F416478

General Info

Members Datasets Scaffolds Average Seq Length
345 222 334 118

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0229280|Ga0466965_0229280_212_622
Length 136
Sequence MKGNEDAALDRAFLALADPVRRAIVARLSRGPATVNELAEPFPISKQAVSKHIAVLEQAGLVSRSRDAQRRPVHLEPAALERLTAWIDRYRLETERGYRRLDAVLGGLGKVTGPVRGSAAERTIAPNTEHDKEQGT

Samples

Sample ID Description Type Environment
1 2643221566 Microbacterium sp. Root166 Isolate Unclassified
2 2643221613 Oerskovia sp. Root22 Isolate Unclassified
3 2643221721 Oerskovia sp. Root918 Isolate Unclassified
4 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
5 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
6 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
7 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
8 2928153084 Leifsonia sp. 563 Isolate Unclassified
9 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
84 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
129 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
130 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
131 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
132 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
133 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
134 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
151 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
162 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
216 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
217 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
218 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
221 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
222 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.23
Metatranscriptomes 0.58
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.14
Nodule 0
Rhizoplane 8.99
Rhizosphere 70.72
Stem 0
Stem Tuber 0
Unclassified 10.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008848 3300001979 Bacteria 3988
2 JGI24739J22299_10025474 3300001989 Bacteria 2080
3 JGI24739J22299_10087095 3300001989 Bacteria 954
4 JGI24737J22298_10002795 3300001990 Bacteria 6182
5 JGI24737J22298_10225385 3300001990 Bacteria 553
6 JGI24735J21928_10000460 3300002067 Bacteria 14319
7 JGI24735J21928_10187904 3300002067 Bacteria 598
8 JGI25152J39213_1000109 3300002773 Bacteria 57724
9 Ga0006562J51391_1003466 3300003578 Bacteria 13358
10 Ga0006562J51391_1003468 3300003578 Bacteria 10700
11 Ga0055539_1000103 3300003752 Bacteria 96081
12 Ga0055533_1000020 3300003756 Bacteria 353998
13 Ga0055532_1009858 3300003758 Bacteria 1153
14 Ga0055525_1000312 3300003759 Bacteria 39548
15 Ga0055525_1008338 3300003759 Bacteria 876
16 Ga0055527_1000003 3300003760 Bacteria 705001
17 Ga0055542_1000005 3300003762 Bacteria 550280
18 Ga0055529_1000046 3300003763 Bacteria 209430
19 Ga0055541_1013899 3300003841 Bacteria 1111
20 Ga0065704_10366310 3300005289 Bacteria 791
21 Ga0070666_10949577 3300005335 Bacteria 637
22 Ga0070682_100106894 3300005337 Bacteria 1858
23 Ga0070660_100436733 3300005339 Bacteria 1085
24 Ga0070668_100036544 3300005347 Bacteria 3749
25 Ga0070668_100152827 3300005347 Bacteria 1868
26 Ga0070668_100184947 3300005347 Bacteria 1704
27 Ga0070671_100286206 3300005355 Bacteria 1402
28 Ga0070671_101902784 3300005355 Bacteria 529
29 Ga0070674_100043553 3300005356 Bacteria 3054
30 Ga0070674_101247891 3300005356 Bacteria 661
31 Ga0070667_100027767 3300005367 Bacteria 4709
32 Ga0070667_100052291 3300005367 Bacteria 3446
33 Ga0070667_100174265 3300005367 Bacteria 1900
34 Ga0070667_100911269 3300005367 Bacteria 818
35 Ga0070710_10809980 3300005437 Bacteria 670
36 Ga0070711_100191205 3300005439 Bacteria 1573
37 Ga0070663_100118851 3300005455 Bacteria 1994
38 Ga0070663_101402423 3300005455 Bacteria 619
39 Ga0070685_10139992 3300005466 Bacteria 1522
40 Ga0068853_100591692 3300005539 Bacteria 1053
41 Ga0070672_100186931 3300005543 Bacteria 1728
42 Ga0070686_100744595 3300005544 Bacteria 785
43 Ga0070686_101103294 3300005544 Bacteria 655
44 Ga0070665_100023366 3300005548 Bacteria 6224
45 Ga0070665_100123356 3300005548 Bacteria 2593
46 Ga0070665_101811081 3300005548 Unclassified 617
47 Ga0068852_100564900 3300005616 Bacteria 1139
48 Ga0068859_100869665 3300005617 Bacteria 987
49 Ga0068864_100853774 3300005618 Bacteria 897
50 Ga0068864_102014071 3300005618 Bacteria 584
51 Ga0068866_10077627 3300005718 Bacteria 1774
52 Ga0068863_100259127 3300005841 Bacteria 1681
53 Ga0068863_100434606 3300005841 Bacteria 1287
54 Ga0068863_100602905 3300005841 Bacteria 1087
55 Ga0068863_100618891 3300005841 Bacteria 1072
56 Ga0068858_100116428 3300005842 Bacteria 2498
57 Ga0068860_100249777 3300005843 Bacteria 1727
58 Ga0068860_101795099 3300005843 Bacteria 635
59 Ga0068860_102049958 3300005843 Bacteria 593
60 Ga0068862_100130059 3300005844 Bacteria 2226
61 Ga0081455_10035070 3300005937 Bacteria 4488
62 Ga0070717_10182779 3300006028 Unclassified 1829
63 Ga0075363_100220422 3300006048 Bacteria 1087
64 Ga0075364_10686494 3300006051 Bacteria 699
65 Ga0070712_101494712 3300006175 Bacteria 590
66 Ga0097621_100251260 3300006237 Bacteria 1548
67 Ga0068871_102077679 3300006358 Bacteria 541
68 Ga0097620_100869658 3300006931 Bacteria 987
69 Ga0105244_10438023 3300009036 Bacteria 601
70 Ga0111539_13286804 3300009094 Bacteria 521
71 Ga0105245_11317511 3300009098 Bacteria 771
72 Ga0105247_10403063 3300009101 Bacteria 975
73 Ga0105243_11086102 3300009148 Bacteria 808
74 Ga0105248_10019473 3300009177 Bacteria 7509
75 Ga0105248_11965897 3300009177 Bacteria 664
76 Ga0105238_10553728 3300009551 Bacteria 1155
77 Ga0105249_10008536 3300009553 Bacteria 8931
78 Ga0105239_11641132 3300010375 Bacteria 744
79 Ga0157369_11522154 3300013105 Bacteria 680
80 Ga0171462_1005 3300013250 Bacteria 598379
81 Ga0157374_10641082 3300013296 Bacteria 1074
82 Ga0157374_11325618 3300013296 Bacteria 742
83 Ga0157378_10286235 3300013297 Bacteria 1590
84 Ga0157378_12919352 3300013297 Bacteria 530
