020158 3300047673 Bacteria 3735
285 Ga0495593_0092325 3300047673 Bacteria 1558
286 Ga0495602_0042409 3300048088 Bacteria 4146
287 Ga0495626_0000103 3300048091 Bacteria 110163
288 Ga0495626_0000494 3300048091 Bacteria 39727
289 Ga0495626_0011706 3300048091 Bacteria 4628
290 Ga0496100_0071042 3300048903 Bacteria 2323
291 Ga0496101_0058181 3300048904 Bacteria 2798
292 Ga0496103_0000631 3300048906 Bacteria 26992
293 Ga0496104_0525164 3300048907 Bacteria 1095
294 Ga0496107_0005997 3300048910 Bacteria 8332
295 Ga0496110_0034989 3300048913 Bacteria 4355
296 Ga0496111_0141539 3300048914 Bacteria 1782
297 Ga0496113_0403873 3300048916 Bacteria 1097
298 Ga0496114_0549865 3300048917 Bacteria 1020
299 Ga0496116_0077132 3300048919 Bacteria 2084
300 Ga0496117_0000001 3300048920 Bacteria 2526244
301 Ga0496118_0000078 3300048921 Bacteria 190946
302 Ga0496122_0028447 3300048925 Bacteria 4741
303 Ga0496123_0001152 3300048926 Bacteria 39412
304 Ga0496124_0041630 3300048927 Bacteria 3962
305 Ga0496124_0065837 3300048927 Bacteria 3020
306 Ga0496124_0066257 3300048927 Bacteria 3008
307 Ga0496124_0066840 3300048927 Bacteria 2993
308 Ga0496125_0003554 3300048928 Bacteria 18777
309 Ga0496126_0041376 3300048929 Bacteria 4265
310 Ga0495678_000006 3300049459 Bacteria 463690
311 Ga0495678_000365 3300049459 Bacteria 46300
312 Ga0495678_000679 3300049459 Bacteria 31270
313 Ga0495678_010124 3300049459 Bacteria 4599
314 Ga0495678_045973 3300049459 Bacteria 1718
315 Ga0495682_0000188 3300049460 Bacteria 50664
316 Ga0495682_0001280 3300049460 Bacteria 14063
317 Ga0495682_0075102 3300049460 Bacteria 1216
318 Ga0501249_004544 3300049679 Bacteria 2821
319 Ga0501269_000090 3300049766 Bacteria 28652
320 Ga0501035_0000652 3300049822 Bacteria 38210
321 Ga0501044_0295173 3300049823 Bacteria 1551
322 Ga0501044_0303672 3300049823 Bacteria 1524
323 nmdc:mga05p37_14950_c1 3300050507 Bacteria 9317
324 nmdc:mga0n895_449961_c1 3300050512 Bacteria 1300
325 nmdc:mga0a205_27400_c1 3300050515 Bacteria 5442
326 Ga0500595_022885 3300053119 Bacteria 2202
327 Ga0500618_014917 3300053125 Bacteria 1974
328 Ga0500574_008145 3300053141 Bacteria 2214
329 Ga0500586_000683 3300053145 Bacteria 6948
330 Ga0500619_000271 3300053154 Bacteria 10652
331 Ga0466962_0026811 3300061719 Bacteria 2767

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_449961_c1 nmdc:mga0n895_449961_c1_637_1275 211
2 3300046499 Ga0495594_0051830 Ga0495594_0051830_659_1432 244
3 3300046531 Ga0495665_0045193 Ga0495665_0045193_87_860 244
4 3300046535 Ga0495586_0027395 Ga0495586_0027395_318_1091 244
5 3300046674 Ga0495588_0073884 Ga0495588_0073884_300_1073 244
6 3300047315 Ga0495581_0077960 Ga0495581_0077960_802_1575 244
7 3300046674 Ga0495588_0000110 Ga0495588_0000110_18014_18787 245
8 3300046684 Ga0495669_0162219 Ga0495669_0162219_21_761 246
9 3300046457 Ga0495590_0024568 Ga0495590_0024568_30_773 247
10 3300046516 Ga0495628_0193575 Ga0495628_0193575_753_1502 249
11 iso_pu_bacteria 2846037992 2846039463 250
12 3300002774 JGI25150J39212_1000260 JGI25150J39212_100026029 251
13 3300003215 JGI25153J46596_10005812 JGI25153J46596_100058125 251
14 3300003775 Ga0055524_1001361 Ga0055524_10013613 251
