F416329

General Info

Members Datasets Scaffolds Average Seq Length
345 178 345 328

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100026165|Ga0075431_1000261653
Length 332
Sequence MLRLPRFSYHEPTTVAEAVRLYAEAAPNVAYVAGGTDLYPNMKRRQQTPAVVVALHRIPELRTISGTPETGMTIGACVTLTELAAHEGIRARYSAVSHAAHVVSTPILRNMGTIGGNLLLDTRCNYYDQNYEWRKAINFCMKRDGEICWVAPSSPRCWAVQSSDGVPVAVALGAEVTLTSVRGMRRLPAAGLYRNDGIQYLEKAPDELLVAYHLPSVANGGWRATYRKLRRRDAFDFPVLGVAARVDFARDGSVSSARIVLGAVASYPQEIPEAAQAIVGSRLDETAIGAAADAAYRPAKPMDNTDFTLAWRKEMVRVHVQRALQDIRAQSR

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
141 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
142 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
151 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
152 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
153 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
159 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
160 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
161 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
162 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
163 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
164 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
165 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
166 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
167 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
168 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.9
Rhizosphere 95.36
Stem 0
Stem Tuber 0
Unclassified 1.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000002 3300002074 Bacteria 426946
2 JGI24034J26672_10000004 3300002239 Bacteria 426946
3 Ga0065707_10088510 3300005295 Unclassified 4626
4 Ga0065707_10120093 3300005295 Bacteria 2143
5 Ga0070676_10166499 3300005328 Unclassified 1422
6 Ga0070690_100023738 3300005330 Bacteria 3764
7 Ga0070690_100188938 3300005330 Bacteria 1427
8 Ga0070670_100000413 3300005331 Bacteria 35230
9 Ga0068869_100027918 3300005334 Bacteria 3939
10 Ga0068869_100028107 3300005334 Unclassified 3926
11 Ga0070680_100000342 3300005336 Bacteria 31293
12 Ga0070689_100010625 3300005340 Bacteria 6565
13 Ga0070689_100116122 3300005340 Bacteria 2134
14 Ga0070687_100133947 3300005343 Unclassified 1434
15 Ga0070668_100010083 3300005347 Bacteria 7004
16 Ga0070669_100243829 3300005353 Bacteria 1429
17 Ga0070675_100081464 3300005354 Bacteria 2699
18 Ga0070675_100279656 3300005354 Unclassified 1466
19 Ga0070671_100004622 3300005355 Bacteria 10915
20 Ga0070671_100143527 3300005355 Bacteria 2015
21 Ga0070673_100015044 3300005364 Bacteria 5416
22 Ga0070673_100025917 3300005364 Bacteria 4323
23 Ga0070673_100187920 3300005364 Bacteria 1772
24 Ga0070688_100066865 3300005365 Bacteria 2288
25 Ga0070659_100001636 3300005366 Bacteria 16138
26 Ga0070667_100168627 3300005367 Unclassified 1931
27 Ga0070701_10112045 3300005438 Bacteria 1526
28 Ga0070701_10136850 3300005438 Unclassified 1397
29 Ga0070700_100023717 3300005441 Bacteria 3592
30 Ga0070694_100088863 3300005444 Unclassified 2164
31 Ga0070694_100092931 3300005444 Unclassified 2120
32 Ga0070708_100000361 3300005445 Bacteria 34379