85 Ga0157372_10172464 3300013307 Bacteria 2503
86 Ga0157372_10445782 3300013307 Bacteria 1509
87 Ga0157372_12744693 3300013307 Bacteria 565
88 Ga0157375_10320983 3300013308 Bacteria 1713
89 Ga0157375_10410477 3300013308 Bacteria 1520
90 Ga0157375_10806722 3300013308 Bacteria 1087
91 Ga0157375_10818895 3300013308 Bacteria 1079
92 Ga0157375_11343715 3300013308 Bacteria 841
93 Ga0163163_10493097 3300014325 Bacteria 1287
94 Ga0163163_10879199 3300014325 Bacteria 959
95 Ga0157380_12212421 3300014326 Bacteria 614
96 Ga0157379_10400783 3300014968 Bacteria 1261
97 Ga0157379_12003661 3300014968 Unclassified 572
98 Ga0157376_11315174 3300014969 Bacteria 753
99 Ga0163161_10487853 3300017792 Bacteria 1001
100 Ga0213876_10036054 3300021384 Bacteria 2608
101 Ga0213876_10068723 3300021384 Bacteria 1871
102 Ga0209566_100043 3300025225 Bacteria 266609
103 Ga0209674_100001 3300025226 Bacteria 4013750
104 Ga0209672_100003 3300025228 Bacteria 1560476
105 Ga0209147_100372 3300025229 Bacteria 31562
106 Ga0209563_100001 3300025230 Bacteria 4013775
107 Ga0209563_100183 3300025230 Bacteria 37635
108 Ga0209258_102281 3300025242 Bacteria 5125
109 Ga0207425_1007710 3300025245 Bacteria 2813
110 Ga0209677_100001 3300025253 Bacteria 4013787
111 Ga0209148_1000004 3300025254 Bacteria 1844481
112 Ga0209129_1000180 3300025258 Bacteria 90882
113 Ga0209129_1033690 3300025258 Bacteria 841
114 Ga0209455_1000080 3300025272 Bacteria 266151
115 Ga0209455_1000654 3300025272 Bacteria 21171
116 Ga0209025_1001362 3300025294 Bacteria 32778
117 Ga0207642_10125597 3300025899 Bacteria 1330
118 Ga0207710_10598151 3300025900 Bacteria 576
119 Ga0207647_10025877 3300025904 Bacteria 3847
120 Ga0207647_10038455 3300025904 Bacteria 3025
121 Ga0207663_11201837 3300025916 Bacteria 610
122 Ga0207657_10457280 3300025919 Bacteria 1001
123 Ga0207694_10987611 3300025924 Bacteria 712
124 Ga0207700_11994692 3300025928 Bacteria 507
125 Ga0207644_10891629 3300025931 Bacteria 745
126 Ga0207669_10309337 3300025937 Bacteria 1204
127 Ga0207691_10330485 3300025940 Bacteria 1306
128 Ga0207711_10069718 3300025941 Bacteria 3049
129 Ga0207689_10685381 3300025942 Bacteria 864
130 Ga0207668_10002408 3300025972 Bacteria 10939
131 Ga0207668_10050482 3300025972 Bacteria 2867
132 Ga0207668_10116521 3300025972 Bacteria 2015
133 Ga0207658_10182722 3300025986 Bacteria 1737
134 Ga0207658_10231582 3300025986 Bacteria 1560
135 Ga0207658_10508665 3300025986 Bacteria 1074
136 Ga0207677_10337473 3300026023 Bacteria 1258
137 Ga0207703_10367989 3300026035 Bacteria 1327
138 Ga0207703_11817405 3300026035 Bacteria 585
139 Ga0207678_10458212 3300026067 Bacteria 1109
140 Ga0207678_10634877 3300026067 Bacteria 938
141 Ga0207708_10392898 3300026075 Bacteria 1145
142 Ga0207641_10194952 3300026088 Bacteria 1864
143 Ga0207641_10246706 3300026088 Bacteria 1666
144 Ga0207676_10763607 3300026095 Bacteria 941
145 Ga0207683_10352410 3300026121 Bacteria 1351
146 Ga0207698_11076797 3300026142 Bacteria 816
147 Ga0268266_10024637 3300028379 Bacteria 5119
148 Ga0268266_10237124 3300028379 Bacteria 1682
149 Ga0268265_10295450 3300028380 Bacteria 1456
150 Ga0268264_10224541 3300028381 Bacteria 1731
151 Ga0307512_10161765 3300030522 Bacteria 1309
152 Ga0307513_10595564 3300031456 Bacteria 815
153 Ga0307509_10946843 3300031507 Bacteria 527
154 Ga0307410_10314879 3300031852 Bacteria 1240
155 Ga0307406_10356543 3300031901 Bacteria 1145
156 Ga0307412_10087208 3300031911 Bacteria 2174
157 Ga0373945_0100311 3300035116 Bacteria 1132
158 Ga0373953_0050503 3300035117 Bacteria 1680
159 Ga0373937_0254478 3300036401 Bacteria 1655
160 Ga0395900_0008620 3300037418 Bacteria 10479
161 Ga0395898_0000647 3300037466 Bacteria 63277
162 Ga0395898_0522909 3300037466 Bacteria 1128
163 Ga0436364_0731954 3300037853 Bacteria 4898
164 Ga0395901_1253947 3300038443 Bacteria 705
165 Ga0395901_1969190 3300038443 Bacteria 531
166 Ga0436365_1351461 3300039437 Bacteria 8491
167 Ga0436365_1506893 3300039437 Bacteria 5076
168 Ga0436363_0765989 3300039450 Bacteria 877
169 Ga0436363_1507012 3300039450 Bacteria 666
170 Ga0436362_0933277 3300039453 Bacteria 2146
171 Ga0451793_0001389 3300041452 Bacteria 599
172 Ga0451795_0996762 3300041456 Bacteria 822
173 Ga0451807_2148320 3300041486 Bacteria 610
174 Ga0451833_0459305 3300041491 Bacteria 639
175 Ga0451845_0400608 3300041501 Unclassified 901
176 Ga0451853_1004110 3300041512 Bacteria 596
177 Ga0466969_0090781 3300044656 Bacteria 1448
178 Ga0466972_0019964 3300044658 Bacteria 3349
179 Ga0466972_0022464 3300044658 Bacteria 3142
180 Ga0466972_0067223 3300044658 Bacteria 1712
181 Ga0466972_0094867 3300044658 Bacteria 1413
182 Ga0466965_0000004 3300044683 Bacteria 229348
183 Ga0466965_0011049 3300044683 Bacteria 4223
184 Ga0466965_0040001 3300044683 Bacteria 2306
185 Ga0466965_0229280 3300044683 Bacteria 992
186 Ga0466966_0021035 3300044684 Bacteria 4286
187 Ga0466966_0565325 3300044684 Bacteria 684
188 Ga0466961_0114438 3300044693 Bacteria 1695
189 Ga0466961_0138284 3300044693 Bacteria 1526
190 Ga0466961_0712220 3300044693 Bacteria 601
191 Ga0466963_0048720 3300044694 Bacteria 2801
192 Ga0466971_0391349 3300044719 Bacteria 676
193 Ga0466970_0035825 3300044765 Bacteria 2628
194 Ga0466970_0110147 3300044765 Bacteria 1503
195 Ga0466970_0174865 3300044765 Bacteria 1190
196 Ga0466970_0225869 3300044765 Bacteria 1045
197 Ga0466970_0351126 3300044765 Bacteria 837
198 Ga0466957_0071718 3300044842 Bacteria 2143
199 Ga0466957_0149745 3300044842 Bacteria 1508
200 Ga0466960_0072781 3300044901 Bacteria 1714
201 Ga0466960_0268028 3300044901 Bacteria 953
202 Ga0466959_0153508 3300045049 Bacteria 1621
203 Ga0466959_0441504 3300045049 Bacteria 883
204 Ga0466958_0021284 3300045836 Bacteria 3788
205 Ga0466958_0113204 3300045836 Bacteria 1695
206 Ga0466967_0366711 3300045976 Bacteria 1396
207 Ga0466967_0693918 3300045976 Bacteria 1008
208 Ga0495638_0006151 3300046460 Bacteria 8774
209 Ga0495616_0199970 3300046513 Bacteria 879
