F416484

General Info

Members Datasets Scaffolds Average Seq Length
345 214 341 283

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0179965|Ga0451576_0179965_1260_2099
Length 274
Sequence MALPAHEETFQGTGGLKIFFRSWRPTGSPRGVIVICHGVNSHGGQYLWPAQQFAASGLAAYAIDLRGRGKSGGERFYVDDVAEYQLIGIAKSRDPGLKVFLLGHSAGGVVSCSYTLDNQAELAGLICESFAFQVPAPDFALAIIKGLSTVAPRLPVLKLKNEDFSRDPKAVQTLNSDPLTHNEVQPAKTVAALVRANERLKREFPRITIPVFILHGTADKATVPAGSQLFYDTTASKDKTLKLYEGHYHDLLNDVGKDGVLSDIKSWIDKHLAA

Samples

Sample ID Description Type Environment
1 2738543024 Aminobacter sp. AP02 Isolate Unclassified
2 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
3 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
4 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
126 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
149 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
152 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
153 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
154 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
155 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
156 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
157 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
158 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
159 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
172 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
193 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
206 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
207 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
208 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
209 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
210 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
211 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 0
Isolates 1.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.42
Nodule 0.29
Rhizoplane 1.16
Rhizosphere 73.91
Stem 0
Stem Tuber 0
Unclassified 5.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1000050 3300002774 Bacteria 72743
2 JGI25153J46596_10000036 3300003215 Bacteria 182205
3 rootH1_10091269 3300003323 Bacteria 5654
4 Ga0055537_1001195 3300003773 Bacteria 11039
5 Ga0055530_10000061 3300003791 Bacteria 95363
6 Ga0055540_1001026 3300003792 Bacteria 17931
7 Ga0055540_1003043 3300003792 Bacteria 8364
8 Ga0055531_10000035 3300003794 Bacteria 147414
9 Ga0065165_1035619 3300005262 Bacteria 1527
10 Ga0065707_10089452 3300005295 Bacteria 4363
11 Ga0065707_10192591 3300005295 Bacteria 1353
12 Ga0070670_100004206 3300005331 Bacteria 12050
13 Ga0070670_100162041 3300005331 Bacteria 1938
14 Ga0070677_10006391 3300005333 Bacteria 3914
15 Ga0070680_100001980 3300005336 Bacteria 15068
16 Ga0070682_100010373 3300005337 Bacteria 5287
17 Ga0068868_100445054 3300005338 Bacteria 1126
18 Ga0070668_100005801 3300005347 Bacteria 9160
19 Ga0070675_100004438 3300005354 Bacteria 10693
20 Ga0070675_100015161 3300005354 Bacteria 6086
21 Ga0070675_100041394 3300005354 Bacteria 3764
22 Ga0070675_100256590 3300005354 Bacteria 1531
23 Ga0070671_100346980 3300005355 Bacteria 1267
24 Ga0070674_100055540 3300005356 Bacteria 2743
25 Ga0070673_100032058 3300005364 Bacteria 3951
26 Ga0070673_100166121 3300005364 Bacteria 1880
27 Ga0070673_100341716 3300005364 Bacteria 1326
28 Ga0070713_100028117 3300005436 Unclassified 4437
29 Ga0070705_100004292 3300005440 Bacteria 6948
30 Ga0070694_100005979 3300005444 Bacteria 7379
31 Ga0070694_100081258 3300005444 Bacteria 2254
32 Ga0070708_100027203 3300005445 Bacteria 4905
33 Ga0070708_100194246 3300005445 Unclassified 1899
34 Ga0070678_100018570 3300005456 Bacteria 4509
35 Ga0070678_100433056 3300005456 Unclassified 1149
36 Ga0070681_10000970 3300005458 Bacteria 24216
37 Ga0068867_100141232 3300005459 Bacteria 1882
38 Ga0070706_100032200 3300005467 Bacteria 4836
39 Ga0070707_100112233 3300005468 Bacteria 2644
40 Ga0070698_100015893 3300005471 Bacteria 7947
41 Ga0070698_100022909 3300005471 Bacteria 6530
42 Ga0070698_100025085 3300005471 Bacteria 6214
43 Ga0070698_100039630 3300005471 Unclassified 4847
44 Ga0070699_100011468 3300005518 Bacteria 7655
45 Ga0070699_100100651 3300005518 Bacteria 2533
46 Ga0070699_100356918 3300005518 Unclassified 1317
47 Ga0070679_100000493 3300005530 Bacteria 33616
48 Ga0070679_100288342 3300005530 Unclassified 1593
49 Ga0070684_100051796 3300005535 Bacteria 3568
50 Ga0070672_100000626 3300005543 Bacteria 20778
51 Ga0070672_100029882 3300005543 Bacteria 4090
52 Ga0070672_100426648 3300005543 Bacteria 1139
53 Ga0070695_100147726 3300005545 Bacteria 1637
54 Ga0070696_100002045 3300005546 Bacteria 13231
55 Ga0070665_100274047 3300005548 Bacteria 1689
56 Ga0070704_100002323 3300005549 Bacteria 10648
57 Ga0070704_100006975 3300005549 Bacteria 6701
58 Ga0068855_100003019 3300005563 Bacteria 20587
59 Ga0068856_100016841 3300005614 Bacteria 7083
60 Ga0068859_100011142 3300005617 Bacteria 9040
61 Ga0068859_100155477 3300005617 Bacteria 2364
62 Ga0068859_100242218 3300005617 Bacteria 1893
63 Ga0068864_100074973 3300005618 Bacteria 2953
64 Ga0068864_100514545 3300005618 Bacteria 1153
65 Ga0068863_100026736 3300005841 Bacteria 5502
66 Ga0068863_100300587 3300005841 Bacteria 1557
67 Ga0068860_100013038 3300005843 Bacteria 8160
68 Ga0068860_100096633 3300005843 Bacteria 2816
69 Ga0081539_10036288 3300005985 Bacteria 2952
70 Ga0075365_10009004 3300006038 Bacteria 5709
71 Ga0075368_10007058 3300006042 Bacteria 3954
72 Ga0075363_100010151 3300006048 Bacteria 4455
73 Ga0075364_10004317 3300006051 Bacteria 8154
74 Ga0075364_10033079 3300006051 Bacteria 3326
75 Ga0075364_10035512 3300006051 Bacteria 3221
76 Ga0075364_10041809 3300006051 Bacteria 2977
77 Ga0070716_100252370 3300006173 Bacteria 1202
78 Ga0075362_10021057 3300006177 Bacteria 2731
79 Ga0075367_10004837 3300006178 Bacteria 6637
80 Ga0075367_10009199 3300006178 Bacteria 5154
81 Ga0075367_10098498 3300006178 Bacteria 1785
82 Ga0075367_10370016 3300006178 Unclassified 905
83 Ga0075369_10004139 3300006186 Bacteria 5338
84 Ga0075366_10045235 3300006195 Bacteria 2609
85 Ga0097621_100001714 3300006237 Bacteria 14980
86 Ga0097621_100031026 3300006237 Bacteria 4237
87 Ga0097621_100319680 3300006237 Bacteria 1374
