F416403

General Info

Members Datasets Scaffolds Average Seq Length
345 223 690 280

Family's Representative Sequence

Representative Sequence 3300025909|Ga0207705_10044154|Ga0207705_100441544
Length 331
Sequence VSGGNAASGPNNDSVDWHRQPKVRPRLGPPAAQGLPGGLETVTGVESISPPDDPERIHVKRAFVIGHPIAHSRSPLIHGYWLKHYGIEGSYEPIDVTPDRLPDFFARLKAGEFAGGNVTIPHKEMAYALCDERDPLAEEIGAVNTLVLKGDEVTGFNTDYLGFLGNLDQNAPGWDKDLEDVIVLGAGGASRAILVALKSRNVGRIHLLNRTIDKAEALAIEFEGKIECGGLHEFSARAPNARLVVNTSSVGMKGTTFEAFDLSRLPEDAVVTDLVYVPLLTPLLEEAKTLGLKVVDGLGMLLHQAVPGFEAWFGTKPEVTPELRALVEATL

Samples

Sample ID Description Type Environment
1 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
67 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
68 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
129 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
132 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
133 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
134 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
135 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
138 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
139 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
140 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
181 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
182 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
183 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
184 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
190 2508501050 Microvirga lupini Lut6 Isolate Nodule
191 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
192 2509276019 Ensifer aridi TW10 Isolate Nodule
193 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
194 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
195 2516143018 Ensifer sp. BR816 Isolate Nodule
196 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
197 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
198 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
199 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
200 2643221629 Devosia sp. Root105 Isolate Unclassified
201 2643221662 Devosia sp. Root413D1 Isolate Unclassified
202 2643221733 Bosea sp. Root381 Isolate Unclassified
203 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
204 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
205 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
206 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
207 2818991467 Bosea vestrisii 3192 Isolate Unclassified
208 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
209 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
210 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
211 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
212 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
213 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
214 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
215 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
216 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
217 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
218 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
219 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
220 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
221 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
222 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
223 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.57
Metatranscriptomes 0.58
Isolates 9.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.88
Nodule 4.35
Rhizoplane 0.87
Rhizosphere 68.41
Stem 0
Stem Tuber 0
Unclassified 0.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207705_10044154 3300025909 Bacteria 3203
2 JGI24740J21852_10026035 3300001979 Bacteria 1964
3 JGI25158J39367_1007838 3300002739 Bacteria 1496
4 JGI25152J39213_1000820 3300002773 Bacteria 15512
5 JGI25153J46596_10005551 3300003215 Bacteria 6594
6 rootH1_10169368 3300003323 Bacteria 1654
7 Ga0006562J51391_1118626 3300003578 Bacteria 1760