33 Ga0070681_10000043 3300005458 Bacteria 86436
34 Ga0070681_10029351 3300005458 Bacteria 5523
35 Ga0070681_10118817 3300005458 Bacteria 2580
36 Ga0068867_100049378 3300005459 Unclassified 3097
37 Ga0070685_10008896 3300005466 Bacteria 5177
38 Ga0070706_100000055 3300005467 Bacteria 137675
39 Ga0070706_100004283 3300005467 Bacteria 13831
40 Ga0070706_100024043 3300005467 Bacteria 5610
41 Ga0070706_100026577 3300005467 Bacteria 5326
42 Ga0070706_100037418 3300005467 Unclassified 4482
43 Ga0070707_100002485 3300005468 Bacteria 17581
44 Ga0070707_100020620 3300005468 Bacteria 6220
45 Ga0070707_100045074 3300005468 Unclassified 4221
46 Ga0070707_100264792 3300005468 Bacteria 1672
47 Ga0070707_100272814 3300005468 Unclassified 1644
48 Ga0070707_100347778 3300005468 Bacteria 1440
49 Ga0070698_100004560 3300005471 Bacteria 15214
50 Ga0070698_100009470 3300005471 Bacteria 10435
51 Ga0070698_100014091 3300005471 Bacteria 8454
52 Ga0070698_100016325 3300005471 Bacteria 7840
53 Ga0070698_100017121 3300005471 Bacteria 7640
54 Ga0070699_100007923 3300005518 Bacteria 9226
55 Ga0070699_100015176 3300005518 Bacteria 6619
56 Ga0070699_100021496 3300005518 Bacteria 5565
57 Ga0070679_100000036 3300005530 Bacteria 101158
58 Ga0070679_100033992 3300005530 Bacteria 5051
59 Ga0070697_100001825 3300005536 Bacteria 16277
60 Ga0070697_100004262 3300005536 Bacteria 10964
61 Ga0070697_100063716 3300005536 Bacteria 3010
62 Ga0070697_100070891 3300005536 Unclassified 2858
63 Ga0068853_100014025 3300005539 Bacteria 6558
64 Ga0068853_100359464 3300005539 Unclassified 1356
65 Ga0068853_100483808 3300005539 Unclassified 1167
66 Ga0070672_100052623 3300005543 Bacteria 3179
67 Ga0070672_100190290 3300005543 Bacteria 1713
68 Ga0070686_100009294 3300005544 Bacteria 5519
69 Ga0070696_100154526 3300005546 Unclassified 1686
70 Ga0068855_100354039 3300005563 Bacteria 1617
71 Ga0070664_100003832 3300005564 Bacteria 12142
72 Ga0070664_100332989 3300005564 Unclassified 1378
73 Ga0068857_100001668 3300005577 Bacteria 17826
74 Ga0068856_100031361 3300005614 Bacteria 5199
75 Ga0070702_100077014 3300005615 Bacteria 1987
76 Ga0070702_100147748 3300005615 Bacteria 1505
77 Ga0068859_100027572 3300005617 Bacteria 5697
78 Ga0068859_100054142 3300005617 Bacteria 4035
79 Ga0068859_100163627 3300005617 Bacteria 2304
80 Ga0068859_100448513 3300005617 Unclassified 1386
81 Ga0068864_100035605 3300005618 Bacteria 4238
82 Ga0068866_10049577 3300005718 Unclassified 2128
83 Ga0068861_100016147 3300005719 Bacteria 5276
84 Ga0068870_10083395 3300005840 Unclassified 1772
85 Ga0068863_100163452 3300005841 Unclassified 2134
86 Ga0068863_100198632 3300005841 Viruses 1928
87 Ga0068858_100002375 3300005842 Bacteria 19040
88 Ga0068858_100174618 3300005842 Bacteria 2027
89 Ga0068858_100199925 3300005842 Bacteria 1890
90 Ga0068858_100358931 3300005842 Bacteria 1397
91 Ga0068860_100033702 3300005843 Bacteria 4913
92 Ga0068860_100076654 3300005843 Bacteria 3180
93 Ga0068860_100088695 3300005843 Bacteria 2944
94 Ga0068860_100188766 3300005843 Bacteria 1994
95 Ga0068860_100189048 3300005843 Bacteria 1992
96 Ga0068862_100068855 3300005844 Bacteria 3054