88 Ga0097621_100357712 3300006237 Bacteria 1300
89 Ga0075370_10058761 3300006353 Bacteria 2188
90 Ga0075370_10085867 3300006353 Bacteria 1812
91 Ga0068871_100020120 3300006358 Bacteria 5107
92 Ga0068871_100253596 3300006358 Bacteria 1533
93 Ga0075428_100000019 3300006844 Bacteria 137803
94 Ga0075428_100001448 3300006844 Bacteria 25368
95 Ga0075428_100009562 3300006844 Archaea 10765
96 Ga0075428_100345772 3300006844 Bacteria 1597
97 Ga0075430_100024348 3300006846 Bacteria 5152
98 Ga0075430_100358489 3300006846 Bacteria 1204
99 Ga0075430_100422465 3300006846 Bacteria 1100
100 Ga0075431_100004860 3300006847 Bacteria 13232
101 Ga0075431_100023330 3300006847 Bacteria 6329
102 Ga0075431_100032317 3300006847 Bacteria 5393
103 Ga0075431_100038730 3300006847 Unclassified 4911
104 Ga0075434_100008947 3300006871 Bacteria 9325
105 Ga0075429_100010994 3300006880 Bacteria 7831
106 Ga0075429_100078088 3300006880 Bacteria 2885
107 Ga0068865_100118083 3300006881 Bacteria 1967
108 Ga0068865_100158933 3300006881 Bacteria 1722
109 Ga0097620_100011142 3300006931 Bacteria 9040
110 Ga0097620_100155473 3300006931 Bacteria 2364
111 Ga0097620_100242212 3300006931 Bacteria 1893
112 Ga0075435_100155483 3300007076 Bacteria 1924
113 Ga0105251_10100610 3300009011 Bacteria 1321
114 Ga0105240_10001245 3300009093 Bacteria 44167
115 Ga0111539_10000002 3300009094 Bacteria 983359
116 Ga0111539_10044687 3300009094 Bacteria 5304
117 Ga0105245_10184160 3300009098 Bacteria 1997
118 Ga0105247_10086124 3300009101 Bacteria 1988
119 Ga0114129_10014748 3300009147 Bacteria 11133
120 Ga0114129_10030841 3300009147 Bacteria 7582
121 Ga0114129_10055508 3300009147 Bacteria 5551
122 Ga0114129_10153508 3300009147 Bacteria 3150
123 Ga0114129_10203196 3300009147 Bacteria 2682
124 Ga0105242_10020366 3300009176 Bacteria 5199
125 Ga0105242_10206390 3300009176 Bacteria 1748
126 Ga0105242_10522326 3300009176 Bacteria 1133
127 Ga0105248_10013027 3300009177 Bacteria 9166
128 Ga0105248_10069664 3300009177 Bacteria 3949
129 Ga0105248_10080954 3300009177 Bacteria 3651
130 Ga0105248_10133015 3300009177 Bacteria 2806
131 Ga0105248_10309930 3300009177 Bacteria 1778
132 Ga0105248_10371429 3300009177 Unclassified 1610
133 Ga0105237_10029907 3300009545 Bacteria 5534
134 Ga0163162_10158919 3300013306 Bacteria 2381
135 Ga0163162_10306988 3300013306 Bacteria 1719
136 Ga0163162_10351475 3300013306 Bacteria 1607
137 Ga0157375_10001936 3300013308 Bacteria 17825
138 Ga0157375_10094616 3300013308 Bacteria 3057
139 Ga0157375_10158524 3300013308 Unclassified 2404
140 Ga0163163_10000001 3300014325 Bacteria 622185
141 Ga0163163_10282932 3300014325 Bacteria 1710
142 Ga0157380_10003065 3300014326 Bacteria 11386
143 Ga0157380_10153683 3300014326 Bacteria 1992
144 Ga0157380_10408536 3300014326 Bacteria 1291
145 Ga0157377_10151734 3300014745 Bacteria 1433
146 Ga0157379_10067660 3300014968 Bacteria 3193
147 Ga0157376_10027316 3300014969 Bacteria 4522
148 Ga0157376_10032075 3300014969 Bacteria 4214
149 Ga0157376_10124210 3300014969 Bacteria 2292
150 Ga0157376_10170148 3300014969 Bacteria 1983
151 Ga0163161_10523430 3300017792 Bacteria 969
152 Ga0213876_10002243 3300021384 Bacteria 11407
153 Ga0207425_1000037 3300025245 Bacteria 224645
154 Ga0209565_1000290 3300025263 Bacteria 48865
155 Ga0209673_1003989 3300025273 Bacteria 8207
156 Ga0209025_1000117 3300025294 Bacteria 215073
157 Ga0209564_1001191 3300025295 Bacteria 29869
158 Ga0209564_1024902 3300025295 Bacteria 2031
159 Ga0209758_1000103 3300025297 Bacteria 223968
160 Ga0209758_1047667 3300025297 Bacteria 1531
161 Ga0209050_1000001 3300025298 Bacteria 3563507
162 Ga0209050_1000014 3300025298 Bacteria 774327
163 Ga0209050_1010540 3300025298 Bacteria 4538
164 Ga0209050_1010745 3300025298 Bacteria 4460
165 Ga0207426_1051357 3300025302 Bacteria 1225
166 Ga0209051_1000838 3300025303 Bacteria 31660
167 Ga0209257_1000019 3300025304 Bacteria 774261
168 Ga0209257_1001391 3300025304 Bacteria 28995
169 Ga0209257_1001422 3300025304 Bacteria 28466
170 Ga0207697_10018343 3300025315 Bacteria 2870
171 Ga0207682_10005937 3300025893 Bacteria 4940
172 Ga0207645_10078691 3300025907 Bacteria 2113
173 Ga0207684_10035574 3300025910 Bacteria 4229
174 Ga0207684_10124572 3300025910 Bacteria 2210
175 Ga0207671_10060494 3300025914 Bacteria 2810
176 Ga0207660_10247519 3300025917 Bacteria 1406
177 Ga0207646_10095586 3300025922 Bacteria 2662
178 Ga0207650_10000254 3300025925 Bacteria 58014
179 Ga0207650_10141163 3300025925 Bacteria 1894
180 Ga0207659_10019525 3300025926 Bacteria 4463
181 Ga0207659_10034072 3300025926 Bacteria 3509
182 Ga0207659_10116816 3300025926 Bacteria 2038
183 Ga0207659_10199213 3300025926 Bacteria 1598
184 Ga0207659_10213518 3300025926 Bacteria 1548
185 Ga0207687_10114149 3300025927 Bacteria 2010
186 Ga0207700_10028316 3300025928 Unclassified 3937
187 Ga0207644_10229279 3300025931 Bacteria 1475
188 Ga0207706_10511951 3300025933 Bacteria 1035
189 Ga0207686_10288324 3300025934 Bacteria 1214
190 Ga0207704_10040220 3300025938 Bacteria 2730
191 Ga0207704_10102373 3300025938 Bacteria 1912
192 Ga0207704_10439161 3300025938 Bacteria 1039
193 Ga0207691_10016932 3300025940 Bacteria 6916
194 Ga0207691_10369483 3300025940 Bacteria 1225
195 Ga0207711_10022513 3300025941 Bacteria 5270
196 Ga0207711_10035038 3300025941 Bacteria 4253
197 Ga0207711_10086598 3300025941 Bacteria 2747
198 Ga0207711_10119978 3300025941 Bacteria 2347
199 Ga0207711_10194241 3300025941 Bacteria 1851
200 Ga0207711_10291314 3300025941 Bacteria 1505
201 Ga0207689_10109109 3300025942 Bacteria 2274
202 Ga0207667_10004619 3300025949 Bacteria 16896
203 Ga0207651_10015533 3300025960 Bacteria 4428
204 Ga0207651_10053667 3300025960 Bacteria 2757
205 Ga0207668_10003551 3300025972 Bacteria 9170
206 Ga0207658_10000347 3300025986 Bacteria 45971
207 Ga0207678_10439486 3300026067 Bacteria 1133
208 Ga0207708_10573274 3300026075 Bacteria 954
209 Ga0207641_10014883 3300026088 Bacteria 6378
210 Ga0207641_10054809 3300026088 Bacteria 3385
211 Ga0207641_10068364 3300026088 Bacteria 3046
212 Ga0207641_10546872 3300026088 Bacteria 1129
213 Ga0207648_10012600 3300026089 Bacteria 7911
214 Ga0207676_10232967 3300026095 Bacteria 1647
215 Ga0207683_10005275 3300026121 Bacteria 11092