8 Ga0055536_1004552 3300003781 Bacteria 7046
9 Ga0055531_10001167 3300003794 Bacteria 20222
10 Ga0065165_1003259 3300005262 Bacteria 11726
11 Ga0070658_10047559 3300005327 Bacteria 3472
12 Ga0070658_10076976 3300005327 Bacteria 2736
13 Ga0070658_10181119 3300005327 Bacteria 1773
14 Ga0070658_10183991 3300005327 Bacteria 1759
15 Ga0070682_100007351 3300005337 Bacteria 6212
16 Ga0070682_100175967 3300005337 Bacteria 1491
17 Ga0070660_100157011 3300005339 Bacteria 1831
18 Ga0070661_100000446 3300005344 Bacteria 31661
19 Ga0070661_100008518 3300005344 Bacteria 7093
20 Ga0070661_100017389 3300005344 Bacteria 5100
21 Ga0070675_100054585 3300005354 Bacteria 3288
22 Ga0070673_100214689 3300005364 Bacteria 1663
23 Ga0070659_100033544 3300005366 Bacteria 3987
24 Ga0070659_100218982 3300005366 Bacteria 1570
25 Ga0070710_10010540 3300005437 Bacteria 4543
26 Ga0070700_100207630 3300005441 Bacteria 1380
27 Ga0070663_100174947 3300005455 Bacteria 1662
28 Ga0070678_100017259 3300005456 Bacteria 4643
29 Ga0070678_100129194 3300005456 Bacteria 2005
30 Ga0070662_100079238 3300005457 Bacteria 2442
31 Ga0070681_10024745 3300005458 Bacteria 6040
32 Ga0070706_100020414 3300005467 Bacteria 6105
33 Ga0070698_100020159 3300005471 Bacteria 6990
34 Ga0070698_100117618 3300005471 Bacteria 2620
35 Ga0070699_100026873 3300005518 Bacteria 4965
36 Ga0070699_100286890 3300005518 Bacteria 1475
37 Ga0070697_100027446 3300005536 Bacteria 4555
38 Ga0068853_100002614 3300005539 Bacteria 13545
39 Ga0068853_100002813 3300005539 Bacteria 13174
40 Ga0068853_100022937 3300005539 Bacteria 5219
41 Ga0068853_100031727 3300005539 Bacteria 4469
42 Ga0068853_100124252 3300005539 Bacteria 2304
43 Ga0068853_100266700 3300005539 Bacteria 1576
44 Ga0068853_100429601 3300005539 Bacteria 1240
45 Ga0070672_100025566 3300005543 Bacteria 4381
46 Ga0070693_100005746 3300005547 Bacteria 5992
47 Ga0068855_100027054 3300005563 Bacteria 6862
48 Ga0068857_100054447 3300005577 Bacteria 3550
49 Ga0068854_100003011 3300005578 Bacteria 10461
50 Ga0068854_100017240 3300005578 Bacteria 4830
51 Ga0068856_100031963 3300005614 Bacteria 5150
52 Ga0068856_100104571 3300005614 Bacteria 2825
53 Ga0068856_100112770 3300005614 Bacteria 2717
54 Ga0068856_100131912 3300005614 Bacteria 2503
55 Ga0068852_100007860 3300005616 Bacteria 7809
56 Ga0068852_100095419 3300005616 Bacteria 2671
57 Ga0068852_100154511 3300005616 Bacteria 2136
58 Ga0068851_10001859 3300005834 Bacteria 9268
59 Ga0068851_10029310 3300005834 Bacteria 2725
60 Ga0081538_10081528 3300005981 Bacteria 1720
61 Ga0081540_1010421 3300005983 Bacteria 6298
62 Ga0081539_10000690 3300005985 Bacteria 67656
63 Ga0070717_10027743 3300006028 Bacteria 4527
64 Ga0075365_10114680 3300006038 Bacteria 1854
65 Ga0075365_10186950 3300006038 Bacteria 1449
66 Ga0075364_10000055 3300006051 Bacteria 41950
67 Ga0075362_10003742 3300006177 Bacteria 5376
68 Ga0075362_10045632 3300006177 Bacteria 1947
69 Ga0075367_10041309 3300006178 Bacteria 2695
70 Ga0075366_10037142 3300006195 Bacteria 2874
71 Ga0075366_10122123 3300006195 Bacteria 1570
72 Ga0075370_10037873 3300006353 Bacteria 2712
73 Ga0075428_100010541 3300006844 Bacteria 10270
74 Ga0075431_100109458 3300006847 Bacteria 2852
75 Ga0075429_100021745 3300006880 Bacteria 5563
76 Ga0079104_1001973 3300006946 Bacteria 12061
77 Ga0105240_10014195 3300009093 Bacteria 10878
78 Ga0105240_10118594 3300009093 Bacteria 3189
79 Ga0105240_10603159 3300009093 Bacteria 1209
80 Ga0114129_10009407 3300009147 Bacteria 13929
81 Ga0105243_10234303 3300009148 Bacteria 1630
82 Ga0105241_10025078 3300009174 Bacteria 4431
83 Ga0105241_10360207 3300009174 Bacteria 1265
84 Ga0105237_10003445 3300009545 Bacteria 18785
85 Ga0105237_10015191 3300009545 Bacteria 8022
86 Ga0105237_10187638 3300009545 Bacteria 2067
87 Ga0105238_10001923 3300009551 Bacteria 20855
88 Ga0105239_10013409 3300010375 Bacteria 9107
89 Ga0105239_10023745 3300010375 Bacteria 6752