97 Ga0081539_10000033 3300005985 Bacteria 309306
98 Ga0081539_10001274 3300005985 Bacteria 44371
99 Ga0081539_10002860 3300005985 Bacteria 22952
100 Ga0081539_10033343 3300005985 Bacteria 3138
101 Ga0070715_10000019 3300006163 Bacteria 122990
102 Ga0070716_100000001 3300006173 Bacteria 400668
103 Ga0070716_100011114 3300006173 Bacteria 4531
104 Ga0075431_100026165 3300006847 Bacteria 5985
105 Ga0075431_100027484 3300006847 Bacteria 5838
106 Ga0075433_10107475 3300006852 Bacteria 2474
107 Ga0075433_10278991 3300006852 Unclassified 1480
108 Ga0075434_100019153 3300006871 Bacteria 6619
109 Ga0075434_100282989 3300006871 Bacteria 1678
110 Ga0075434_100318167 3300006871 Unclassified 1577
111 Ga0075429_100126941 3300006880 Bacteria 2231
112 Ga0075429_100193234 3300006880 Bacteria 1783
113 Ga0068865_100077498 3300006881 Unclassified 2376
114 Ga0068865_100209791 3300006881 Bacteria 1517
115 Ga0075436_100000015 3300006914 Bacteria 174598
116 Ga0097620_100027570 3300006931 Bacteria 5697
117 Ga0097620_100054143 3300006931 Bacteria 4035
118 Ga0097620_100163631 3300006931 Bacteria 2304
119 Ga0097620_100448491 3300006931 Unclassified 1386
120 Ga0075435_100000410 3300007076 Bacteria 26372
121 Ga0075435_100017182 3300007076 Bacteria 5469
122 Ga0105251_10045850 3300009011 Bacteria 2106
123 Ga0105247_10000005 3300009101 Bacteria 426989
124 Ga0105247_10062101 3300009101 Unclassified 2317
125 Ga0114129_10003875 3300009147 Bacteria 21099
126 Ga0114129_10027104 3300009147 Bacteria 8113
127 Ga0114129_10078668 3300009147 Unclassified 4586
128 Ga0114129_10210158 3300009147 Bacteria 2631
129 Ga0114129_10249433 3300009147 Bacteria 2384
130 Ga0114129_10252430 3300009147 Unclassified 2367
131 Ga0114129_10327476 3300009147 Unclassified 2035
132 Ga0114129_10564365 3300009147 Bacteria 1479
133 Ga0114129_10797294 3300009147 Bacteria 1205
134 Ga0105243_10002722 3300009148 Bacteria 14692
135 Ga0105243_10030928 3300009148 Bacteria 4125
136 Ga0105243_10047688 3300009148 Unclassified 3374
137 Ga0105243_10256169 3300009148 Unclassified 1565
138 Ga0105241_10028499 3300009174 Bacteria 4162
139 Ga0105241_10076400 3300009174 Bacteria 2612
140 Ga0105242_10000227 3300009176 Bacteria 44246
141 Ga0105242_10000507 3300009176 Bacteria 30734
142 Ga0105242_10002537 3300009176 Bacteria 14333
143 Ga0105242_10020232 3300009176 Bacteria 5218
144 Ga0105248_10006595 3300009177 Bacteria 12722
145 Ga0105248_10081124 3300009177 Unclassified 3646
146 Ga0105248_10389938 3300009177 Bacteria 1568
147 Ga0105248_10435129 3300009177 Unclassified 1477
148 Ga0105248_10456022 3300009177 Bacteria 1441
149 Ga0105249_10000375 3300009553 Bacteria 44344
150 Ga0105249_10022736 3300009553 Bacteria 5620
151 Ga0105249_10309687 3300009553 Bacteria 1587
152 Ga0105239_10047024 3300010375 Bacteria 4728
153 Ga0105239_10590676 3300010375 Unclassified 1266
154 Ga0105246_10030376 3300011119 Bacteria 3568
155 Ga0157373_10004467 3300013100 Bacteria 10527
156 Ga0157374_10070109 3300013296 Unclassified 3302
157 Ga0157378_10000067 3300013297 Bacteria 92867
158 Ga0157378_10006655 3300013297 Bacteria 10097
159 Ga0157378_10007638 3300013297 Bacteria 9438
160 Ga0157378_10050935 3300013297 Unclassified 3684