216 Ga0207683_10007552 3300026121 Bacteria 9317
217 Ga0207683_10427805 3300026121 Bacteria 1220
218 Ga0207683_10493416 3300026121 Unclassified 1131
219 Ga0209813_10000030 3300027866 Bacteria 65385
220 Ga0209974_10050942 3300027876 Bacteria 1391
221 Ga0207428_10000004 3300027907 Bacteria 727800
222 Ga0207428_10000254 3300027907 Bacteria 72967
223 Ga0207428_10179263 3300027907 Unclassified 1601
224 Ga0268264_10067555 3300028381 Bacteria 3018
225 Ga0268264_10161936 3300028381 Bacteria 2016
226 Ga0265337_1005382 3300028556 Bacteria 5085
227 Ga0265338_10032818 3300028800 Bacteria 5054
228 Ga0265339_10001186 3300031249 Bacteria 19711
229 Ga0265316_10022910 3300031344 Bacteria 5255
230 Ga0307408_100262753 3300031548 Unclassified 1429
231 Ga0265314_10000002 3300031711 Bacteria 2092193
232 Ga0307516_10001826 3300031730 Bacteria 29257
233 Ga0307516_10002260 3300031730 Bacteria 25992
234 Ga0307516_10163136 3300031730 Bacteria 1977
235 Ga0307405_10083250 3300031731 Bacteria 2097
236 Ga0307410_10008765 3300031852 Bacteria 5631
237 Ga0307406_10069970 3300031901 Bacteria 2296
238 Ga0307407_10013048 3300031903 Bacteria 4019
239 Ga0307407_10098044 3300031903 Unclassified 1813
240 Ga0307412_10018377 3300031911 Bacteria 4205
241 Ga0307409_100244376 3300031995 Bacteria 1636
242 Ga0307409_100460406 3300031995 Unclassified 1229
243 Ga0307416_100001209 3300032002 Bacteria 13909
244 Ga0307414_10082199 3300032004 Bacteria 2361
245 Ga0307411_10011399 3300032005 Bacteria 4797
246 Ga0307411_10022672 3300032005 Bacteria 3702
247 Ga0307415_100088199 3300032126 Unclassified 2238
248 Ga0373937_0196761 3300036401 Bacteria 1894
249 Ga0373925_0003693 3300037068 Bacteria 11757
250 Ga0451835_0046063 3300041492 Bacteria 1129
251 Ga0451841_1309528 3300041498 Bacteria 2868
252 Ga0451853_0777360 3300041512 Bacteria 40336
253 Ga0439431_0006636 3300041997 Bacteria 2564
254 Ga0450920_000799 3300042122 Bacteria 5082
255 Ga0450920_002492 3300042122 Bacteria 3135
256 Ga0450920_023181 3300042122 Bacteria 1203
257 Ga0450923_000313 3300042125 Bacteria 4969
258 Ga0450923_001523 3300042125 Bacteria 3102
259 Ga0450895_000771 3300042132 Bacteria 2011
260 Ga0450898_007032 3300042134 Bacteria 1745
261 Ga0439446_0010396 3300042156 Bacteria 2504
262 Ga0439434_0022136 3300042435 Bacteria 1910
263 Ga0439435_0029002 3300042436 Unclassified 1491
264 Ga0450918_006520 3300042531 Bacteria 2078
265 Ga0451576_0179965 3300045051 Bacteria 2207
266 Ga0495638_0030407 3300046460 Bacteria 3477
267 Ga0495642_0027654 3300046528 Bacteria 2257
268 Ga0495609_0097542 3300046538 Bacteria 1275
269 Ga0495649_0211851 3300046694 Bacteria 1004
270 Ga0495674_0527879 3300047319 Bacteria 942
271 Ga0495675_0058724 3300047444 Bacteria 2439
272 Ga0496104_0572674 3300048907 Bacteria 1040
273 Ga0496108_0311860 3300048911 Bacteria 1371
274 Ga0496114_0050445 3300048917 Bacteria 3464
275 Ga0496114_0417016 3300048917 Bacteria 1189
276 Ga0496117_0012084 3300048920 Bacteria 7662
277 Ga0496120_0027179 3300048923 Bacteria 3524
278 Ga0496121_0000001 3300048924 Bacteria 1830318
279 Ga0496121_0070916 3300048924 Bacteria 2804
280 Ga0496122_0057442 3300048925 Bacteria 2889
281 Ga0496123_0027294 3300048926 Bacteria 4255
282 Ga0496124_0134375 3300048927 Bacteria 1960
283 Ga0496125_0000001 3300048928 Bacteria 1766138
284 Ga0501032_0086268 3300049569 Bacteria 2086
285 Ga0501034_0025741 3300049571 Bacteria 5992
286 Ga0501036_0119472 3300049572 Bacteria 2226
287 Ga0501037_0020291 3300049573 Bacteria 4906
288 Ga0501047_0032990 3300049581 Bacteria 4999
289 Ga0501067_0219221 3300049583 Bacteria 1059
290 Ga0501068_0008915 3300049584 Bacteria 5598
291 Ga0501070_0049291 3300049586 Bacteria 3497
292 Ga0501073_0029666 3300049589 Bacteria 3908
293 Ga0501075_0000923 3300049591 Bacteria 18653
294 Ga0501077_0002233 3300049593 Bacteria 11684
295 Ga0501080_0004041 3300049742 Bacteria 12993
296 Ga0501080_0005043 3300049742 Bacteria 11764
297 Ga0501081_0021148 3300049743 Bacteria 4342
298 Ga0501083_0052677 3300049744 Bacteria 2734
299 Ga0501044_0117360 3300049823 Bacteria 2665
300 nmdc:mga03683_129_c1 3300050489 Bacteria 25227
301 nmdc:mga03n38_2478_c1 3300050490 Bacteria 5710
302 nmdc:mga00v17_197315_c1 3300050491 Bacteria 1301
303 nmdc:mga00v17_31431_c1 3300050491 Bacteria 3131
304 nmdc:mga00v17_5527_c1 3300050491 Bacteria 6661
305 nmdc:mga0k408_40697_c1 3300050493 Bacteria 2675
306 nmdc:mga06z11_122_c1 3300050494 Bacteria 32025
307 nmdc:mga06z11_233963_c1 3300050494 Unclassified 1077
308 nmdc:mga06z11_67433_c1 3300050494 Bacteria 1883
309 nmdc:mga04h51_544_c1 3300050495 Bacteria 8972
310 nmdc:mga07m45_21619_c1 3300050496 Unclassified 3505
311 nmdc:mga07m45_32_c1 3300050496 Bacteria 78063
312 nmdc:mga07m45_50336_c1 3300050496 Bacteria 2347
313 nmdc:mga07m45_58943_c1 3300050496 Bacteria 2172
314 nmdc:mga05p37_193640_c1 3300050507 Bacteria 2466
315 nmdc:mga05p37_24070_c1 3300050507 Bacteria 7396
316 nmdc:mga05p37_5055_c1 3300050507 Bacteria 15461
317 nmdc:mga05p37_63120_c1 3300050507 Bacteria 4559
318 nmdc:mga05p37_798406_c1 3300050507 Bacteria 1033
319 nmdc:mga09592_121097_c1 3300050508 Bacteria 2248
320 nmdc:mga09592_8849_c1 3300050508 Bacteria 8189
321 nmdc:mga0qj67_7047_c1 3300050509 Bacteria 8289
322 nmdc:mga06r32_26226_c1 3300050510 Bacteria 5430
323 nmdc:mga06r32_30374_c1 3300050510 Bacteria 5069
324 nmdc:mga06r32_32081_c1 3300050510 Bacteria 4939
325 nmdc:mga06r32_47397_c1 3300050510 Bacteria 4105
326 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
327 nmdc:mga08y16_43936_c1 3300050511 Bacteria 4682
328 nmdc:mga08y16_505_c1 3300050511 Bacteria 36001
329 nmdc:mga0rr50_452429_c1 3300050513 Bacteria 1089
330 nmdc:mga0sz30_5603_c1 3300050516 Bacteria 4614
331 nmdc:mga0sz30_87766_c1 3300050516 Bacteria 1351
332 Ga0500635_0094975 3300053080 Bacteria 1090
333 Ga0500641_0024423 3300053096 Bacteria 2330
334 Ga0500595_021029 3300053119 Bacteria 2336
335 Ga0500595_039551 3300053119 Bacteria 1525
336 Ga0500607_000721 3300053121 Bacteria 31928
337 Ga0500626_085055 3300053128 Bacteria 1394
338 Ga0500652_000035 3300053131 Bacteria 74022
339 Ga0500616_0058852 3300053153 Bacteria 1997
340 Ga0500636_0008423 3300053177 Bacteria 5980
341 Ga0501082_0000991 3300060353 Bacteria 25066