210 Ga0495616_0246875 3300046513 Bacteria 768
211 Ga0495620_0138751 3300046515 Bacteria 951
212 Ga0495643_0409772 3300046522 Bacteria 596
213 Ga0495652_0599067 3300046529 Bacteria 752
214 Ga0495611_0541519 3300046648 Bacteria 527
215 Ga0495625_0060204 3300046660 Bacteria 2691
216 Ga0495671_0625086 3300046692 Bacteria 512
217 Ga0495672_0303486 3300047320 Bacteria 755
218 Ga0495676_0534019 3300047321 Bacteria 768
219 Ga0495680_0562150 3300047322 Bacteria 767
220 Ga0495686_0169315 3300047472 Bacteria 1271
221 Ga0495615_0233445 3300048090 Bacteria 578
222 Ga0495626_0197666 3300048091 Bacteria 826
223 Ga0496100_0000526 3300048903 Bacteria 18270
224 Ga0496100_0306039 3300048903 Bacteria 1190
225 Ga0496101_0000672 3300048904 Bacteria 20605
226 Ga0496101_0012413 3300048904 Bacteria 5685
227 Ga0496102_0348863 3300048905 Bacteria 1393
228 Ga0496102_1639067 3300048905 Bacteria 561
229 Ga0496104_0002882 3300048907 Bacteria 14826
230 Ga0496104_0185103 3300048907 Bacteria 1993
231 Ga0496104_0277322 3300048907 Bacteria 1589
232 Ga0496105_0005703 3300048908 Bacteria 9478
233 Ga0496105_0129006 3300048908 Bacteria 2085
234 Ga0496105_0146142 3300048908 Bacteria 1944
235 Ga0496105_0332981 3300048908 Bacteria 1215
236 Ga0496106_0002583 3300048909 Bacteria 13477
237 Ga0496107_0014817 3300048910 Bacteria 5458
238 Ga0496107_0115926 3300048910 Bacteria 1972
239 Ga0496108_0040954 3300048911 Bacteria 3865
240 Ga0496109_0050762 3300048912 Bacteria 3777
241 Ga0496109_1520606 3300048912 Bacteria 604
242 Ga0496110_0135640 3300048913 Bacteria 2224
243 Ga0496110_0903805 3300048913 Bacteria 789
244 Ga0496113_0332432 3300048916 Bacteria 1218
245 Ga0496114_0000472 3300048917 Bacteria 29452
246 Ga0496114_0178532 3300048917 Bacteria 1853
247 Ga0496114_0263973 3300048917 Bacteria 1516
248 Ga0496115_0024538 3300048918 Bacteria 4688
249 Ga0496115_0356914 3300048918 Bacteria 1191
250 Ga0496115_0723684 3300048918 Bacteria 780
251 Ga0496116_0063537 3300048919 Bacteria 2378
252 Ga0496117_0000226 3300048920 Bacteria 106213
253 Ga0496117_0005837 3300048920 Bacteria 12748
254 Ga0496117_0008854 3300048920 Bacteria 9499
255 Ga0496117_0491130 3300048920 Bacteria 597
256 Ga0496118_0006679 3300048921 Bacteria 12584
257 Ga0496118_0145680 3300048921 Bacteria 1492
258 Ga0496119_0001137 3300048922 Bacteria 33415
259 Ga0496119_0098089 3300048922 Bacteria 1650
260 Ga0496120_0066019 3300048923 Bacteria 2002
261 Ga0496121_0156276 3300048924 Bacteria 1673
262 Ga0496122_0084198 3300048925 Bacteria 2201
263 Ga0496123_0338676 3300048926 Bacteria 704
264 Ga0496126_0179947 3300048929 Bacteria 1796
265 Ga0496126_0296673 3300048929 Bacteria 1335
266 Ga0501031_0014742 3300049568 Bacteria 5080
267 Ga0501032_0023986 3300049569 Bacteria 4214
268 Ga0501032_0027840 3300049569 Bacteria 3884
269 Ga0501032_0078119 3300049569 Bacteria 2203
270 Ga0501033_0002021 3300049570 Bacteria 17651
271 Ga0501033_0003080 3300049570 Bacteria 13858
272 Ga0501033_0065490 3300049570 Bacteria 2673
273 Ga0501033_0141889 3300049570 Bacteria 1736
274 Ga0501033_0283732 3300049570 Bacteria 1168
275 Ga0501033_0774935 3300049570 Bacteria 649
276 Ga0501034_0012462 3300049571 Bacteria 8781
277 Ga0501034_0057521 3300049571 Bacteria 3909
278 Ga0501034_0086010 3300049571 Bacteria 3145
279 Ga0501034_0097345 3300049571 Bacteria 2938
280 Ga0501034_0233939 3300049571 Bacteria 1785
281 Ga0501034_0574871 3300049571 Bacteria 1034
282 Ga0501036_0025837 3300049572 Bacteria 4956
283 Ga0501036_0343188 3300049572 Bacteria 1247
284 Ga0501037_0007998 3300049573 Bacteria 7748
285 Ga0501037_0305354 3300049573 Bacteria 1104
286 Ga0501037_0306630 3300049573 Bacteria 1101
287 Ga0501037_0564743 3300049573 Bacteria 767
288 Ga0501038_0031837 3300049574 Bacteria 4658
289 Ga0501039_0040418 3300049575 Bacteria 3601
290 Ga0501039_0069179 3300049575 Bacteria 2741
291 Ga0501042_0048613 3300049578 Bacteria 3025
292 Ga0501043_0006047 3300049579 Bacteria 9726
293 Ga0501043_0047087 3300049579 Bacteria 3390
294 Ga0501043_0104751 3300049579 Bacteria 2223
295 Ga0501043_0316393 3300049579 Bacteria 1191
296 Ga0501046_0003511 3300049580 Bacteria 14366
297 Ga0501046_0122435 3300049580 Bacteria 1978
298 Ga0501046_0130622 3300049580 Bacteria 1905
299 Ga0501047_0013481 3300049581 Bacteria 7748
300 Ga0501047_0036822 3300049581 Bacteria 4729
301 Ga0501047_0057260 3300049581 Bacteria 3769
302 Ga0501047_0246197 3300049581 Bacteria 1637
303 Ga0501048_0011201 3300049582 Bacteria 6685
304 Ga0501067_0176343 3300049583 Bacteria 1190
305 Ga0501068_0064510 3300049584 Bacteria 2229
306 Ga0501069_0122152 3300049585 Bacteria 1488
307 Ga0501070_0003347 3300049586 Bacteria 13919
308 Ga0501070_0014108 3300049586 Bacteria 6726
309 Ga0501070_0017777 3300049586 Bacteria 5971
310 Ga0501073_0039815 3300049589 Bacteria 3329
311 Ga0501076_0908654 3300049592 Bacteria 726
312 Ga0501079_1639573 3300049741 Bacteria 506
313 Ga0501080_1664755 3300049742 Bacteria 539
314 Ga0501083_0088177 3300049744 Bacteria 2051
315 Ga0501035_0005198 3300049822 Bacteria 12315
316 Ga0501035_0016105 3300049822 Bacteria 6899
317 Ga0501035_0073443 3300049822 Bacteria 3026
318 Ga0501035_0538554 3300049822 Bacteria 957
319 Ga0501044_0006227 3300049823 Bacteria 13188
320 Ga0501044_0034005 3300049823 Bacteria 5350
321 Ga0501044_0060318 3300049823 Bacteria 3884
322 nmdc:mga00v17_25187_c1 3300050491 Bacteria 3456
323 nmdc:mga0yw44_134994_c1 3300050492 Bacteria 1600
324 nmdc:mga07m45_86189_c1 3300050496 Bacteria 1796
325 nmdc:mga08y16_2053250_c1 3300050511 Bacteria 520
326 nmdc:mga08x19_993282_c1 3300050514 Bacteria 596
327 nmdc:mga0sz30_286208_c1 3300050516 Bacteria 734
328 Ga0500644_0094333 3300053088 Bacteria 1126
329 Ga0500646_0006287 3300053090 Bacteria 3019
330 Ga0500562_004677 3300053108 Bacteria 3451
331 Ga0500568_0263577 3300053139 Bacteria 627
332 Ga0501082_0125538 3300060353 Bacteria 2226
333 Ga0501082_0386912 3300060353 Bacteria 1220
334 Ga0466962_0032340 3300061719 Bacteria 2504