90 Ga0105239_10040567 3300010375 Bacteria 5100
91 Ga0105239_10069699 3300010375 Bacteria 3863
92 Ga0105239_10083808 3300010375 Bacteria 3511
93 Ga0105239_10342848 3300010375 Bacteria 1686
94 Ga0105239_10815332 3300010375 Bacteria 1069
95 Ga0157373_10061856 3300013100 Bacteria 2651
96 Ga0157371_10005383 3300013102 Bacteria 10810
97 Ga0157370_10044456 3300013104 Bacteria 4269
98 Ga0157370_10144391 3300013104 Bacteria 2216
99 Ga0157370_10197222 3300013104 Bacteria 1868
100 Ga0157369_10067493 3300013105 Bacteria 3845
101 Ga0157374_10015110 3300013296 Bacteria 6768
102 Ga0157372_10017550 3300013307 Bacteria 7678
103 Ga0157372_10039958 3300013307 Bacteria 5180
104 Ga0157380_10087678 3300014326 Bacteria 2559
105 Ga0157380_10331869 3300014326 Bacteria 1415
106 Ga0206353_10447524 3300020082 Bacteria 1363
107 Ga0214544_1000163 3300021320 Bacteria 101631
108 Ga0214543_1000015 3300021327 Bacteria 305679
109 Ga0213874_10068973 3300021377 Bacteria 1123
110 Ga0213875_10003772 3300021388 Bacteria 8533
111 Ga0213875_10079629 3300021388 Bacteria 1528
112 Ga0207427_100957 3300025231 Bacteria 12296
113 Ga0209233_1000253 3300025261 Bacteria 82672
114 Ga0209676_1004127 3300025292 Bacteria 8274
115 Ga0209025_1044430 3300025294 Bacteria 1857
116 Ga0209758_1000406 3300025297 Bacteria 73962
117 Ga0209050_1011173 3300025298 Bacteria 4299
118 Ga0209051_1000547 3300025303 Bacteria 45743
119 Ga0209051_1017722 3300025303 Bacteria 3175
120 Ga0209257_1006107 3300025304 Bacteria 7995
121 Ga0207656_10004298 3300025321 Bacteria 4962
122 Ga0207656_10011745 3300025321 Bacteria 3315
123 Ga0207647_10092907 3300025904 Bacteria 1798
124 Ga0207705_10039852 3300025909 Bacteria 3367
125 Ga0207705_10271210 3300025909 Bacteria 1297
126 Ga0207684_10016182 3300025910 Bacteria 6409
127 Ga0207684_10340783 3300025910 Bacteria 1291
128 Ga0207654_10100432 3300025911 Bacteria 1782
129 Ga0207654_10152570 3300025911 Bacteria 1484
130 Ga0207707_10178032 3300025912 Bacteria 1857
131 Ga0207695_10273348 3300025913 Bacteria 1585
132 Ga0207671_10003608 3300025914 Bacteria 15295
133 Ga0207671_10042872 3300025914 Bacteria 3348
134 Ga0207660_10015716 3300025917 Bacteria 5000
135 Ga0207657_10037832 3300025919 Bacteria 4304
136 Ga0207649_10094988 3300025920 Bacteria 1960
137 Ga0207652_10109920 3300025921 Bacteria 2444
138 Ga0207694_10011114 3300025924 Bacteria 6800
139 Ga0207694_10168226 3300025924 Bacteria 1773
140 Ga0207690_10244997 3300025932 Bacteria 1382
141 Ga0207706_10041174 3300025933 Bacteria 4096
142 Ga0207669_10021815 3300025937 Bacteria 3389
143 Ga0207691_10060914 3300025940 Bacteria 3429
144 Ga0207667_10090124 3300025949 Bacteria 3169
145 Ga0207667_10235162 3300025949 Bacteria 1876
146 Ga0207667_10596274 3300025949 Bacteria 1114
147 Ga0207668_10095574 3300025972 Bacteria 2194
148 Ga0207640_10030130 3300025981 Bacteria 3338
149 Ga0207640_10074346 3300025981 Bacteria 2300
150 Ga0207640_10116797 3300025981 Bacteria 1903
151 Ga0207639_10000207 3300026041 Bacteria 44698
152 Ga0207639_10000551 3300026041 Bacteria 25713
153 Ga0207639_10001161 3300026041 Bacteria 17869
154 Ga0207639_10229032 3300026041 Bacteria 1610
155 Ga0207639_10280701 3300026041 Bacteria 1464
156 Ga0207678_10095217 3300026067 Bacteria 2544
157 Ga0207702_10010146 3300026078 Bacteria 7886
158 Ga0207702_10336288 3300026078 Bacteria 1441
159 Ga0207648_10062222 3300026089 Bacteria 3254
160 Ga0207648_10394009 3300026089 Bacteria 1254
161 Ga0207674_10034643 3300026116 Bacteria 5276
162 Ga0207674_10050782 3300026116 Bacteria 4235
163 Ga0207674_10099276 3300026116 Bacteria 2894
164 Ga0207683_10106771 3300026121 Bacteria 2504
165 Ga0207698_10001665 3300026142 Bacteria 12965
166 Ga0207698_10039343 3300026142 Bacteria 3502
167 Ga0207698_10177366 3300026142 Bacteria 1883
168 Ga0207698_10180709 3300026142 Bacteria 1868
169 Ga0268266_10001261 3300028379 Bacteria 30928
170 Ga0268266_10105492 3300028379 Bacteria 2490
171 Ga0307515_10192191 3300028794 Bacteria 1947
172 Ga0265327_10022525 3300031251 Bacteria 3761