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0012084 Ga0496117_0012084_6854_7609 245
2 3300005333 Ga0070677_10006391 Ga0070677_100063916 257
3 3300005456 Ga0070678_100433056 Ga0070678_1004330562 258
4 3300005543 Ga0070672_100426648 Ga0070672_1004266481 258
5 3300025940 Ga0207691_10369483 Ga0207691_103694831 258
6 3300047444 Ga0495675_0058724 Ga0495675_0058724_791_1582 258
7 3300048907 Ga0496104_0572674 Ga0496104_0572674_45_863 269
8 3300045051 Ga0451576_0179965 Ga0451576_0179965_1260_2099 271
9 3300009094 Ga0111539_10000002 Ga0111539_10000002507 272
10 3300031903 Ga0307407_10013048 Ga0307407_100130485 272
11 3300032005 Ga0307411_10022672 Ga0307411_100226723 272
12 3300050510 nmdc:mga06r32_30374_c1 nmdc:mga06r32_30374_c1_417_1238 272
13 3300050511 nmdc:mga08y16_2_c1 nmdc:mga08y16_2_c1_409291_410112 272
14 3300053080 Ga0500635_0094975 Ga0500635_0094975_94_921 272
15 3300003323 rootH1_10091269 rootH1_100912695 273
16 3300005295 Ga0065707_10089452 Ga0065707_100894522 273
17 3300005336 Ga0070680_100001980 Ga0070680_1000019806 273
18 3300005337 Ga0070682_100010373 Ga0070682_1000103735 273
19 3300005354 Ga0070675_100256590 Ga0070675_1002565902 273
20 3300005458 Ga0070681_10000970 Ga0070681_1000097013 273
21 3300005530 Ga0070679_100000493 Ga0070679_10000049313 273
22 3300005530 Ga0070679_100288342 Ga0070679_1002883422 273
23 3300005535 Ga0070684_100051796 Ga0070684_1000517962 273
24 3300005548 Ga0070665_100274047 Ga0070665_1002740472 273
25 3300005563 Ga0068855_100003019 Ga0068855_10000301912 273
26 3300005614 Ga0068856_100016841 Ga0068856_1000168415 273
27 3300005617 Ga0068859_100011142 Ga0068859_1000111424 273
28 3300005617 Ga0068859_100155477 Ga0068859_1001554774 273
29 3300005843 Ga0068860_100013038 Ga0068860_1000130388 273
30 3300005985 Ga0081539_10036288 Ga0081539_100362883 273
31 3300006038 Ga0075365_10009004 Ga0075365_100090042 273
32 3300006048 Ga0075363_100010151 Ga0075363_1000101514 273
33 3300006051 Ga0075364_10004317 Ga0075364_100043176 273
34 3300006051 Ga0075364_10041809 Ga0075364_100418093 273
35 3300006177 Ga0075362_10021057 Ga0075362_100210571 273
36 3300006178 Ga0075367_10004837 Ga0075367_100048372 273
37 3300006178 Ga0075367_10370016 Ga0075367_103700161 273
38 3300006186 Ga0075369_10004139 Ga0075369_100041394 273
39 3300006195 Ga0075366_10045235 Ga0075366_100452352 273
40 3300006353 Ga0075370_10058761 Ga0075370_100587612 273
41 3300006847 Ga0075431_100032317 Ga0075431_1000323176 273
42 3300006880 Ga0075429_100078088 Ga0075429_1000780882 273
43 3300006881 Ga0068865_100158933 Ga0068865_1001589332 273
44 3300006931 Ga0097620_100011142 Ga0097620_1000111424 273
45 3300006931 Ga0097620_100155473 Ga0097620_1001554734 273
46 3300009093 Ga0105240_10001245 Ga0105240_100012452 273
47 3300009094 Ga0111539_10044687 Ga0111539_100446872 273
48 3300009101 Ga0105247_10086124 Ga0105247_100861242 273
49 3300009147 Ga0114129_10055508 Ga0114129_100555082 273
50 3300013306 Ga0163162_10158919 Ga0163162_101589192 273
51 3300013306 Ga0163162_10351475 Ga0163162_103514752 273
52 3300014325 Ga0163163_10282932 Ga0163163_102829322 273
53 3300014326 Ga0157380_10153683 Ga0157380_101536832 273
54 3300014969 Ga0157376_10032075 Ga0157376_100320753 273
55 3300021384 Ga0213876_10002243 Ga0213876_100022438 273
56 3300025910 Ga0207684_10124572 Ga0207684_101245722 273
57 3300025917 Ga0207660_10247519 Ga0207660_102475192 273
58 3300025926 Ga0207659_10213518 Ga0207659_102135182 273
59 3300025938 Ga0207704_10102373 Ga0207704_101023732 273
60 3300025949 Ga0207667_10004619 Ga0207667_100046193 273
61 3300027866 Ga0209813_10000030 Ga0209813_1000003019 273
62 3300027907 Ga0207428_10179263 Ga0207428_101792632 273
63 3300028381 Ga0268264_10067555 Ga0268264_100675554 273
64 3300028556 Ga0265337_1005382 Ga0265337_10053821 273
65 3300028800 Ga0265338_10032818 Ga0265338_100328183 273
66 3300031249 Ga0265339_10001186 Ga0265339_100011866 273
67 3300031344 Ga0265316_10022910 Ga0265316_100229105 273
68 3300031711 Ga0265314_10000002 Ga0265314_10000002451 273
69 3300031730 Ga0307516_10001826 Ga0307516_100018265 273
70 3300031730 Ga0307516_10002260 Ga0307516_100022605 273
71 3300031731 Ga0307405_10083250 Ga0307405_100832502 273
72 3300031995 Ga0307409_100244376 Ga0307409_1002443763 273
73 3300032126 Ga0307415_100088199 Ga0307415_1000881991 273
74 3300041492 Ga0451835_0046063 Ga0451835_0046063_49_915 273
75 3300041498 Ga0451841_1309528 Ga0451841_1309528_1810_2676 273
76 3300041512 Ga0451853_0777360 Ga0451853_0777360_17045_17911 273
77 3300048911 Ga0496108_0311860 Ga0496108_0311860_386_1234 273
78 3300048917 Ga0496114_0417016 Ga0496114_0417016_15_869 273
79 3300049583 Ga0501067_0219221 Ga0501067_0219221_121_945 273
80 3300049591 Ga0501075_0000923 Ga0501075_0000923_17428_18258 273
81 3300049593 Ga0501077_0002233 Ga0501077_0002233_10276_11106 273
82 3300049742 Ga0501080_0005043 Ga0501080_0005043_3308_4138 273
83 3300050491 nmdc:mga00v17_5527_c1 nmdc:mga00v17_5527_c1_5498_6322 273
84 3300050494 nmdc:mga06z11_233963_c1 nmdc:mga06z11_233963_c1_44_871 273
85 3300050496 nmdc:mga07m45_50336_c1 nmdc:mga07m45_50336_c1_1263_2102 273
86 3300050496 nmdc:mga07m45_58943_c1 nmdc:mga07m45_58943_c1_248_1075 273
87 3300050507 nmdc:mga05p37_798406_c1 nmdc:mga05p37_798406_c1_180_1013 273