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_11086102 Ga0105243_110861022 105
2 3300001989 JGI24739J22299_10087095 JGI24739J22299_100870953 106
3 3300001990 JGI24737J22298_10225385 JGI24737J22298_102253851 106
4 3300002067 JGI24735J21928_10187904 JGI24735J21928_101879041 106
5 3300005335 Ga0070666_10949577 Ga0070666_109495771 106
6 3300005337 Ga0070682_100106894 Ga0070682_1001068943 106
7 3300005339 Ga0070660_100436733 Ga0070660_1004367332 106
8 3300005367 Ga0070667_100911269 Ga0070667_1009112691 106
9 3300005455 Ga0070663_100118851 Ga0070663_1001188513 106
10 3300005841 Ga0068863_100434606 Ga0068863_1004346063 106
11 3300006358 Ga0068871_102077679 Ga0068871_1020776792 106
12 3300009101 Ga0105247_10403063 Ga0105247_104030632 106
13 3300009551 Ga0105238_10553728 Ga0105238_105537283 106
14 3300010375 Ga0105239_11641132 Ga0105239_116411322 106
15 3300013307 Ga0157372_10172464 Ga0157372_101724644 106
16 3300025900 Ga0207710_10598151 Ga0207710_105981512 106
17 3300025919 Ga0207657_10457280 Ga0207657_104572803 106
18 3300025924 Ga0207694_10987611 Ga0207694_109876112 106
19 3300025986 Ga0207658_10508665 Ga0207658_105086652 106
20 3300026067 Ga0207678_10458212 Ga0207678_104582121 106
21 3300026121 Ga0207683_10352410 Ga0207683_103524103 106
22 3300002773 JGI25152J39213_1000109 JGI25152J39213_100010922 107
23 3300005937 Ga0081455_10035070 Ga0081455_100350706 107
24 3300009094 Ga0111539_13286804 Ga0111539_132868042 107
25 3300021384 Ga0213876_10036054 Ga0213876_100360545 107
26 3300025245 Ga0207425_1007710 Ga0207425_10077102 107
27 3300025258 Ga0209129_1000180 Ga0209129_100018036 107
28 3300025294 Ga0209025_1001362 Ga0209025_100136210 107
29 3300030522 Ga0307512_10161765 Ga0307512_101617652 107
30 3300031507 Ga0307509_10946843 Ga0307509_109468431 107
31 3300039437 Ga0436365_1351461 Ga0436365_1351461_4940_5434 107
32 3300046648 Ga0495611_0541519 Ga0495611_0541519_34_366 107
33 3300050511 nmdc:mga08y16_2053250_c1 nmdc:mga08y16_2053250_c1_97_429 107
34 3300005843 Ga0068860_101795099 Ga0068860_1017950991 109
35 3300009036 Ga0105244_10438023 Ga0105244_104380231 109
36 3300021384 Ga0213876_10068723 Ga0213876_100687232 109
37 3300025928 Ga0207700_11994692 Ga0207700_119946921 109
38 3300031456 Ga0307513_10595564 Ga0307513_105955641 109
39 3300037466 Ga0395898_0522909 Ga0395898_0522909_721_1059 109
40 3300037853 Ga0436364_0731954 Ga0436364_0731954_3182_3532 109
41 3300038443 Ga0395901_1253947 Ga0395901_1253947_250_588 109
42 3300039437 Ga0436365_1506893 Ga0436365_1506893_3487_3837 109
43 3300039450 Ga0436363_0765989 Ga0436363_0765989_265_615 109
44 3300039453 Ga0436362_0933277 Ga0436362_0933277_1211_1561 109
45 3300044684 Ga0466966_0565325 Ga0466966_0565325_275_619 109
46 3300044693 Ga0466961_0138284 Ga0466961_0138284_263_607 109
47 3300044765 Ga0466970_0110147 Ga0466970_0110147_1124_1468 109
48 3300045049 Ga0466959_0441504 Ga0466959_0441504_71_415 109
49 3300046529 Ga0495652_0599067 Ga0495652_0599067_309_647 109
50 3300047321 Ga0495676_0534019 Ga0495676_0534019_66_404 109
51 3300044658 Ga0466972_0094867 Ga0466972_0094867_139_471 110
52 3300044683 Ga0466965_0011049 Ga0466965_0011049_1471_1803 110
53 3300044694 Ga0466963_0048720 Ga0466963_0048720_10_351 110
54 3300044842 Ga0466957_0149745 Ga0466957_0149745_827_1159 110
55 3300044901 Ga0466960_0268028 Ga0466960_0268028_370_702 110
56 3300045836 Ga0466958_0113204 Ga0466958_0113204_348_680 110
57 3300045976 Ga0466967_0366711 Ga0466967_0366711_10_351 110
58 3300049569 Ga0501032_0023986 Ga0501032_0023986_3173_3514 110
59 3300049570 Ga0501033_0774935 Ga0501033_0774935_51_392 110
60 3300049571 Ga0501034_0086010 Ga0501034_0086010_525_866 110
61 3300049573 Ga0501037_0306630 Ga0501037_0306630_291_632 110
62 3300049574 Ga0501038_0031837 Ga0501038_0031837_4026_4367 110
63 3300049579 Ga0501043_0316393 Ga0501043_0316393_183_524 110
64 3300049580 Ga0501046_0122435 Ga0501046_0122435_311_652 110
65 3300049581 Ga0501047_0057260 Ga0501047_0057260_173_514 110
66 3300049583 Ga0501067_0176343 Ga0501067_0176343_457_798 110
67 3300049592 Ga0501076_0908654 Ga0501076_0908654_215_556 110
68 3300049741 Ga0501079_1639573 Ga0501079_1639573_32_373 110
69 3300049744 Ga0501083_0088177 Ga0501083_0088177_167_508 110
70 3300049822 Ga0501035_0538554 Ga0501035_0538554_402_743 110
71 3300049823 Ga0501044_0060318 Ga0501044_0060318_3087_3428 110
72 3300060353 Ga0501082_0386912 Ga0501082_0386912_198_539 110
73 3300005355 Ga0070671_101902784 Ga0070671_1019027841 111
74 3300005367 Ga0070667_100027767 Ga0070667_1000277677 111