15 3300025245 Ga0207425_1000001 Ga0207425_10000011820 251
16 3300025258 Ga0209129_1000001 Ga0209129_1000001997 251
17 3300025297 Ga0209758_1000166 Ga0209758_100016650 251
18 3300025299 Ga0209256_1000350 Ga0209256_10003503 251
19 3300046530 Ga0495654_0025930 Ga0495654_0025930_1251_2006 251
20 3300049460 Ga0495682_0075102 Ga0495682_0075102_314_1069 251
21 3300002773 JGI25152J39213_1000052 JGI25152J39213_10000523 252
22 3300046460 Ga0495638_0032890 Ga0495638_0032890_839_1597 252
23 3300046474 Ga0495605_0004340 Ga0495605_0004340_3857_4615 252
24 3300046491 Ga0495584_0092989 Ga0495584_0092989_555_1313 252
25 3300046491 Ga0495584_0105372 Ga0495584_0105372_137_895 252
26 3300046492 Ga0495585_0043835 Ga0495585_0043835_1068_1826 252
27 3300046492 Ga0495585_0180986 Ga0495585_0180986_256_1014 252
28 3300046501 Ga0495607_0059960 Ga0495607_0059960_1285_2043 252
29 3300046506 Ga0495583_0000155 Ga0495583_0000155_1264_2022 252
30 3300046523 Ga0495644_0003276 Ga0495644_0003276_1335_2093 252
31 3300046523 Ga0495644_0015254 Ga0495644_0015254_852_1610 252
32 3300046524 Ga0495648_0003974 Ga0495648_0003974_11996_12754 252
33 3300046538 Ga0495609_0005728 Ga0495609_0005728_1333_2091 252
34 3300046558 Ga0495633_0035907 Ga0495633_0035907_1158_1916 252
35 3300046648 Ga0495611_0068446 Ga0495611_0068446_229_987 252
36 3300046660 Ga0495625_0026955 Ga0495625_0026955_216_974 252
37 3300046664 Ga0495659_0012250 Ga0495659_0012250_1148_1906 252
38 3300046691 Ga0495670_0001500 Ga0495670_0001500_4528_5286 252
39 3300046692 Ga0495671_0025498 Ga0495671_0025498_2028_2786 252
40 3300046692 Ga0495671_0108534 Ga0495671_0108534_550_1308 252
41 3300047318 Ga0495636_0000998 Ga0495636_0000998_5964_6722 252
42 3300047443 Ga0495687_000296 Ga0495687_000296_34399_35157 252
43 3300047445 Ga0495677_0017435 Ga0495677_0017435_260_1018 252
44 3300047447 Ga0495685_000076 Ga0495685_000076_4841_5599 252
45 3300049459 Ga0495678_000365 Ga0495678_000365_14727_15485 252
46 3300049460 Ga0495682_0000188 Ga0495682_0000188_31179_31937 252
47 3300049460 Ga0495682_0001280 Ga0495682_0001280_9576_10334 252
48 3300009036 Ga0105244_10004503 Ga0105244_100045038 253
49 3300031548 Ga0307408_100098769 Ga0307408_1000987695 253
50 3300031731 Ga0307405_10105091 Ga0307405_101050914 253
51 3300031911 Ga0307412_10132058 Ga0307412_101320582 253
52 3300032002 Ga0307416_100213961 Ga0307416_1002139611 253
53 3300032005 Ga0307411_10043757 Ga0307411_100437572 253
54 3300046474 Ga0495605_0019984 Ga0495605_0019984_2729_3490 253
55 3300046501 Ga0495607_0019369 Ga0495607_0019369_171_932 253
56 3300046513 Ga0495616_0007652 Ga0495616_0007652_34_795 253
57 3300046538 Ga0495609_0000039 Ga0495609_0000039_87602_88363 253
58 3300046665 Ga0495661_0000094 Ga0495661_0000094_19206_19967 253
59 3300046794 Ga0495589_0000019 Ga0495589_0000019_89373_90134 253
60 3300047443 Ga0495687_000059 Ga0495687_000059_87602_88363 253
61 3300047445 Ga0495677_0000006 Ga0495677_0000006_110868_111629 253
62 3300048091 Ga0495626_0000494 Ga0495626_0000494_35570_36331 253
63 3300048927 Ga0496124_0066840 Ga0496124_0066840_690_1451 253
64 iso_pu_bacteria 2600255292 2601667277 253
65 iso_pu_bacteria 2857547612 2857552532 253
66 iso_pu_bacteria 2885080285 2885082844 253