88 3300050508 nmdc:mga09592_8849_c1 nmdc:mga09592_8849_c1_6644_7474 273
89 3300050510 nmdc:mga06r32_26226_c1 nmdc:mga06r32_26226_c1_1474_2304 273
90 3300050511 nmdc:mga08y16_43936_c1 nmdc:mga08y16_43936_c1_1921_2751 273
91 3300050516 nmdc:mga0sz30_87766_c1 nmdc:mga0sz30_87766_c1_10_849 273
92 3300053096 Ga0500641_0024423 Ga0500641_0024423_241_1068 273
93 3300053119 Ga0500595_021029 Ga0500595_021029_199_1026 273
94 3300053121 Ga0500607_000721 Ga0500607_000721_24862_25743 273
95 3300053153 Ga0500616_0058852 Ga0500616_0058852_492_1322 273
96 3300060353 Ga0501082_0000991 Ga0501082_0000991_460_1290 273
97 iso_pu_bacteria 2738543024 2739310586 273
98 iso_pu_bacteria 2840878972 2840881553 273
99 iso_pu_bacteria 2885312484 2885317664 273
100 iso_pu_bacteria 2929138655 2929139661 273
101 3300003791 Ga0055530_10000061 Ga0055530_1000006158 275
102 3300003794 Ga0055531_10000035 Ga0055531_1000003590 275
103 3300005262 Ga0065165_1035619 Ga0065165_10356192 275
104 3300005436 Ga0070713_100028117 Ga0070713_1000281174 275
105 3300005444 Ga0070694_100081258 Ga0070694_1000812581 275
106 3300005445 Ga0070708_100194246 Ga0070708_1001942462 275
107 3300005467 Ga0070706_100032200 Ga0070706_1000322005 275
108 3300005471 Ga0070698_100015893 Ga0070698_1000158935 275
109 3300005471 Ga0070698_100022909 Ga0070698_1000229094 275
110 3300005518 Ga0070699_100356918 Ga0070699_1003569182 275
111 3300005549 Ga0070704_100006975 Ga0070704_1000069754 275
112 3300006173 Ga0070716_100252370 Ga0070716_1002523701 275
113 3300006844 Ga0075428_100345772 Ga0075428_1003457722 275
114 3300006846 Ga0075430_100422465 Ga0075430_1004224651 275
115 3300009098 Ga0105245_10184160 Ga0105245_101841602 275
116 3300009147 Ga0114129_10014748 Ga0114129_100147489 275
117 3300025298 Ga0209050_1000014 Ga0209050_1000014453 275
118 3300025304 Ga0209257_1000019 Ga0209257_1000019239 275
119 3300025910 Ga0207684_10035574 Ga0207684_100355744 275
120 3300025927 Ga0207687_10114149 Ga0207687_101141493 275
121 3300025928 Ga0207700_10028316 Ga0207700_100283164 275
122 3300026088 Ga0207641_10054809 Ga0207641_100548093 275
123 3300037068 Ga0373925_0003693 Ga0373925_0003693_4686_5534 275
124 3300047319 Ga0495674_0527879 Ga0495674_0527879_50_892 275
125 3300048917 Ga0496114_0050445 Ga0496114_0050445_773_1621 275
126 3300049569 Ga0501032_0086268 Ga0501032_0086268_927_1778 275
127 3300049571 Ga0501034_0025741 Ga0501034_0025741_1183_2034 275
128 3300049572 Ga0501036_0119472 Ga0501036_0119472_1046_1897 275
129 3300049573 Ga0501037_0020291 Ga0501037_0020291_1533_2384 275
130 3300049581 Ga0501047_0032990 Ga0501047_0032990_3856_4707 275
131 3300049586 Ga0501070_0049291 Ga0501070_0049291_2232_3083 275
132 3300049823 Ga0501044_0117360 Ga0501044_0117360_261_1112 275
133 3300050507 nmdc:mga05p37_5055_c1 nmdc:mga05p37_5055_c1_8844_9695 275
134 3300053128 Ga0500626_085055 Ga0500626_085055_287_1114 275
135 3300053131 Ga0500652_000035 Ga0500652_000035_23954_24793 275
136 3300053177 Ga0500636_0008423 Ga0500636_0008423_674_1513 275
137 3300002774 JGI25150J39212_1000050 JGI25150J39212_100005036 276
138 3300003215 JGI25153J46596_10000036 JGI25153J46596_1000003685 276
139 3300003773 Ga0055537_1001195 Ga0055537_100119510 276
140 3300003792 Ga0055540_1001026 Ga0055540_100102617 276
141 3300003792 Ga0055540_1003043 Ga0055540_10030434 276
142 3300005295 Ga0065707_10192591 Ga0065707_101925911 276
143 3300005331 Ga0070670_100004206 Ga0070670_10000420612 276
144 3300005331 Ga0070670_100162041 Ga0070670_1001620411 276
145 3300005338 Ga0068868_100445054 Ga0068868_1004450541 276
146 3300005347 Ga0070668_100005801 Ga0070668_1000058015 276
147 3300005354 Ga0070675_100004438 Ga0070675_1000044383 276
148 3300005354 Ga0070675_100015161 Ga0070675_1000151613 276
149 3300005354 Ga0070675_100041394 Ga0070675_1000413945 276
150 3300005355 Ga0070671_100346980 Ga0070671_1003469801 276
151 3300005356 Ga0070674_100055540 Ga0070674_1000555402 276
152 3300005364 Ga0070673_100032058 Ga0070673_1000320582 276
153 3300005364 Ga0070673_100166121 Ga0070673_1001661211 276
154 3300005364 Ga0070673_100341716 Ga0070673_1003417162 276
155 3300005440 Ga0070705_100004292 Ga0070705_1000042927 276
156 3300005444 Ga0070694_100005979 Ga0070694_1000059795 276
157 3300005445 Ga0070708_100027203 Ga0070708_1000272032 276
158 3300005456 Ga0070678_100018570 Ga0070678_1000185702 276
159 3300005459 Ga0068867_100141232 Ga0068867_1001412322 276
160 3300005468 Ga0070707_100112233 Ga0070707_1001122334 276
161 3300005471 Ga0070698_100025085 Ga0070698_1000250857 276
162 3300005471 Ga0070698_100039630 Ga0070698_1000396304 276
163 3300005518 Ga0070699_100011468 Ga0070699_1000114682 276
164 3300005518 Ga0070699_100100651 Ga0070699_1001006512 276
165 3300005543 Ga0070672_100000626 Ga0070672_10000062618 276
166 3300005543 Ga0070672_100029882 Ga0070672_1000298824 276
167 3300005545 Ga0070695_100147726 Ga0070695_1001477262 276
168 3300005546 Ga0070696_100002045 Ga0070696_1000020458 276
169 3300005549 Ga0070704_100002323 Ga0070704_1000023232 276
170 3300005617 Ga0068859_100242218 Ga0068859_1002422183 276
171 3300005618 Ga0068864_100074973 Ga0068864_1000749732 276
172 3300005618 Ga0068864_100514545 Ga0068864_1005145452 276
173 3300005841 Ga0068863_100026736 Ga0068863_1000267363 276
174 3300005841 Ga0068863_100300587 Ga0068863_1003005872 276