75 3300005437 Ga0070710_10809980 Ga0070710_108099801 111
76 3300005544 Ga0070686_101103294 Ga0070686_1011032941 111
77 3300005617 Ga0068859_100869665 Ga0068859_1008696652 111
78 3300005841 Ga0068863_100259127 Ga0068863_1002591274 111
79 3300005842 Ga0068858_100116428 Ga0068858_1001164281 111
80 3300005843 Ga0068860_100249777 Ga0068860_1002497772 111
81 3300005844 Ga0068862_100130059 Ga0068862_1001300593 111
82 3300006028 Ga0070717_10182779 Ga0070717_101827792 111
83 3300006931 Ga0097620_100869658 Ga0097620_1008696582 111
84 3300009098 Ga0105245_11317511 Ga0105245_113175111 111
85 3300009177 Ga0105248_10019473 Ga0105248_100194733 111
86 3300013297 Ga0157378_10286235 Ga0157378_102862352 111
87 3300013297 Ga0157378_12919352 Ga0157378_129193521 111
88 3300013307 Ga0157372_12744693 Ga0157372_127446931 111
89 3300013308 Ga0157375_10410477 Ga0157375_104104772 111
90 3300013308 Ga0157375_10806722 Ga0157375_108067221 111
91 3300014325 Ga0163163_10493097 Ga0163163_104930972 111
92 3300014325 Ga0163163_10879199 Ga0163163_108791992 111
93 3300014326 Ga0157380_12212421 Ga0157380_122124211 111
94 3300014968 Ga0157379_10400783 Ga0157379_104007833 111
95 3300014969 Ga0157376_11315174 Ga0157376_113151741 111
96 3300025942 Ga0207689_10685381 Ga0207689_106853812 111
97 3300025972 Ga0207668_10050482 Ga0207668_100504822 111
98 3300025986 Ga0207658_10231582 Ga0207658_102315822 111
99 3300026023 Ga0207677_10337473 Ga0207677_103374732 111
100 3300026035 Ga0207703_10367989 Ga0207703_103679891 111
101 3300026088 Ga0207641_10194952 Ga0207641_101949522 111
102 3300028380 Ga0268265_10295450 Ga0268265_102954503 111
103 3300028381 Ga0268264_10224541 Ga0268264_102245413 111
104 3300035116 Ga0373945_0100311 Ga0373945_0100311_594_941 111
105 3300035117 Ga0373953_0050503 Ga0373953_0050503_1125_1472 111
106 3300036401 Ga0373937_0254478 Ga0373937_0254478_441_788 111
107 3300039450 Ga0436363_1507012 Ga0436363_1507012_64_594 111
108 3300046460 Ga0495638_0006151 Ga0495638_0006151_6148_6486 111
109 3300046513 Ga0495616_0246875 Ga0495616_0246875_239_577 111
110 3300046660 Ga0495625_0060204 Ga0495625_0060204_420_758 111
111 3300047320 Ga0495672_0303486 Ga0495672_0303486_378_716 111
112 3300047322 Ga0495680_0562150 Ga0495680_0562150_272_619 111
113 3300048091 Ga0495626_0197666 Ga0495626_0197666_77_415 111
114 3300048903 Ga0496100_0000526 Ga0496100_0000526_2201_2539 111
115 3300048904 Ga0496101_0000672 Ga0496101_0000672_11739_12077 111
116 3300048907 Ga0496104_0002882 Ga0496104_0002882_2413_2751 111
117 3300048908 Ga0496105_0005703 Ga0496105_0005703_5119_5457 111
118 3300048909 Ga0496106_0002583 Ga0496106_0002583_9935_10273 111
119 3300048910 Ga0496107_0014817 Ga0496107_0014817_353_691 111
120 3300048912 Ga0496109_1520606 Ga0496109_1520606_171_509 111
121 3300048917 Ga0496114_0000472 Ga0496114_0000472_4131_4469 111
122 3300048918 Ga0496115_0024538 Ga0496115_0024538_2799_3137 111
123 3300048920 Ga0496117_0000226 Ga0496117_0000226_59837_60181 111
124 3300049822 Ga0501035_0016105 Ga0501035_0016105_922_1317 111
125 3300050514 nmdc:mga08x19_993282_c1 nmdc:mga08x19_993282_c1_48_395 111
126 3300053088 Ga0500644_0094333 Ga0500644_0094333_87_425 111
127 3300053108 Ga0500562_004677 Ga0500562_004677_1344_1682 111
128 3300053139 Ga0500568_0263577 Ga0500568_0263577_132_470 111
129 3300060353 Ga0501082_0125538 Ga0501082_0125538_852_1217 111
130 iso_pu_bacteria 2919523602 2919527151 111
131 iso_pu_bacteria 8003830390 8003832760 111
132 3300005347 Ga0070668_100152827 Ga0070668_1001528272 112
133 3300005548 Ga0070665_101811081 Ga0070665_1018110811 112
134 3300013250 Ga0171462_1005 Ga0171462_100581 112
135 3300044658 Ga0466972_0022464 Ga0466972_0022464_2384_2728 112
136 3300044842 Ga0466957_0071718 Ga0466957_0071718_1342_1689 112
137 3300049569 Ga0501032_0078119 Ga0501032_0078119_644_997 112
138 3300049570 Ga0501033_0283732 Ga0501033_0283732_318_671 112
139 3300049575 Ga0501039_0069179 Ga0501039_0069179_2034_2387 112
140 3300049584 Ga0501068_0064510 Ga0501068_0064510_1015_1368 112
141 3300049586 Ga0501070_0014108 Ga0501070_0014108_196_549 112
142 3300005367 Ga0070667_100052291 Ga0070667_1000522916 113
143 3300005618 Ga0068864_102014071 Ga0068864_1020140712 113
144 3300005841 Ga0068863_100618891 Ga0068863_1006188912 113
145 3300009553 Ga0105249_10008536 Ga0105249_100085367 113
146 3300013296 Ga0157374_11325618 Ga0157374_113256182 113
147 3300041452 Ga0451793_0001389 Ga0451793_0001389_66_422 113
148 3300048922 Ga0496119_0001137 Ga0496119_0001137_28288_28629 113
149 3300005548 Ga0070665_100023366 Ga0070665_1000233663 114