173 Ga0307408_100114286 3300031548 Bacteria 2079
174 Ga0307405_10039287 3300031731 Bacteria 2859
175 Ga0307405_10218657 3300031731 Bacteria 1396
176 Ga0307405_10385358 3300031731 Bacteria 1093
177 Ga0307413_10020633 3300031824 Bacteria 3510
178 Ga0307412_10075587 3300031911 Bacteria 2311
179 Ga0307409_100070575 3300031995 Bacteria 2773
180 Ga0307409_100453636 3300031995 Bacteria 1238
181 Ga0373953_0000798 3300035117 Bacteria 8788
182 Ga0373954_0042355 3300035118 Bacteria 2123
183 Ga0373954_0188076 3300035118 Bacteria 1013
184 Ga0373956_0162585 3300035119 Bacteria 1052
185 Ga0373937_0014522 3300036401 Bacteria 6954
186 Ga0373937_0083110 3300036401 Bacteria 2962
187 Ga0395899_0019123 3300037312 Bacteria 5205
188 Ga0395899_0108332 3300037312 Bacteria 1999
189 Ga0395900_0052713 3300037418 Bacteria 4187
190 Ga0395900_0104798 3300037418 Bacteria 2905
191 Ga0395898_0030263 3300037466 Bacteria 5418
192 Ga0395898_0533249 3300037466 Bacteria 1115
193 Ga0436364_0128168 3300037853 Bacteria 71580
194 Ga0436364_1014610 3300037853 Bacteria 1799
195 Ga0395901_1078608 3300038443 Bacteria 775
196 Ga0400483_133223 3300039062 Bacteria 5867
197 Ga0400483_191709 3300039062 Bacteria 8235
198 Ga0436360_0212877 3300039438 Bacteria 2751
199 Ga0436360_0365447 3300039438 Bacteria 2600
200 Ga0436362_0489397 3300039453 Bacteria 4764
201 Ga0436362_0844612 3300039453 Bacteria 1685
202 Ga0439466_0040779 3300041411 Bacteria 1552
203 Ga0439465_0066921 3300041413 Bacteria 1198
204 Ga0439465_0107758 3300041413 Bacteria 967
205 Ga0451807_2576637 3300041486 Bacteria 1312
206 Ga0466970_0051960 3300044765 Bacteria 2188
207 Ga0495607_0027160 3300046501 Bacteria 3544
208 Ga0495643_0063994 3300046522 Bacteria 1944
209 Ga0496109_0107151 3300048912 Bacteria 2596
210 Ga0496116_0055947 3300048919 Bacteria 2588
211 Ga0496116_0237218 3300048919 Unclassified 919
212 Ga0496117_0010245 3300048920 Bacteria 8588
213 Ga0496117_0118261 3300048920 Bacteria 1634
214 Ga0496118_0090333 3300048921 Bacteria 2111
215 Ga0496119_0023565 3300048922 Bacteria 4358
216 Ga0496120_0008826 3300048923 Bacteria 7237
217 Ga0496121_0000034 3300048924 Bacteria 377095
218 Ga0496121_0057134 3300048924 Bacteria 3236
219 Ga0496121_0165100 3300048924 Bacteria 1615
220 Ga0496121_0267232 3300048924 Bacteria 1177
221 Ga0496122_0000082 3300048925 Bacteria 209159
222 Ga0496122_0049845 3300048925 Bacteria 3199
223 Ga0496123_0000067 3300048926 Bacteria 209159
224 Ga0496123_0041078 3300048926 Bacteria 3211
225 Ga0496123_0051313 3300048926 Bacteria 2747
226 Ga0496124_0092524 3300048927 Bacteria 2463
227 Ga0496124_0134174 3300048927 Bacteria 1962
228 Ga0496124_0255056 3300048927 Bacteria 1294
229 Ga0496125_0000030 3300048928 Bacteria 375023
230 Ga0496126_0096937 3300048929 Bacteria 2585
231 Ga0501031_0017718 3300049568 Bacteria 4631
232 Ga0501031_0101409 3300049568 Bacteria 1878
233 Ga0501031_0190140 3300049568 Bacteria 1341
234 Ga0501032_0013589 3300049569 Bacteria 5784
235 Ga0501032_0171975 3300049569 Bacteria 1420
236 Ga0501033_0014638 3300049570 Bacteria 5956
237 Ga0501034_0172534 3300049571 Bacteria 2129
238 Ga0501034_0383927 3300049571 Bacteria 1329
239 Ga0501034_0527760 3300049571 Bacteria 1092
240 Ga0501036_0018772 3300049572 Bacteria 5799
241 Ga0501036_0053950 3300049572 Bacteria 3403
242 Ga0501036_0255806 3300049572 Bacteria 1467
243 Ga0501036_0504083 3300049572 Bacteria 1007
244 Ga0501037_0066460 3300049573 Bacteria 2627
245 Ga0501037_0144244 3300049573 Bacteria 1703
246 Ga0501037_0199774 3300049573 Unclassified 1413
247 Ga0501038_0020797 3300049574 Bacteria 5898
248 Ga0501038_0078125 3300049574 Bacteria 2793
249 Ga0501038_0166472 3300049574 Bacteria 1788
250 Ga0501038_0367863 3300049574 Bacteria 1117
251 Ga0501039_0022369 3300049575 Bacteria 4853
252 Ga0501039_0025596 3300049575 Bacteria 4535
253 Ga0501040_0018311 3300049576 Bacteria 4649
254 Ga0501040_0079017 3300049576 Bacteria 2277
255 Ga0501041_0013454 3300049577 Bacteria 4850