175 3300005843 Ga0068860_100096633 Ga0068860_1000966332 276
176 3300006042 Ga0075368_10007058 Ga0075368_100070583 276
177 3300006051 Ga0075364_10033079 Ga0075364_100330792 276
178 3300006051 Ga0075364_10035512 Ga0075364_100355121 276
179 3300006178 Ga0075367_10009199 Ga0075367_100091993 276
180 3300006178 Ga0075367_10098498 Ga0075367_100984982 276
181 3300006237 Ga0097621_100001714 Ga0097621_1000017147 276
182 3300006237 Ga0097621_100031026 Ga0097621_1000310265 276
183 3300006237 Ga0097621_100319680 Ga0097621_1003196802 276
184 3300006237 Ga0097621_100357712 Ga0097621_1003577122 276
185 3300006353 Ga0075370_10085867 Ga0075370_100858672 276
186 3300006358 Ga0068871_100020120 Ga0068871_1000201202 276
187 3300006358 Ga0068871_100253596 Ga0068871_1002535962 276
188 3300006844 Ga0075428_100000019 Ga0075428_10000001937 276
189 3300006844 Ga0075428_100001448 Ga0075428_10000144813 276
190 3300006844 Ga0075428_100009562 Ga0075428_1000095628 276
191 3300006846 Ga0075430_100024348 Ga0075430_1000243483 276
192 3300006846 Ga0075430_100358489 Ga0075430_1003584892 276
193 3300006847 Ga0075431_100004860 Ga0075431_10000486011 276
194 3300006847 Ga0075431_100023330 Ga0075431_1000233303 276
195 3300006847 Ga0075431_100038730 Ga0075431_1000387302 276
196 3300006871 Ga0075434_100008947 Ga0075434_1000089473 276
197 3300006880 Ga0075429_100010994 Ga0075429_1000109947 276
198 3300006881 Ga0068865_100118083 Ga0068865_1001180832 276
199 3300006931 Ga0097620_100242212 Ga0097620_1002422123 276
200 3300007076 Ga0075435_100155483 Ga0075435_1001554831 276
201 3300009011 Ga0105251_10100610 Ga0105251_101006102 276
202 3300009147 Ga0114129_10030841 Ga0114129_100308411 276
203 3300009147 Ga0114129_10153508 Ga0114129_101535081 276
204 3300009147 Ga0114129_10203196 Ga0114129_102031964 276
205 3300009176 Ga0105242_10020366 Ga0105242_100203662 276
206 3300009176 Ga0105242_10206390 Ga0105242_102063902 276
207 3300009176 Ga0105242_10522326 Ga0105242_105223262 276
208 3300009177 Ga0105248_10013027 Ga0105248_100130275 276
209 3300009177 Ga0105248_10069664 Ga0105248_100696644 276
210 3300009177 Ga0105248_10080954 Ga0105248_100809545 276
211 3300009177 Ga0105248_10133015 Ga0105248_101330155 276
212 3300009177 Ga0105248_10309930 Ga0105248_103099301 276
213 3300009177 Ga0105248_10371429 Ga0105248_103714292 276
214 3300009545 Ga0105237_10029907 Ga0105237_100299072 276
215 3300013306 Ga0163162_10306988 Ga0163162_103069882 276
216 3300013308 Ga0157375_10001936 Ga0157375_100019369 276
217 3300013308 Ga0157375_10094616 Ga0157375_100946164 276
218 3300013308 Ga0157375_10158524 Ga0157375_101585242 276
219 3300014325 Ga0163163_10000001 Ga0163163_1000000143 276
220 3300014326 Ga0157380_10003065 Ga0157380_100030655 276
221 3300014326 Ga0157380_10408536 Ga0157380_104085361 276
222 3300014745 Ga0157377_10151734 Ga0157377_101517342 276
223 3300014968 Ga0157379_10067660 Ga0157379_100676601 276
224 3300014969 Ga0157376_10027316 Ga0157376_100273163 276
225 3300014969 Ga0157376_10124210 Ga0157376_101242102 276
226 3300014969 Ga0157376_10170148 Ga0157376_101701483 276
227 3300017792 Ga0163161_10523430 Ga0163161_105234301 276
228 3300025245 Ga0207425_1000037 Ga0207425_100003769 276
229 3300025263 Ga0209565_1000290 Ga0209565_100029019 276
230 3300025273 Ga0209673_1003989 Ga0209673_10039893 276
231 3300025294 Ga0209025_1000117 Ga0209025_1000117103 276
232 3300025295 Ga0209564_1001191 Ga0209564_10011915 276
233 3300025295 Ga0209564_1024902 Ga0209564_10249021 276
234 3300025297 Ga0209758_1000103 Ga0209758_100010369 276
235 3300025297 Ga0209758_1047667 Ga0209758_10476673 276
236 3300025298 Ga0209050_1000001 Ga0209050_10000013379 276
237 3300025298 Ga0209050_1010540 Ga0209050_10105404 276
238 3300025298 Ga0209050_1010745 Ga0209050_10107453 276
239 3300025302 Ga0207426_1051357 Ga0207426_10513571 276
240 3300025303 Ga0209051_1000838 Ga0209051_100083814 276
241 3300025304 Ga0209257_1001391 Ga0209257_100139113 276
242 3300025304 Ga0209257_1001422 Ga0209257_100142213 276
243 3300025315 Ga0207697_10018343 Ga0207697_100183432 276
244 3300025893 Ga0207682_10005937 Ga0207682_100059373 276
245 3300025907 Ga0207645_10078691 Ga0207645_100786912 276
246 3300025914 Ga0207671_10060494 Ga0207671_100604942 276
247 3300025922 Ga0207646_10095586 Ga0207646_100955862 276
248 3300025925 Ga0207650_10000254 Ga0207650_100002545 276
249 3300025925 Ga0207650_10141163 Ga0207650_101411632 276
250 3300025926 Ga0207659_10019525 Ga0207659_100195253 276
251 3300025926 Ga0207659_10034072 Ga0207659_100340723 276
252 3300025926 Ga0207659_10116816 Ga0207659_101168161 276
253 3300025926 Ga0207659_10199213 Ga0207659_101992132 276
254 3300025931 Ga0207644_10229279 Ga0207644_102292792 276
255 3300025933 Ga0207706_10511951 Ga0207706_105119511 276
256 3300025934 Ga0207686_10288324 Ga0207686_102883242 276
257 3300025938 Ga0207704_10040220 Ga0207704_100402205 276
258 3300025938 Ga0207704_10439161 Ga0207704_104391612 276
259 3300025940 Ga0207691_10016932 Ga0207691_100169324 276
260 3300025941 Ga0207711_10022513 Ga0207711_100225133 276
261 3300025941 Ga0207711_10035038 Ga0207711_100350383 276
262 3300025941 Ga0207711_10086598 Ga0207711_100865982 276
263 3300025941 Ga0207711_10119978 Ga0207711_101199784 276
264 3300025941 Ga0207711_10194241 Ga0207711_101942411 276