150 3300006048 Ga0075363_100220422 Ga0075363_1002204223 114
151 3300009177 Ga0105248_11965897 Ga0105248_119658971 114
152 3300028379 Ga0268266_10024637 Ga0268266_100246373 114
153 3300041456 Ga0451795_0996762 Ga0451795_0996762_366_728 114
154 3300041512 Ga0451853_1004110 Ga0451853_1004110_35_388 114
155 3300046692 Ga0495671_0625086 Ga0495671_0625086_26_385 114
156 3300048913 Ga0496110_0903805 Ga0496110_0903805_149_511 114
157 3300049571 Ga0501034_0574871 Ga0501034_0574871_425_781 114
158 3300050491 nmdc:mga00v17_25187_c1 nmdc:mga00v17_25187_c1_2563_2922 114
159 3300050492 nmdc:mga0yw44_134994_c1 nmdc:mga0yw44_134994_c1_840_1199 114
160 3300050496 nmdc:mga07m45_86189_c1 nmdc:mga07m45_86189_c1_961_1323 114
161 3300053090 Ga0500646_0006287 Ga0500646_0006287_377_739 114
162 iso_pu_bacteria 2919055335 2919057094 114
163 iso_pu_bacteria 2928153084 2928154866 114
164 3300005347 Ga0070668_100184947 Ga0070668_1001849472 115
165 3300005356 Ga0070674_101247891 Ga0070674_1012478912 115
166 3300005543 Ga0070672_100186931 Ga0070672_1001869313 115
167 3300005548 Ga0070665_100123356 Ga0070665_1001233564 115
168 3300025272 Ga0209455_1000654 Ga0209455_100065412 115
169 3300025940 Ga0207691_10330485 Ga0207691_103304852 115
170 3300025972 Ga0207668_10116521 Ga0207668_101165213 115
171 3300028379 Ga0268266_10237124 Ga0268266_102371241 115
172 3300041491 Ga0451833_0459305 Ga0451833_0459305_44_397 115
173 3300046513 Ga0495616_0199970 Ga0495616_0199970_398_766 115
174 3300046522 Ga0495643_0409772 Ga0495643_0409772_132_500 115
175 3300048090 Ga0495615_0233445 Ga0495615_0233445_96_464 115
176 iso_pu_bacteria 2643221566 2643847939 115
177 iso_pu_bacteria 2833709550 2833710047 115
178 3300003758 Ga0055532_1009858 Ga0055532_10098582 116
179 3300003760 Ga0055527_1000003 Ga0055527_1000003530 116
180 3300003762 Ga0055542_1000005 Ga0055542_1000005394 116
181 3300003763 Ga0055529_1000046 Ga0055529_100004653 116
182 3300025228 Ga0209672_100003 Ga0209672_1000031368 116
183 3300025229 Ga0209147_100372 Ga0209147_10037224 116
184 3300025242 Ga0209258_102281 Ga0209258_1022815 116
185 3300025254 Ga0209148_1000004 Ga0209148_10000041663 116
186 3300025272 Ga0209455_1000080 Ga0209455_1000080119 116
187 3300031911 Ga0307412_10087208 Ga0307412_100872083 116
188 3300038443 Ga0395901_1969190 Ga0395901_1969190_34_402 116
189 3300041486 Ga0451807_2148320 Ga0451807_2148320_25_390 116
190 3300046515 Ga0495620_0138751 Ga0495620_0138751_65_436 116
191 3300047472 Ga0495686_0169315 Ga0495686_0169315_885_1241 116
192 iso_pu_bacteria 2844841374 2844841450 116
193 iso_pu_bacteria 8056037122 8056037351 116
194 3300003752 Ga0055539_1000103 Ga0055539_10001037 117
195 3300003756 Ga0055533_1000020 Ga0055533_1000020253 117
196 3300003759 Ga0055525_1000312 Ga0055525_10003128 117
197 3300003841 Ga0055541_1013899 Ga0055541_10138992 117
198 3300005289 Ga0065704_10366310 Ga0065704_103663102 117
199 3300005347 Ga0070668_100036544 Ga0070668_1000365444 117
200 3300005355 Ga0070671_100286206 Ga0070671_1002862061 117
201 3300005356 Ga0070674_100043553 Ga0070674_1000435531 117
202 3300005367 Ga0070667_100174265 Ga0070667_1001742653 117
203 3300005439 Ga0070711_100191205 Ga0070711_1001912052 117
204 3300005466 Ga0070685_10139992 Ga0070685_101399922 117
205 3300005539 Ga0068853_100591692 Ga0068853_1005916922 117
206 3300005544 Ga0070686_100744595 Ga0070686_1007445952 117
207 3300005616 Ga0068852_100564900 Ga0068852_1005649002 117
208 3300005618 Ga0068864_100853774 Ga0068864_1008537741 117
209 3300005718 Ga0068866_10077627 Ga0068866_100776273 117
210 3300005841 Ga0068863_100602905 Ga0068863_1006029052 117
211 3300005843 Ga0068860_102049958 Ga0068860_1020499582 117
212 3300006051 Ga0075364_10686494 Ga0075364_106864942 117
213 3300006175 Ga0070712_101494712 Ga0070712_1014947121 117
214 3300006237 Ga0097621_100251260 Ga0097621_1002512602 117
215 3300013307 Ga0157372_10445782 Ga0157372_104457821 117
216 3300013308 Ga0157375_10818895 Ga0157375_108188952 117
217 3300014968 Ga0157379_12003661 Ga0157379_120036611 117
218 3300025225 Ga0209566_100043 Ga0209566_100043164 117
219 3300025226 Ga0209674_100001 Ga0209674_1000013646 117
220 3300025230 Ga0209563_100001 Ga0209563_1000013646 117
221 3300025253 Ga0209677_100001 Ga0209677_1000013646 117
222 3300025899 Ga0207642_10125597 Ga0207642_101255973 117
223 3300025904 Ga0207647_10038455 Ga0207647_100384554 117
224 3300025916 Ga0207663_11201837 Ga0207663_112018371 117
225 3300025931 Ga0207644_10891629 Ga0207644_108916292 117