67 iso_pu_bacteria 2919476304 2919481378 253
68 iso_pu_bacteria 8047673197 8047673331 253
69 3300005445 Ga0070708_100011230 Ga0070708_1000112308 254
70 3300005467 Ga0070706_100046532 Ga0070706_1000465323 254
71 3300005468 Ga0070707_100210488 Ga0070707_1002104882 254
72 3300005536 Ga0070697_100007952 Ga0070697_1000079523 254
73 3300006173 Ga0070716_100021742 Ga0070716_1000217425 254
74 3300025939 Ga0207665_10039518 Ga0207665_100395182 254
75 3300046694 Ga0495649_0030801 Ga0495649_0030801_1877_2683 254
76 iso_pu_bacteria 2857553236 2857553532 254
77 3300009147 Ga0114129_10002450 Ga0114129_1000245019 255
78 3300014497 Ga0182008_10000203 Ga0182008_1000020315 255
79 3300015261 Ga0182006_1000002 Ga0182006_1000002208 255
80 3300015265 Ga0182005_1000070 Ga0182005_100007035 255
81 3300017792 Ga0163161_10100817 Ga0163161_101008172 255
82 3300027252 Ga0209973_1000747 Ga0209973_10007474 255
83 3300046491 Ga0495584_0000021 Ga0495584_0000021_106687_107454 255
84 3300046507 Ga0495606_0001419 Ga0495606_0001419_12716_13483 255
85 3300048914 Ga0496111_0141539 Ga0496111_0141539_185_976 255
86 3300048919 Ga0496116_0077132 Ga0496116_0077132_215_1006 255
87 3300048920 Ga0496117_0000001 Ga0496117_0000001_1843248_1844039 255
88 3300048921 Ga0496118_0000078 Ga0496118_0000078_152360_153151 255
89 3300048925 Ga0496122_0028447 Ga0496122_0028447_2366_3157 255
90 3300048926 Ga0496123_0001152 Ga0496123_0001152_1977_2768 255
91 3300048927 Ga0496124_0066257 Ga0496124_0066257_984_1775 255
92 3300048928 Ga0496125_0003554 Ga0496125_0003554_17818_18609 255
93 3300050507 nmdc:mga05p37_14950_c1 nmdc:mga05p37_14950_c1_8113_8883 255
94 3300050515 nmdc:mga0a205_27400_c1 nmdc:mga0a205_27400_c1_2889_3659 255
95 iso_pu_bacteria 2818991436 2819541005 255
96 3300006946 Ga0079104_1009935 Ga0079104_10099355 256
97 3300027111 Ga0209281_1007260 Ga0209281_10072605 256
98 3300046455 Ga0495603_0025584 Ga0495603_0025584_1871_2641 256
99 3300046471 Ga0495650_0000097 Ga0495650_0000097_71493_72287 256
100 3300046471 Ga0495650_0001058 Ga0495650_0001058_20654_21436 256
101 3300046491 Ga0495584_0018503 Ga0495584_0018503_1592_2374 256
102 3300046492 Ga0495585_0033332 Ga0495585_0033332_2062_2832 256
103 3300046499 Ga0495594_0001115 Ga0495594_0001115_6019_6789 256
104 3300046499 Ga0495594_0036691 Ga0495594_0036691_1698_2468 256
105 3300046501 Ga0495607_0002140 Ga0495607_0002140_2862_3656 256
106 3300046506 Ga0495583_0002755 Ga0495583_0002755_12980_13762 256
107 3300046512 Ga0495610_0000003 Ga0495610_0000003_80593_81366 256
108 3300046512 Ga0495610_0004426 Ga0495610_0004426_4693_5484 256
109 3300046526 Ga0495666_0092058 Ga0495666_0092058_78_848 256
110 3300046526 Ga0495666_0162966 Ga0495666_0162966_14_784 256
111 3300046558 Ga0495633_0089332 Ga0495633_0089332_199_993 256
112 3300046648 Ga0495611_0013556 Ga0495611_0013556_763_1533 256
113 3300046648 Ga0495611_0022007 Ga0495611_0022007_1329_2123 256
114 3300046648 Ga0495611_0075700 Ga0495611_0075700_224_1018 256
115 3300046660 Ga0495625_0000139 Ga0495625_0000139_86161_86943 256
116 3300046660 Ga0495625_0002129 Ga0495625_0002129_1242_2024 256
117 3300046665 Ga0495661_0022165 Ga0495661_0022165_3021_3815 256