265 3300025941 Ga0207711_10291314 Ga0207711_102913142 276
266 3300025942 Ga0207689_10109109 Ga0207689_101091092 276
267 3300025960 Ga0207651_10015533 Ga0207651_100155332 276
268 3300025960 Ga0207651_10053667 Ga0207651_100536673 276
269 3300025972 Ga0207668_10003551 Ga0207668_100035516 276
270 3300025986 Ga0207658_10000347 Ga0207658_100003472 276
271 3300026067 Ga0207678_10439486 Ga0207678_104394862 276
272 3300026075 Ga0207708_10573274 Ga0207708_105732741 276
273 3300026088 Ga0207641_10014883 Ga0207641_100148831 276
274 3300026088 Ga0207641_10068364 Ga0207641_100683643 276
275 3300026088 Ga0207641_10546872 Ga0207641_105468722 276
276 3300026089 Ga0207648_10012600 Ga0207648_100126002 276
277 3300026095 Ga0207676_10232967 Ga0207676_102329671 276
278 3300026121 Ga0207683_10005275 Ga0207683_1000527510 276
279 3300026121 Ga0207683_10007552 Ga0207683_100075529 276
280 3300026121 Ga0207683_10427805 Ga0207683_104278052 276
281 3300026121 Ga0207683_10493416 Ga0207683_104934161 276
282 3300027876 Ga0209974_10050942 Ga0209974_100509422 276
283 3300027907 Ga0207428_10000004 Ga0207428_10000004149 276
284 3300027907 Ga0207428_10000254 Ga0207428_1000025453 276
285 3300028381 Ga0268264_10161936 Ga0268264_101619362 276
286 3300031548 Ga0307408_100262753 Ga0307408_1002627532 276
287 3300031730 Ga0307516_10163136 Ga0307516_101631361 276
288 3300031852 Ga0307410_10008765 Ga0307410_100087652 276
289 3300031901 Ga0307406_10069970 Ga0307406_100699702 276
290 3300031903 Ga0307407_10098044 Ga0307407_100980442 276
291 3300031911 Ga0307412_10018377 Ga0307412_100183774 276
292 3300031995 Ga0307409_100460406 Ga0307409_1004604062 276
293 3300032002 Ga0307416_100001209 Ga0307416_1000012095 276
294 3300032004 Ga0307414_10082199 Ga0307414_100821992 276
295 3300032005 Ga0307411_10011399 Ga0307411_100113994 276
296 3300036401 Ga0373937_0196761 Ga0373937_0196761_266_1141 276
297 3300041997 Ga0439431_0006636 Ga0439431_0006636_118_1032 276
298 3300042122 Ga0450920_000799 Ga0450920_000799_3574_4410 276
299 3300042122 Ga0450920_002492 Ga0450920_002492_2123_3037 276
300 3300042122 Ga0450920_023181 Ga0450920_023181_159_1058 276
301 3300042125 Ga0450923_000313 Ga0450923_000313_594_1430 276
302 3300042125 Ga0450923_001523 Ga0450923_001523_1382_2296 276
303 3300042132 Ga0450895_000771 Ga0450895_000771_498_1334 276
304 3300042134 Ga0450898_007032 Ga0450898_007032_795_1709 276
305 3300042156 Ga0439446_0010396 Ga0439446_0010396_1514_2428 276
306 3300042435 Ga0439434_0022136 Ga0439434_0022136_797_1711 276
307 3300042436 Ga0439435_0029002 Ga0439435_0029002_70_984 276
308 3300042531 Ga0450918_006520 Ga0450918_006520_421_1260 276
309 3300046460 Ga0495638_0030407 Ga0495638_0030407_2594_3436 276
310 3300046528 Ga0495642_0027654 Ga0495642_0027654_1114_1968 276
311 3300046538 Ga0495609_0097542 Ga0495609_0097542_375_1247 276
312 3300046694 Ga0495649_0211851 Ga0495649_0211851_104_985 276
313 3300048923 Ga0496120_0027179 Ga0496120_0027179_1291_2154 276
314 3300048924 Ga0496121_0000001 Ga0496121_0000001_1032247_1033110 276
315 3300048924 Ga0496121_0070916 Ga0496121_0070916_371_1213 276
316 3300048925 Ga0496122_0057442 Ga0496122_0057442_688_1551 276
317 3300048926 Ga0496123_0027294 Ga0496123_0027294_320_1183 276
318 3300048927 Ga0496124_0134375 Ga0496124_0134375_587_1450 276
319 3300048928 Ga0496125_0000001 Ga0496125_0000001_1192805_1193668 276
320 3300049584 Ga0501068_0008915 Ga0501068_0008915_297_1127 276
321 3300049589 Ga0501073_0029666 Ga0501073_0029666_1001_1831 276
322 3300049742 Ga0501080_0004041 Ga0501080_0004041_5470_6300 276
323 3300049743 Ga0501081_0021148 Ga0501081_0021148_3418_4260 276
324 3300049744 Ga0501083_0052677 Ga0501083_0052677_1814_2644 276
325 3300050489 nmdc:mga03683_129_c1 nmdc:mga03683_129_c1_15703_16596 276
326 3300050490 nmdc:mga03n38_2478_c1 nmdc:mga03n38_2478_c1_2665_3558 276
327 3300050491 nmdc:mga00v17_197315_c1 nmdc:mga00v17_197315_c1_349_1242 276
328 3300050491 nmdc:mga00v17_31431_c1 nmdc:mga00v17_31431_c1_515_1378 276
329 3300050493 nmdc:mga0k408_40697_c1 nmdc:mga0k408_40697_c1_116_994 276
330 3300050494 nmdc:mga06z11_122_c1 nmdc:mga06z11_122_c1_18388_19281 276
331 3300050494 nmdc:mga06z11_67433_c1 nmdc:mga06z11_67433_c1_952_1794 276
332 3300050495 nmdc:mga04h51_544_c1 nmdc:mga04h51_544_c1_5997_6890 276
333 3300050496 nmdc:mga07m45_21619_c1 nmdc:mga07m45_21619_c1_313_1191 276
334 3300050496 nmdc:mga07m45_32_c1 nmdc:mga07m45_32_c1_15703_16596 276
335 3300050507 nmdc:mga05p37_193640_c1 nmdc:mga05p37_193640_c1_1175_2047 276
336 3300050507 nmdc:mga05p37_24070_c1 nmdc:mga05p37_24070_c1_1541_2416 276
337 3300050507 nmdc:mga05p37_63120_c1 nmdc:mga05p37_63120_c1_109_963 276
338 3300050508 nmdc:mga09592_121097_c1 nmdc:mga09592_121097_c1_542_1396 276
339 3300050509 nmdc:mga0qj67_7047_c1 nmdc:mga0qj67_7047_c1_925_1779 276
340 3300050510 nmdc:mga06r32_32081_c1 nmdc:mga06r32_32081_c1_4062_4916 276
341 3300050510 nmdc:mga06r32_47397_c1 nmdc:mga06r32_47397_c1_2075_2947 276
342 3300050511 nmdc:mga08y16_505_c1 nmdc:mga08y16_505_c1_17357_18232 276
343 3300050513 nmdc:mga0rr50_452429_c1 nmdc:mga0rr50_452429_c1_48_932 276
344 3300050516 nmdc:mga0sz30_5603_c1 nmdc:mga0sz30_5603_c1_500_1393 276
345 3300053119 Ga0500595_039551 Ga0500595_039551_645_1487 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