256 Ga0501042_0007834 3300049578 Bacteria 7023
257 Ga0501043_0065255 3300049579 Bacteria 2858
258 Ga0501043_0080057 3300049579 Bacteria 2567
259 Ga0501043_0105105 3300049579 Bacteria 2219
260 Ga0501046_0021628 3300049580 Bacteria 5307
261 Ga0501046_0039833 3300049580 Bacteria 3759
262 Ga0501047_0015784 3300049581 Bacteria 7199
263 Ga0501048_0042282 3300049582 Bacteria 3263
264 Ga0501069_0060924 3300049585 Bacteria 2107
265 Ga0501070_0044631 3300049586 Bacteria 3687
266 Ga0501070_0095948 3300049586 Bacteria 2453
267 Ga0501070_0111381 3300049586 Bacteria 2262
268 Ga0501070_0160743 3300049586 Bacteria 1852
269 Ga0501071_0007713 3300049587 Bacteria 7094
270 Ga0501072_0054239 3300049588 Bacteria 3157
271 Ga0501073_0187221 3300049589 Bacteria 1433
272 Ga0501076_0031410 3300049592 Bacteria 4141
273 Ga0501077_0081224 3300049593 Bacteria 2053
274 Ga0501079_0011859 3300049741 Bacteria 6652
275 Ga0501080_0101941 3300049742 Bacteria 2663
276 Ga0501080_0310904 3300049742 Bacteria 1428
277 Ga0501081_0023694 3300049743 Bacteria 4116
278 Ga0501083_0134051 3300049744 Bacteria 1624
279 Ga0501035_0016301 3300049822 Bacteria 6854
280 Ga0501035_0034773 3300049822 Bacteria 4578
281 Ga0501035_0050454 3300049822 Bacteria 3729
282 Ga0501035_0050591 3300049822 Bacteria 3723
283 Ga0501035_0407486 3300049822 Bacteria 1130
284 Ga0501044_0173937 3300049823 Unclassified 2123
285 Ga0501044_0406413 3300049823 Bacteria 1273
286 Ga0501045_0025021 3300049824 Bacteria 4289
287 nmdc:mga03683_72561_c1 3300050489 Bacteria 1474
288 nmdc:mga00v17_431_c1 3300050491 Bacteria 23635
289 nmdc:mga0yw44_154578_c1 3300050492 Bacteria 1498
290 nmdc:mga0yw44_4777_c2 3300050492 Bacteria 5532
291 nmdc:mga0yw44_53684_c1 3300050492 Bacteria 2448
292 nmdc:mga04h51_13996_c1 3300050495 Bacteria 2283
293 nmdc:mga07m45_14807_c1 3300050496 Bacteria 4164
294 nmdc:mga07m45_168803_c1 3300050496 Bacteria 1271
295 nmdc:mga09592_9798_c1 3300050508 Bacteria 7787
296 nmdc:mga0qj67_537664_c1 3300050509 Bacteria 938
297 nmdc:mga06r32_5373_c1 3300050510 Bacteria 11525
298 Ga0495619_0005086 3300053085 Bacteria 8351
299 Ga0495619_0154118 3300053085 Bacteria 1585
300 Ga0500641_0176638 3300053096 Bacteria 918
301 Ga0500608_089261 3300053122 Bacteria 1443
302 Ga0500655_000659 3300053133 Bacteria 6845
303 Ga0500568_0004709 3300053139 Bacteria 7238
304 Ga0500577_0029152 3300053142 Bacteria 1909
305 Ga0500616_0000448 3300053153 Bacteria 53998
306 Ga0500616_0014593 3300053153 Bacteria 4510
307 Ga0500616_0021440 3300053153 Bacteria 3623
308 Ga0500636_0012984 3300053177 Bacteria 4887
309 Ga0501084_0044053 3300054114 Bacteria 3734
310 Ga0501082_0074176 3300060353 Bacteria 2930
311 Ga0530510_0025429 3300061734 Bacteria 4234
312 2508734591 2508501050 Bacteria 9633614
313 2509108852 2508501122 Bacteria 6292184
314 2509377982 2509276019 Bacteria 6802256
315 2510839198 2510461069 Bacteria 5505000
316 2511168437 2510917026 Bacteria 7046020
317 2516205705 2516143018 Bacteria 6951533
318 2558867517 2558860100 Bacteria 8458965
319 2585998086 2585427633 Bacteria 6413184
320 2586002665 2585427634 Bacteria 6455027
321 2599335740 2599185156 Bacteria 5403036
322 2644164751 2643221629 Bacteria 5850260
323 2644345977 2643221662 Bacteria 5851492
324 2644730966 2643221733 Bacteria 5690728
325 2692319828 2690316117 Bacteria 6800650
326 2776257467 2775506901 Bacteria 9631051
327 2792640086 2791355094 Bacteria 7011481
328 2819688372 2818991461 Bacteria 7026071
329 2819722259 2818991467 Bacteria 5893227
330 2824687802 2824679649 Bacteria 8248951
331 2835318267 2835312727 Bacteria 7413381
332 2838078052 2838074704 Bacteria 6785777
333 2842699726 2842698319 Bacteria 5190321
334 2842926472 2842922631 Bacteria 5824079
335 2847420948 2847417321 Bacteria 6913799
336 2848995779 2848992105 Bacteria 6810864
337 2850082762 2850079185 Bacteria 6848280
338 2854897781 2854896431 Bacteria 5869725
339 2854922324 2854916844 Bacteria 5725939
340 2855873643 2855872281 Bacteria 6964271