118 3300046691 Ga0495670_0017044 Ga0495670_0017044_2684_3454 256
119 3300047318 Ga0495636_0003923 Ga0495636_0003923_3638_4408 256
120 3300047320 Ga0495672_0006771 Ga0495672_0006771_5011_5805 256
121 3300047443 Ga0495687_076877 Ga0495687_076877_239_1021 256
122 3300047445 Ga0495677_0030461 Ga0495677_0030461_232_1014 256
123 3300048091 Ga0495626_0011706 Ga0495626_0011706_2615_3385 256
124 iso_pu_bacteria 2842711865 2842714499 256
125 iso_pu_bacteria 2857558681 2857561605 256
126 iso_pu_bacteria 2857564685 2857565168 256
127 iso_pu_bacteria 2904424332 2904426477 256
128 3300002738 JGI25154J39366_1004259 JGI25154J39366_10042591 257
129 3300002774 JGI25150J39212_1005558 JGI25150J39212_10055582 257
130 3300003771 Ga0055526_1000100 Ga0055526_100010030 257
131 3300005563 Ga0068855_100028435 Ga0068855_1000284355 257
132 3300009036 Ga0105244_10020520 Ga0105244_100205205 257
133 3300009174 Ga0105241_10088450 Ga0105241_100884505 257
134 3300009176 Ga0105242_10009643 Ga0105242_100096439 257
135 3300013296 Ga0157374_10034738 Ga0157374_100347384 257
136 3300013306 Ga0163162_10268593 Ga0163162_102685934 257
137 3300015265 Ga0182005_1000013 Ga0182005_100001314 257
138 3300025245 Ga0207425_1000484 Ga0207425_100048422 257
139 3300025246 Ga0209646_1000010 Ga0209646_1000010530 257
140 3300025250 Ga0209026_1004451 Ga0209026_10044514 257
141 3300025294 Ga0209025_1003379 Ga0209025_100337915 257
142 3300025295 Ga0209564_1000009 Ga0209564_1000009618 257
143 3300025295 Ga0209564_1000045 Ga0209564_100004544 257
144 3300025297 Ga0209758_1000489 Ga0209758_100048925 257
145 3300025911 Ga0207654_10050086 Ga0207654_100500865 257
146 3300025919 Ga0207657_10020487 Ga0207657_100204873 257
147 3300025920 Ga0207649_10488926 Ga0207649_104889262 257
148 3300025934 Ga0207686_10244790 Ga0207686_102447902 257
149 3300025942 Ga0207689_10055231 Ga0207689_100552315 257
150 3300025949 Ga0207667_10022603 Ga0207667_100226035 257
151 3300028794 Ga0307515_10154267 Ga0307515_101542672 257
152 3300030731 Ga0316177_1172584 Ga0316177_11725842 257
153 3300030733 Ga0314311_1188587 Ga0314311_11885872 257
154 3300030744 Ga0316181_1155464 Ga0316181_11554642 257
155 3300030745 Ga0316182_1353000 Ga0316182_13530002 257
156 3300037312 Ga0395899_0075534 Ga0395899_0075534_1341_2114 257
157 3300037418 Ga0395900_0014151 Ga0395900_0014151_275_1048 257
158 3300037418 Ga0395900_0072494 Ga0395900_0072494_1433_2206 257
159 3300037466 Ga0395898_0111616 Ga0395898_0111616_947_1720 257
160 3300037466 Ga0395898_0124368 Ga0395898_0124368_1228_2001 257
161 3300037466 Ga0395898_0315936 Ga0395898_0315936_181_954 257
162 3300037471 Ga0395905_0034540 Ga0395905_0034540_1944_2717 257
163 3300037471 Ga0395905_0384510 Ga0395905_0384510_484_1257 257
164 3300038443 Ga0395901_0000033 Ga0395901_0000033_32186_32959 257
165 3300038443 Ga0395901_0301110 Ga0395901_0301110_838_1611 257
166 3300038443 Ga0395901_0499498 Ga0395901_0499498_73_846 257
167 3300042005 Ga0439448_0001668 Ga0439448_0001668_1218_1991 257
168 3300042005 Ga0439448_0017001 Ga0439448_0017001_804_1577 257
169 3300042012 Ga0439455_0004502 Ga0439455_0004502_918_1691 257
170 3300042157 Ga0439458_0057199 Ga0439458_0057199_85_858 257