27

256

0.97

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

31

254

0.8

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

33

260

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p0y-assembly1.cif.gz_A crystal structure of mtbmgl k74a (substrate analog complex) 0.9763 1 276
7p0y-assembly1.cif.gz_A crystal structure of mtbmgl k74a (substrate analog complex) 0.9729 1 276
7p0y-assembly2.cif.gz_B crystal structure of mtbmgl k74a (substrate analog complex) 0.9704 5 276
6eic-assembly3.cif.gz_B crystal structure of rv0183, a monoglyceride lipase from mycobacterium tuberculosis 0.9695 1 276
6eic-assembly1.cif.gz_C crystal structure of rv0183, a monoglyceride lipase from mycobacterium tuberculosis 0.9662 1 276
ID Description Score Start End Superfamily
af_Q4CSM0_30_309_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9705 8 276 3.40.50.1820
af_O07427_2_279_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9694 1 276 3.40.50.1820
af_O07427_2_279_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.966 1 276 3.40.50.1820
af_A4I6N9_26_311_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9648 8 275 3.40.50.1820
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9539 5 134 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A529KHK2-F1-model_v4 Alpha/beta hydrolase 0.9898 5 204 GO:0016787
AF-A0A7W1S6N4-F1-model_v4 Alpha/beta hydrolase 0.9842 3 274 GO:0016787
AF-A0A3M1EJD1-F1-model_v4 Alpha/beta fold hydrolase 0.9795 3 129 GO:0016787
AF-A0A3L7XS69-F1-model_v4 Alpha/beta fold hydrolase 0.976 1 129 GO:0016020
GO:0016787
AF-A0A534IFS6-F1-model_v4 Lysophospholipase 0.9754 3 275

Feature Viewer

pLDDT pTM Quality
95.91 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map