226 3300025937 Ga0207669_10309337 Ga0207669_103093372 117
227 3300025941 Ga0207711_10069718 Ga0207711_100697183 117
228 3300025972 Ga0207668_10002408 Ga0207668_1000240811 117
229 3300025986 Ga0207658_10182722 Ga0207658_101827222 117
230 3300026035 Ga0207703_11817405 Ga0207703_118174051 117
231 3300026088 Ga0207641_10246706 Ga0207641_102467062 117
232 3300026095 Ga0207676_10763607 Ga0207676_107636072 117
233 3300026142 Ga0207698_11076797 Ga0207698_110767971 117
234 3300031852 Ga0307410_10314879 Ga0307410_103148792 117
235 3300037418 Ga0395900_0008620 Ga0395900_0008620_4501_4863 117
236 3300037466 Ga0395898_0000647 Ga0395898_0000647_5617_5979 117
237 3300048903 Ga0496100_0306039 Ga0496100_0306039_151_516 117
238 3300048904 Ga0496101_0012413 Ga0496101_0012413_1384_1749 117
239 3300048905 Ga0496102_0348863 Ga0496102_0348863_250_615 117
240 3300048907 Ga0496104_0277322 Ga0496104_0277322_1180_1545 117
241 3300048908 Ga0496105_0129006 Ga0496105_0129006_974_1339 117
242 3300048910 Ga0496107_0115926 Ga0496107_0115926_593_958 117
243 3300048917 Ga0496114_0263973 Ga0496114_0263973_605_970 117
244 3300048918 Ga0496115_0356914 Ga0496115_0356914_615_980 117
245 3300048921 Ga0496118_0145680 Ga0496118_0145680_467_832 117
246 3300048922 Ga0496119_0098089 Ga0496119_0098089_355_720 117
247 3300048923 Ga0496120_0066019 Ga0496120_0066019_577_942 117
248 3300048924 Ga0496121_0156276 Ga0496121_0156276_44_409 117
249 3300048929 Ga0496126_0179947 Ga0496126_0179947_1123_1488 117
250 3300049570 Ga0501033_0141889 Ga0501033_0141889_448_804 117
251 3300049571 Ga0501034_0097345 Ga0501034_0097345_1474_1830 117
252 3300049573 Ga0501037_0305354 Ga0501037_0305354_379_735 117
253 3300049580 Ga0501046_0130622 Ga0501046_0130622_606_962 117
254 3300049581 Ga0501047_0036822 Ga0501047_0036822_142_498 117
255 3300049586 Ga0501070_0003347 Ga0501070_0003347_8070_8435 117
256 3300049823 Ga0501044_0034005 Ga0501044_0034005_2721_3077 117
257 3300050516 nmdc:mga0sz30_286208_c1 nmdc:mga0sz30_286208_c1_91_459 117
258 3300001979 JGI24740J21852_10008848 JGI24740J21852_100088484 118
259 3300001989 JGI24739J22299_10025474 JGI24739J22299_100254742 118
260 3300001990 JGI24737J22298_10002795 JGI24737J22298_100027953 118
261 3300002067 JGI24735J21928_10000460 JGI24735J21928_100004607 118
262 3300003578 Ga0006562J51391_1003466 Ga0006562J51391_10034663 118
263 3300003578 Ga0006562J51391_1003468 Ga0006562J51391_100346810 118
264 3300003759 Ga0055525_1008338 Ga0055525_10083382 118
265 3300005455 Ga0070663_101402423 Ga0070663_1014024232 118
266 3300013105 Ga0157369_11522154 Ga0157369_115221542 118
267 3300013296 Ga0157374_10641082 Ga0157374_106410822 118
268 3300013308 Ga0157375_10320983 Ga0157375_103209833 118
269 3300013308 Ga0157375_11343715 Ga0157375_113437151 118
270 3300017792 Ga0163161_10487853 Ga0163161_104878532 118
271 3300025230 Ga0209563_100183 Ga0209563_1001838 118
272 3300025258 Ga0209129_1033690 Ga0209129_10336901 118
273 3300025904 Ga0207647_10025877 Ga0207647_100258774 118
274 3300026067 Ga0207678_10634877 Ga0207678_106348772 118
275 3300026075 Ga0207708_10392898 Ga0207708_103928983 118
276 3300031901 Ga0307406_10356543 Ga0307406_103565432 118
277 3300041501 Ga0451845_0400608 Ga0451845_0400608_132_521 118
278 3300044656 Ga0466969_0090781 Ga0466969_0090781_369_749 118
279 3300044658 Ga0466972_0019964 Ga0466972_0019964_2330_2689 118
280 3300044658 Ga0466972_0067223 Ga0466972_0067223_1146_1526 118
281 3300044683 Ga0466965_0000004 Ga0466965_0000004_14278_14646 118
282 3300044683 Ga0466965_0040001 Ga0466965_0040001_1470_1850 118
283 3300044683 Ga0466965_0229280 Ga0466965_0229280_212_622 118
284 3300044684 Ga0466966_0021035 Ga0466966_0021035_2146_2526 118
285 3300044693 Ga0466961_0114438 Ga0466961_0114438_1295_1675 118
286 3300044693 Ga0466961_0712220 Ga0466961_0712220_181_540 118
287 3300044719 Ga0466971_0391349 Ga0466971_0391349_49_429 118
288 3300044765 Ga0466970_0035825 Ga0466970_0035825_189_545 118
289 3300044765 Ga0466970_0174865 Ga0466970_0174865_272_631 118
290 3300044765 Ga0466970_0225869 Ga0466970_0225869_181_561 118
291 3300044765 Ga0466970_0351126 Ga0466970_0351126_197_574 118
292 3300044901 Ga0466960_0072781 Ga0466960_0072781_1141_1497 118
293 3300045049 Ga0466959_0153508 Ga0466959_0153508_401_760 118
294 3300045836 Ga0466958_0021284 Ga0466958_0021284_3381_3761 118
295 3300045976 Ga0466967_0693918 Ga0466967_0693918_118_498 118
296 3300048905 Ga0496102_1639067 Ga0496102_1639067_136_516 118
297 3300048907 Ga0496104_0185103 Ga0496104_0185103_602_1000 118
298 3300048908 Ga0496105_0146142 Ga0496105_0146142_1115_1513 118