171 3300044683 Ga0466965_0006865 Ga0466965_0006865_3682_4455 257
172 3300044683 Ga0466965_0037658 Ga0466965_0037658_915_1688 257
173 3300044684 Ga0466966_0048702 Ga0466966_0048702_1577_2350 257
174 3300044693 Ga0466961_0036223 Ga0466961_0036223_1627_2400 257
175 3300044706 Ga0466964_0000157 Ga0466964_0000157_2989_3762 257
176 3300044765 Ga0466970_0179137 Ga0466970_0179137_342_1115 257
177 3300044842 Ga0466957_0005776 Ga0466957_0005776_4971_5744 257
178 3300044842 Ga0466957_0035160 Ga0466957_0035160_1529_2302 257
179 3300045049 Ga0466959_0037085 Ga0466959_0037085_2193_2966 257
180 3300045836 Ga0466958_0087841 Ga0466958_0087841_580_1353 257
181 3300045976 Ga0466967_0022665 Ga0466967_0022665_4306_5079 257
182 3300046457 Ga0495590_0000003 Ga0495590_0000003_383883_384668 257
183 3300046460 Ga0495638_0000091 Ga0495638_0000091_115437_116222 257
184 3300046460 Ga0495638_0048943 Ga0495638_0048943_1025_1810 257
185 3300046463 Ga0495653_0000013 Ga0495653_0000013_153930_154724 257
186 3300046463 Ga0495653_0038844 Ga0495653_0038844_2740_3513 257
187 3300046471 Ga0495650_0003792 Ga0495650_0003792_3142_3927 257
188 3300046471 Ga0495650_0005750 Ga0495650_0005750_1515_2300 257
189 3300046471 Ga0495650_0036146 Ga0495650_0036146_367_1152 257
190 3300046472 Ga0495580_0043058 Ga0495580_0043058_1665_2438 257
191 3300046474 Ga0495605_0000237 Ga0495605_0000237_41117_41890 257
192 3300046492 Ga0495585_0002213 Ga0495585_0002213_3104_3889 257
193 3300046499 Ga0495594_0001246 Ga0495594_0001246_11073_11846 257
194 3300046501 Ga0495607_0005541 Ga0495607_0005541_2126_2899 257
195 3300046501 Ga0495607_0016045 Ga0495607_0016045_920_1702 257
196 3300046501 Ga0495607_0027873 Ga0495607_0027873_190_963 257
197 3300046506 Ga0495583_0000197 Ga0495583_0000197_70984_71769 257
198 3300046506 Ga0495583_0028812 Ga0495583_0028812_1111_1884 257
199 3300046507 Ga0495606_0000141 Ga0495606_0000141_96940_97722 257
200 3300046507 Ga0495606_0000266 Ga0495606_0000266_23541_24335 257
201 3300046507 Ga0495606_0000371 Ga0495606_0000371_67477_68262 257
202 3300046507 Ga0495606_0000696 Ga0495606_0000696_35786_36571 257
203 3300046507 Ga0495606_0002432 Ga0495606_0002432_5717_6502 257
204 3300046512 Ga0495610_0002073 Ga0495610_0002073_13990_14772 257
205 3300046512 Ga0495610_0003707 Ga0495610_0003707_1382_2167 257
206 3300046512 Ga0495610_0011693 Ga0495610_0011693_487_1272 257
207 3300046512 Ga0495610_0020097 Ga0495610_0020097_347_1132 257
208 3300046520 Ga0495637_0000087 Ga0495637_0000087_37075_37860 257
209 3300046520 Ga0495637_0001405 Ga0495637_0001405_13221_14006 257
210 3300046522 Ga0495643_0000179 Ga0495643_0000179_24615_25400 257
211 3300046522 Ga0495643_0006330 Ga0495643_0006330_588_1361 257
212 3300046522 Ga0495643_0007639 Ga0495643_0007639_5420_6193 257
213 3300046524 Ga0495648_0000058 Ga0495648_0000058_76417_77202 257
214 3300046524 Ga0495648_0040255 Ga0495648_0040255_1715_2500 257
215 3300046526 Ga0495666_0002872 Ga0495666_0002872_2804_3577 257
216 3300046528 Ga0495642_0003894 Ga0495642_0003894_4129_4914 257
217 3300046530 Ga0495654_0000074 Ga0495654_0000074_43992_44777 257
218 3300046531 Ga0495665_0128725 Ga0495665_0128725_97_870 257