341 2894235794 2894232714 Bacteria 8834183
342 2896390076 2896384573 Bacteria 7700774
343 2919176874 2919171160 Bacteria 6499771
344 2922396440 2922393267 Bacteria 8285685
345 2929142011 2929138655 Bacteria 5810547
346 Ga0207705_10044154
347 JGI24740J21852_10026035
348 JGI25158J39367_1007838
349 JGI25152J39213_1000820
350 JGI25153J46596_10005551
351 rootH1_10169368
352 Ga0006562J51391_1118626
353 Ga0055536_1004552
354 Ga0055531_10001167
355 Ga0065165_1003259
356 Ga0070658_10047559
357 Ga0070658_10076976
358 Ga0070658_10181119
359 Ga0070658_10183991
360 Ga0070682_100007351
361 Ga0070682_100175967
362 Ga0070660_100157011
363 Ga0070661_100000446
364 Ga0070661_100008518
365 Ga0070661_100017389
366 Ga0070675_100054585
367 Ga0070673_100214689
368 Ga0070659_100033544
369 Ga0070659_100218982
370 Ga0070710_10010540
371 Ga0070700_100207630
372 Ga0070663_100174947
373 Ga0070678_100017259
374 Ga0070678_100129194
375 Ga0070662_100079238
376 Ga0070681_10024745
377 Ga0070706_100020414
378 Ga0070698_100020159
379 Ga0070698_100117618
380 Ga0070699_100026873
381 Ga0070699_100286890
382 Ga0070697_100027446
383 Ga0068853_100002614
384 Ga0068853_100002813
385 Ga0068853_100022937
386 Ga0068853_100031727
387 Ga0068853_100124252
388 Ga0068853_100266700
389 Ga0068853_100429601
390 Ga0070672_100025566
391 Ga0070693_100005746
392 Ga0068855_100027054
393 Ga0068857_100054447
394 Ga0068854_100003011
395 Ga0068854_100017240
396 Ga0068856_100031963
397 Ga0068856_100104571
398 Ga0068856_100112770
399 Ga0068856_100131912
400 Ga0068852_100007860
401 Ga0068852_100095419
402 Ga0068852_100154511
403 Ga0068851_10001859
404 Ga0068851_10029310
405 Ga0081538_10081528
406 Ga0081540_1010421
407 Ga0081539_10000690
408 Ga0070717_10027743
409 Ga0075365_10114680
410 Ga0075365_10186950
411 Ga0075364_10000055
412 Ga0075362_10003742
413 Ga0075362_10045632
414 Ga0075367_10041309
415 Ga0075366_10037142
416 Ga0075366_10122123
417 Ga0075370_10037873
418 Ga0075428_100010541
419 Ga0075431_100109458
420 Ga0075429_100021745
421 Ga0079104_1001973
422 Ga0105240_10014195
423 Ga0105240_10118594
424 Ga0105240_10603159
425 Ga0114129_10009407
426 Ga0105243_10234303
427 Ga0105241_10025078
428 Ga0105241_10360207
429 Ga0105237_10003445
430 Ga0105237_10015191
431 Ga0105237_10187638
432 Ga0105238_10001923
433 Ga0105239_10013409
434 Ga0105239_10023745
435 Ga0105239_10040567
436 Ga0105239_10069699
437 Ga0105239_10083808
438 Ga0105239_10342848
439 Ga0105239_10815332
440 Ga0157373_10061856
441 Ga0157371_10005383
442 Ga0157370_10044456
443 Ga0157370_10144391
444 Ga0157370_10197222
445 Ga0157369_10067493
446 Ga0157374_10015110
447 Ga0157372_10017550
448 Ga0157372_10039958
449 Ga0157380_10087678
450 Ga0157380_10331869
451 Ga0206353_10447524
452 Ga0214544_1000163
453 Ga0214543_1000015
454 Ga0213874_10068973
455 Ga0213875_10003772
456 Ga0213875_10079629
457 Ga0207427_100957
458 Ga0209233_1000253
459 Ga0209676_1004127
460 Ga0209025_1044430
461 Ga0209758_1000406
462 Ga0209050_1011173
463 Ga0209051_1000547
464 Ga0209051_1017722
465 Ga0209257_1006107
466 Ga0207656_10004298
467 Ga0207656_10011745
468 Ga0207647_10092907
469 Ga0207705_10039852
470 Ga0207705_10271210
471 Ga0207684_10016182
472 Ga0207684_10340783
473 Ga0207654_10100432
474 Ga0207654_10152570
475 Ga0207707_10178032
476 Ga0207695_10273348
477 Ga0207671_10003608
478 Ga0207671_10042872
479 Ga0207660_10015716
480 Ga0207657_10037832
481 Ga0207649_10094988
482 Ga0207652_10109920
483 Ga0207694_10011114
484 Ga0207694_10168226
485 Ga0207690_10244997
486 Ga0207706_10041174
487 Ga0207669_10021815
488 Ga0207691_10060914
489 Ga0207667_10090124
490 Ga0207667_10235162
491 Ga0207667_10596274
492 Ga0207668_10095574
493 Ga0207640_10030130
494 Ga0207640_10074346
495 Ga0207640_10116797
496 Ga0207639_10000207
497 Ga0207639_10000551
498 Ga0207639_10001161
499 Ga0207639_10229032
500 Ga0207639_10280701
501 Ga0207678_10095217
502 Ga0207702_10010146
503 Ga0207702_10336288
504 Ga0207648_10062222
505 Ga0207648_10394009
506 Ga0207674_10034643