299 3300048908 Ga0496105_0332981 Ga0496105_0332981_348_746 118
300 3300048911 Ga0496108_0040954 Ga0496108_0040954_1750_2148 118
301 3300048912 Ga0496109_0050762 Ga0496109_0050762_2434_2832 118
302 3300048913 Ga0496110_0135640 Ga0496110_0135640_1115_1513 118
303 3300048916 Ga0496113_0332432 Ga0496113_0332432_655_1053 118
304 3300048917 Ga0496114_0178532 Ga0496114_0178532_622_1020 118
305 3300048918 Ga0496115_0723684 Ga0496115_0723684_149_547 118
306 3300048919 Ga0496116_0063537 Ga0496116_0063537_1775_2155 118
307 3300048920 Ga0496117_0005837 Ga0496117_0005837_9047_9403 118
308 3300048920 Ga0496117_0008854 Ga0496117_0008854_6768_7148 118
309 3300048920 Ga0496117_0491130 Ga0496117_0491130_65_421 118
310 3300048921 Ga0496118_0006679 Ga0496118_0006679_634_1014 118
311 3300048925 Ga0496122_0084198 Ga0496122_0084198_1340_1696 118
312 3300048926 Ga0496123_0338676 Ga0496123_0338676_88_444 118
313 3300048929 Ga0496126_0296673 Ga0496126_0296673_865_1221 118
314 3300049568 Ga0501031_0014742 Ga0501031_0014742_4667_5038 118
315 3300049569 Ga0501032_0027840 Ga0501032_0027840_3050_3421 118
316 3300049570 Ga0501033_0002021 Ga0501033_0002021_10659_11030 118
317 3300049570 Ga0501033_0003080 Ga0501033_0003080_2070_2441 118
318 3300049570 Ga0501033_0065490 Ga0501033_0065490_37_393 118
319 3300049571 Ga0501034_0012462 Ga0501034_0012462_2825_3196 118
320 3300049571 Ga0501034_0057521 Ga0501034_0057521_185_541 118
321 3300049571 Ga0501034_0233939 Ga0501034_0233939_1245_1601 118
322 3300049572 Ga0501036_0025837 Ga0501036_0025837_1789_2160 118
323 3300049572 Ga0501036_0343188 Ga0501036_0343188_546_902 118
324 3300049573 Ga0501037_0007998 Ga0501037_0007998_1792_2163 118
325 3300049573 Ga0501037_0564743 Ga0501037_0564743_18_389 118
326 3300049575 Ga0501039_0040418 Ga0501039_0040418_2278_2634 118
327 3300049578 Ga0501042_0048613 Ga0501042_0048613_2107_2478 118
328 3300049579 Ga0501043_0006047 Ga0501043_0006047_3201_3572 118
329 3300049579 Ga0501043_0047087 Ga0501043_0047087_533_901 118
330 3300049579 Ga0501043_0104751 Ga0501043_0104751_1431_1787 118
331 3300049580 Ga0501046_0003511 Ga0501046_0003511_216_587 118
332 3300049581 Ga0501047_0013481 Ga0501047_0013481_1792_2163 118
333 3300049581 Ga0501047_0246197 Ga0501047_0246197_233_604 118
334 3300049582 Ga0501048_0011201 Ga0501048_0011201_3087_3458 118
335 3300049585 Ga0501069_0122152 Ga0501069_0122152_327_698 118
336 3300049586 Ga0501070_0017777 Ga0501070_0017777_2454_2825 118
337 3300049589 Ga0501073_0039815 Ga0501073_0039815_1792_2163 118
338 3300049742 Ga0501080_1664755 Ga0501080_1664755_122_493 118
339 3300049822 Ga0501035_0005198 Ga0501035_0005198_5586_5957 118
340 3300049822 Ga0501035_0073443 Ga0501035_0073443_13_384 118
341 3300049823 Ga0501044_0006227 Ga0501044_0006227_5586_5957 118
342 3300061719 Ga0466962_0032340 Ga0466962_0032340_1883_2263 118
343 iso_pu_bacteria 2643221613 2644082276 118
344 iso_pu_bacteria 2643221721 2644664624 118
345 iso_pu_bacteria 2935890801 2935894126 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

16

64

0.98

PF01022

HTH_5

Bacterial regulatory protein, arsR family

18

64

0.98

PF01047

MarR

MarR family

24

71

0.95

PF08279

HTH_11

HTH domain

20

76

0.91

PF12802

MarR_2

MarR family

19

71

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9204 18 74
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9123 19 73
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.912 5 85
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9029 18 74
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9023 1 91
ID Description Score Start End Superfamily
af_Q5NE14_88_145_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9492 18 73 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9397 5 86 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9337 16 72 1.10.10.10
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9309 18 74 1.10.10.10
af_P71941_17_120_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9217 3 83 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A354NWL0-F1-model_v4 Transcriptional regulator 0.987 7 78 GO:0003700
AF-A0A4R9WUZ4-F1-model_v4 ArsR family transcriptional regulator 0.9773 4 75 GO:0003700
AF-A0A3S9VAS7-F1-model_v4 ArsR family transcriptional regulator 0.9586 9 85 GO:0003700
AF-A0A1S2J3F8-F1-model_v4 deleted 0.956 3 89
AF-A0A316RQ87-F1-model_v4 ArsR family transcriptional regulator 0.9556 7 88 GO:0003700

Feature Viewer

pLDDT pTM Quality
85.09 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map