219 3300046531 Ga0495665_0148888 Ga0495665_0148888_398_1171 257
220 3300046535 Ga0495586_0016407 Ga0495586_0016407_1957_2730 257
221 3300046535 Ga0495586_0257877 Ga0495586_0257877_41_814 257
222 3300046536 Ga0495587_0074097 Ga0495587_0074097_623_1396 257
223 3300046538 Ga0495609_0042363 Ga0495609_0042363_12_797 257
224 3300046542 Ga0495597_0000209 Ga0495597_0000209_50946_51731 257
225 3300046542 Ga0495597_0000242 Ga0495597_0000242_43599_44384 257
226 3300046543 Ga0495645_0353001 Ga0495645_0353001_65_838 257
227 3300046557 Ga0495622_0006805 Ga0495622_0006805_2828_3613 257
228 3300046558 Ga0495633_0000249 Ga0495633_0000249_33056_33841 257
229 3300046558 Ga0495633_0002342 Ga0495633_0002342_10187_10972 257
230 3300046558 Ga0495633_0053237 Ga0495633_0053237_108_890 257
231 3300046616 Ga0495668_0000466 Ga0495668_0000466_29586_30368 257
232 3300046616 Ga0495668_0000935 Ga0495668_0000935_29549_30334 257
233 3300046660 Ga0495625_0000132 Ga0495625_0000132_30262_31047 257
234 3300046660 Ga0495625_0042210 Ga0495625_0042210_280_1065 257
235 3300046660 Ga0495625_0049280 Ga0495625_0049280_344_1129 257
236 3300046663 Ga0495635_0298565 Ga0495635_0298565_210_995 257
237 3300046665 Ga0495661_0000638 Ga0495661_0000638_6594_7367 257
238 3300046665 Ga0495661_0009088 Ga0495661_0009088_3930_4703 257
239 3300046674 Ga0495588_0008482 Ga0495588_0008482_2389_3162 257
240 3300046692 Ga0495671_0000582 Ga0495671_0000582_24188_24973 257
241 3300046692 Ga0495671_0121470 Ga0495671_0121470_114_899 257
242 3300046694 Ga0495649_0006737 Ga0495649_0006737_4906_5691 257
243 3300046694 Ga0495649_0186241 Ga0495649_0186241_184_969 257
244 3300046794 Ga0495589_0000596 Ga0495589_0000596_23515_24288 257
245 3300046809 Ga0495600_0132649 Ga0495600_0132649_440_1213 257
246 3300046810 Ga0495660_0000056 Ga0495660_0000056_86304_87080 257
247 3300046810 Ga0495660_0000245 Ga0495660_0000245_28724_29497 257
248 3300046810 Ga0495660_0005974 Ga0495660_0005974_551_1336 257
249 3300047315 Ga0495581_0090888 Ga0495581_0090888_371_1144 257
250 3300047319 Ga0495674_0015849 Ga0495674_0015849_6238_7017 257
251 3300047320 Ga0495672_0000896 Ga0495672_0000896_5417_6202 257
252 3300047320 Ga0495672_0005588 Ga0495672_0005588_3122_3895 257
253 3300047322 Ga0495680_0313058 Ga0495680_0313058_200_973 257
254 3300047443 Ga0495687_001460 Ga0495687_001460_3137_3910 257
255 3300047443 Ga0495687_001591 Ga0495687_001591_18505_19290 257
256 3300047444 Ga0495675_0014947 Ga0495675_0014947_3746_4519 257
257 3300047444 Ga0495675_0028444 Ga0495675_0028444_391_1164 257
258 3300047445 Ga0495677_0007529 Ga0495677_0007529_130_903 257
259 3300047469 Ga0495673_0000024 Ga0495673_0000024_238926_239711 257
260 3300047472 Ga0495686_0007184 Ga0495686_0007184_220_1002 257
261 3300047472 Ga0495686_0040141 Ga0495686_0040141_198_983 257
262 3300047673 Ga0495593_0020158 Ga0495593_0020158_2830_3603 257
263 3300047673 Ga0495593_0092325 Ga0495593_0092325_379_1152 257
264 3300048088 Ga0495602_0042409 Ga0495602_0042409_1132_1905 257
265 3300048091 Ga0495626_0000103 Ga0495626_0000103_11439_12212 257
266 3300048903 Ga0496100_0071042 Ga0496100_0071042_970_1743 257
267 3300048904 Ga0496101_0058181 Ga0496101_0058181_1712_2485 257