507 Ga0207674_10050782
508 Ga0207674_10099276
509 Ga0207683_10106771
510 Ga0207698_10001665
511 Ga0207698_10039343
512 Ga0207698_10177366
513 Ga0207698_10180709
514 Ga0268266_10001261
515 Ga0268266_10105492
516 Ga0307515_10192191
517 Ga0265327_10022525
518 Ga0307408_100114286
519 Ga0307405_10039287
520 Ga0307405_10218657
521 Ga0307405_10385358
522 Ga0307413_10020633
523 Ga0307412_10075587
524 Ga0307409_100070575
525 Ga0307409_100453636
526 Ga0373953_0000798
527 Ga0373954_0042355
528 Ga0373954_0188076
529 Ga0373956_0162585
530 Ga0373937_0014522
531 Ga0373937_0083110
532 Ga0395899_0019123
533 Ga0395899_0108332
534 Ga0395900_0052713
535 Ga0395900_0104798
536 Ga0395898_0030263
537 Ga0395898_0533249
538 Ga0436364_0128168
539 Ga0436364_1014610
540 Ga0395901_1078608
541 Ga0400483_133223
542 Ga0400483_191709
543 Ga0436360_0212877
544 Ga0436360_0365447
545 Ga0436362_0489397
546 Ga0436362_0844612
547 Ga0439466_0040779
548 Ga0439465_0066921
549 Ga0439465_0107758
550 Ga0451807_2576637
551 Ga0466970_0051960
552 Ga0495607_0027160
553 Ga0495643_0063994
554 Ga0496109_0107151
555 Ga0496116_0055947
556 Ga0496116_0237218
557 Ga0496117_0010245
558 Ga0496117_0118261
559 Ga0496118_0090333
560 Ga0496119_0023565
561 Ga0496120_0008826
562 Ga0496121_0000034
563 Ga0496121_0057134
564 Ga0496121_0165100
565 Ga0496121_0267232
566 Ga0496122_0000082
567 Ga0496122_0049845
568 Ga0496123_0000067
569 Ga0496123_0041078
570 Ga0496123_0051313
571 Ga0496124_0092524
572 Ga0496124_0134174
573 Ga0496124_0255056
574 Ga0496125_0000030
575 Ga0496126_0096937
576 Ga0501031_0017718
577 Ga0501031_0101409
578 Ga0501031_0190140
579 Ga0501032_0013589
580 Ga0501032_0171975
581 Ga0501033_0014638
582 Ga0501034_0172534
583 Ga0501034_0383927
584 Ga0501034_0527760
585 Ga0501036_0018772
586 Ga0501036_0053950
587 Ga0501036_0255806
588 Ga0501036_0504083
589 Ga0501037_0066460
590 Ga0501037_0144244
591 Ga0501037_0199774
592 Ga0501038_0020797
593 Ga0501038_0078125
594 Ga0501038_0166472
595 Ga0501038_0367863
596 Ga0501039_0022369
597 Ga0501039_0025596
598 Ga0501040_0018311
599 Ga0501040_0079017
600 Ga0501041_0013454
601 Ga0501042_0007834
602 Ga0501043_0065255
603 Ga0501043_0080057
604 Ga0501043_0105105
605 Ga0501046_0021628
606 Ga0501046_0039833
607 Ga0501047_0015784
608 Ga0501048_0042282
609 Ga0501069_0060924
610 Ga0501070_0044631
611 Ga0501070_0095948
612 Ga0501070_0111381
613 Ga0501070_0160743
614 Ga0501071_0007713
615 Ga0501072_0054239
616 Ga0501073_0187221
617 Ga0501076_0031410
618 Ga0501077_0081224
619 Ga0501079_0011859
620 Ga0501080_0101941
621 Ga0501080_0310904
622 Ga0501081_0023694
623 Ga0501083_0134051
624 Ga0501035_0016301
625 Ga0501035_0034773
626 Ga0501035_0050454
627 Ga0501035_0050591
628 Ga0501035_0407486
629 Ga0501044_0173937
630 Ga0501044_0406413
631 Ga0501045_0025021
632 nmdc:mga03683_72561_c1
633 nmdc:mga00v17_431_c1
634 nmdc:mga0yw44_154578_c1
635 nmdc:mga0yw44_4777_c2
636 nmdc:mga0yw44_53684_c1
637 nmdc:mga04h51_13996_c1
638 nmdc:mga07m45_14807_c1
639 nmdc:mga07m45_168803_c1
640 nmdc:mga09592_9798_c1
641 nmdc:mga0qj67_537664_c1
642 nmdc:mga06r32_5373_c1
643 Ga0495619_0005086
644 Ga0495619_0154118
645 Ga0500641_0176638
646 Ga0500608_089261
647 Ga0500655_000659
648 Ga0500568_0004709
649 Ga0500577_0029152
650 Ga0500616_0000448
651 Ga0500616_0014593
652 Ga0500616_0021440
653 Ga0500636_0012984
654 Ga0501084_0044053
655 Ga0501082_0074176
656 Ga0530510_0025429
657 2508734591
658 2509108852
659 2509377982
660 2510839198
661 2511168437
662 2516205705
663 2558867517
664 2585998086
665 2586002665
666 2599335740
667 2644164751
668 2644345977
669 2644730966
670 2692319828
671 2776257467
672 2792640086
673 2819688372
674 2819722259
675 2824687802
676 2835318267
677 2838078052
678 2842699726
679 2842926472
680 2847420948
681 2848995779
682 2850082762
683 2854897781
684 2854922324
685 2855873643
686 2894235794
687 2896390076
688 2919176874
689 2922396440
690 2929142011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08501