268 3300048906 Ga0496103_0000631 Ga0496103_0000631_18787_19572 257
269 3300048907 Ga0496104_0525164 Ga0496104_0525164_273_1046 257
270 3300048910 Ga0496107_0005997 Ga0496107_0005997_4379_5152 257
271 3300048916 Ga0496113_0403873 Ga0496113_0403873_25_798 257
272 3300048917 Ga0496114_0549865 Ga0496114_0549865_114_887 257
273 3300048927 Ga0496124_0041630 Ga0496124_0041630_183_959 257
274 3300048927 Ga0496124_0065837 Ga0496124_0065837_2230_3003 257
275 3300048929 Ga0496126_0041376 Ga0496126_0041376_2976_3773 257
276 3300049459 Ga0495678_000006 Ga0495678_000006_56983_57759 257
277 3300049459 Ga0495678_000679 Ga0495678_000679_24605_25390 257
278 3300049459 Ga0495678_010124 Ga0495678_010124_1875_2660 257
279 3300049459 Ga0495678_045973 Ga0495678_045973_842_1627 257
280 3300049679 Ga0501249_004544 Ga0501249_004544_1847_2632 257
281 3300049766 Ga0501269_000090 Ga0501269_000090_5588_6373 257
282 3300049822 Ga0501035_0000652 Ga0501035_0000652_20395_21168 257
283 3300049823 Ga0501044_0303672 Ga0501044_0303672_703_1476 257
284 3300053125 Ga0500618_014917 Ga0500618_014917_93_878 257
285 3300053145 Ga0500586_000683 Ga0500586_000683_5707_6492 257
286 3300061719 Ga0466962_0026811 Ga0466962_0026811_998_1771 257
287 iso_pu_bacteria 2524614729 2525557867 257
288 iso_pu_bacteria 2627854209 2630650166 257
289 3300046615 Ga0495656_0004425 Ga0495656_0004425_2453_3262 258
290 3300047318 Ga0495636_0010948 Ga0495636_0010948_1099_1908 258
291 3300049823 Ga0501044_0295173 Ga0501044_0295173_31_807 258
292 3300002737 JGI25162J39368_1000015 JGI25162J39368_1000015245 259
293 3300002771 JGI25163J39215_1001995 JGI25163J39215_10019952 259
294 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001922 259
295 3300003751 Ga0055538_1000001 Ga0055538_1000001112 259
296 3300003752 Ga0055539_1000001 Ga0055539_1000001112 259
297 3300003756 Ga0055533_1000003 Ga0055533_1000003922 259
298 3300003759 Ga0055525_1000087 Ga0055525_100008733 259
299 3300003841 Ga0055541_1000001 Ga0055541_1000001922 259
300 3300005337 Ga0070682_100005736 Ga0070682_1000057364 259
301 3300005339 Ga0070660_100151996 Ga0070660_1001519961 259
302 3300005344 Ga0070661_100004150 Ga0070661_10000415010 259
303 3300005366 Ga0070659_100008146 Ga0070659_1000081465 259
304 3300005455 Ga0070663_100202007 Ga0070663_1002020071 259
305 3300005457 Ga0070662_100060360 Ga0070662_1000603602 259
306 3300005564 Ga0070664_100185253 Ga0070664_1001852532 259
307 3300015265 Ga0182005_1000227 Ga0182005_100022719 259
308 3300025207 Ga0209760_101839 Ga0209760_1018394 259
309 3300025224 Ga0209784_100004 Ga0209784_100004916 259
310 3300025225 Ga0209566_100004 Ga0209566_1000041073 259
311 3300025226 Ga0209674_100006 Ga0209674_1000061073 259
312 3300025228 Ga0209672_101805 Ga0209672_1018052 259
313 3300025230 Ga0209563_100009 Ga0209563_100009916 259
314 3300025231 Ga0207427_100459 Ga0207427_1004596 259
315 3300025233 Ga0209437_100004 Ga0209437_100004916 259
316 3300025253 Ga0209677_100005 Ga0209677_100005916 259
317 3300025261 Ga0209233_1000005 Ga0209233_10000051073 259
318 3300025919 Ga0207657_10056977 Ga0207657_100569771 259
319 3300025920 Ga0207649_10008040 Ga0207649_100080404 259
320 3300025932 Ga0207690_10017184 Ga0207690_100171844 259
321 3300028794 Ga0307515_10008778 Ga0307515_1000877819 259
322 3300031730 Ga0307516_10003778 Ga0307516_100037783 259
323 3300039447 Ga0436361_0715686 Ga0436361_0715686_5064_5879 259
324 3300046462 Ga0495651_0006021 Ga0495651_0006021_3139_3918 259
325 3300046463 Ga0495653_0001055 Ga0495653_0001055_16559_17338 259
326 3300046511 Ga0495608_0020505 Ga0495608_0020505_1336_2115 259
327 3300046514 Ga0495618_0062649 Ga0495618_0062649_983_1762 259
328 3300046516 Ga0495628_0004418 Ga0495628_0004418_9815_10594 259
329 3300046529 Ga0495652_0004031 Ga0495652_0004031_11813_12619 259
330 3300046529 Ga0495652_0017800 Ga0495652_0017800_4972_5751 259
331 3300046543 Ga0495645_0050901 Ga0495645_0050901_1528_2307 259
332 3300046557 Ga0495622_0060418 Ga0495622_0060418_839_1618 259
333 3300046675 Ga0495657_0006419 Ga0495657_0006419_6737_7516 259
334 3300046678 Ga0495599_0006988 Ga0495599_0006988_1326_2105 259
335 3300046679 Ga0495623_0009654 Ga0495623_0009654_4565_5356 259
336 3300046679 Ga0495623_0223489 Ga0495623_0223489_80_994 259
337 3300046680 Ga0495646_0000446 Ga0495646_0000446_18986_19792 259
338 3300046680 Ga0495646_0011782 Ga0495646_0011782_816_1595 259
339 3300046683 Ga0495658_0279998 Ga0495658_0279998_204_983 259
340 3300046690 Ga0495624_0012831 Ga0495624_0012831_3449_4228 259
341 3300046809 Ga0495600_0030154 Ga0495600_0030154_690_1469 259
342 3300048913 Ga0496110_0034989 Ga0496110_0034989_2796_3587 259
343 3300053119 Ga0500595_022885 Ga0500595_022885_414_1193 259
344 3300053141 Ga0500574_008145 Ga0500574_008145_1151_1930 259
345 3300053154 Ga0500619_000271 Ga0500619_000271_5058_5837 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

117

237

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7976 5 259
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7928 3 259
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7853 5 259
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7783 3 259
8e50-assembly1.cif.gz_A cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa 0.6696 55 230
ID Description Score Start End Superfamily
af_Q93841_73_201_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8866 72 190 3.40.50.620
af_D4AC45_64_192_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.876 72 190 3.40.50.620
af_Q22267_77_205_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8698 74 190 3.40.50.2000
af_Q4DTE0_69_208_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8667 85 192 3.40.50.620
af_O07809_23_150_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8607 74 190 3.40.50.2000
ID Description Score Start End GO Terms
AF-J2UAJ6-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9891 3 252 GO:0003841
GO:0006654
GO:0016020
AF-A0A7L9U2A5-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.986 1 256 GO:0003841
GO:0006654
GO:0016020
AF-A0A411WUS9-F1-model_v4 deleted 0.9849 3 256
AF-A0A352RX75-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9796 1 218 GO:0003841
GO:0006654
GO:0016020
AF-A0A7L9U2A5-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9785 1 256 GO:0003841
GO:0006654
GO:0016020

Feature Viewer

pLDDT pTM Quality
86.34 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map