Shikimate_dh_N

Shikimate dehydrogenase substrate binding domain

64

146

0.99

PF18317

SDH_C

Shikimate 5'-dehydrogenase C-terminal domain

297

326

0.93

PF01488

Shikimate_DH

Shikimate / quinate 5-dehydrogenase

170

290

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2egg-assembly1.cif.gz_A crystal structure of shikimate 5-dehydrogenase (aroe) from geobacillus kaustophilus 0.9323 8 283
2egg-assembly1.cif.gz_A crystal structure of shikimate 5-dehydrogenase (aroe) from geobacillus kaustophilus 0.9194 8 283
3sef-assembly2.cif.gz_C 2.4 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. n16961 in complex with shikimate and nadph 0.9169 10 282
3pgj-assembly2.cif.gz_C 2.49 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. n16961 in complex with shikimate 0.9156 10 282
2cy0-assembly1.cif.gz_B crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with nadp 0.9134 10 285
ID Description Score Start End Superfamily
3tozG01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9471 9 110 3.40.50.10860
af_P0A6D5_3_112_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9453 9 115 3.40.50.10860
3tumA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9449 9 109 3.40.50.10860
af_P0A6D5_8_104_1.10.560.10 Mainly Alpha;Orthogonal Bundle;GROEL; domain 1;GroEL-like equatorial domain 0.9386 11 107 1.10.560.10
af_Q2FXY1_2_97_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9317 12 107 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A520NVJ4-F1-model_v4 Shikimate dehydrogenase (NADP(+)) (SDH) (EC 1.1.1.25) 0.9727 9 281 GO:0004764
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0019632
GO:0050661
AF-A0A368A2Q1-F1-model_v4 Shikimate dehydrogenase (NADP(+)) (SDH) (EC 1.1.1.25) 0.9709 9 284 GO:0004764
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0019632
GO:0050661
AF-A0A4V1TIF8-F1-model_v4 Shikimate dehydrogenase 0.9678 98 281 GO:0004764
GO:0005829
GO:0009073
GO:0009423
GO:0019632
GO:0050661
AF-A5G270-F1-model_v4 Shikimate dehydrogenase (NADP(+)) (SDH) (EC 1.1.1.25) 0.9672 9 282 GO:0004764
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0019632
GO:0050661
AF-A0A2E7WXI1-F1-model_v4 Shikimate dehydrogenase (NADP(+)) (SDH) (EC 1.1.1.25) 0.9649 1 281 GO:0004764
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0019632
GO:0050661

Map