161 Ga0157378_10113153 3300013297 Bacteria 2491
162 Ga0157378_10249997 3300013297 Unclassified 1697
163 Ga0157378_10325240 3300013297 Unclassified 1495
164 Ga0163162_10000162 3300013306 Bacteria 61820
165 Ga0163162_10001341 3300013306 Bacteria 22917
166 Ga0163162_10004188 3300013306 Bacteria 13864
167 Ga0163162_10047180 3300013306 Bacteria 4317
168 Ga0163162_10056960 3300013306 Unclassified 3936
169 Ga0163162_10091654 3300013306 Bacteria 3122
170 Ga0163162_10320102 3300013306 Bacteria 1684
171 Ga0163162_10613078 3300013306 Bacteria 1214
172 Ga0157375_10005624 3300013308 Bacteria 10912
173 Ga0163163_10023043 3300014325 Bacteria 5904
174 Ga0163163_10028033 3300014325 Bacteria 5403
175 Ga0163163_10040958 3300014325 Bacteria 4527
176 Ga0163163_10129753 3300014325 Unclassified 2561
177 Ga0163163_10221712 3300014325 Bacteria 1940
178 Ga0157380_10000349 3300014326 Bacteria 27635
179 Ga0157379_10010606 3300014968 Bacteria 8032
180 Ga0157379_10303057 3300014968 Bacteria 1456
181 Ga0157376_10028062 3300014969 Unclassified 4470
182 Ga0163161_10060603 3300017792 Bacteria 2755
183 Ga0163161_10247349 3300017792 Unclassified 1389
184 Ga0213876_10000104 3300021384 Bacteria 93860
185 Ga0213876_10000577 3300021384 Bacteria 27304
186 Ga0213876_10023223 3300021384 Bacteria 3276
187 Ga0207672_1000315 3300025223 Bacteria 6488
188 Ga0207697_10018857 3300025315 Bacteria 2827
189 Ga0207653_10000180 3300025885 Bacteria 44353
190 Ga0207642_10037670 3300025899 Unclassified 2086
191 Ga0207710_10000004 3300025900 Bacteria 846540
192 Ga0207710_10002291 3300025900 Bacteria 8955
193 Ga0207710_10085090 3300025900 Bacteria 1472
194 Ga0207685_10000021 3300025905 Bacteria 131248
195 Ga0207643_10033896 3300025908 Bacteria 2858
196 Ga0207643_10066754 3300025908 Bacteria 2064
197 Ga0207643_10151161 3300025908 Bacteria 1392
198 Ga0207684_10000171 3300025910 Bacteria 107398
199 Ga0207684_10022712 3300025910 Bacteria 5355
200 Ga0207684_10085309 3300025910 Bacteria 2690
201 Ga0207684_10192030 3300025910 Unclassified 1761
202 Ga0207707_10000030 3300025912 Bacteria 160015
203 Ga0207707_10014025 3300025912 Bacteria 6986
204 Ga0207707_10163493 3300025912 Bacteria 1946
205 Ga0207660_10000376 3300025917 Bacteria 29145
206 Ga0207662_10019253 3300025918 Bacteria 3881
207 Ga0207662_10096781 3300025918 Bacteria 1824
208 Ga0207652_10000086 3300025921 Bacteria 101164
209 Ga0207646_10019481 3300025922 Bacteria 6306
210 Ga0207681_10005479 3300025923 Bacteria 7795
211 Ga0207650_10000304 3300025925 Bacteria 48674
212 Ga0207659_10238039 3300025926 Unclassified 1471
213 Ga0207687_10072771 3300025927 Unclassified 2460
214 Ga0207644_10003135 3300025931 Bacteria 10650
215 Ga0207644_10146080 3300025931 Bacteria 1826
216 Ga0207690_10012623 3300025932 Bacteria 5058
217 Ga0207686_10000213 3300025934 Bacteria 44250
218 Ga0207686_10001463 3300025934 Bacteria 13344
219 Ga0207686_10008445 3300025934 Bacteria 5560
220 Ga0207686_10072427 3300025934 Viruses 2220
221 Ga0207686_10172433 3300025934 Bacteria 1527
222 Ga0207709_10000043 3300025935 Bacteria 248179
223 Ga0207709_10001862 3300025935 Bacteria 14034
224 Ga0207709_10190551 3300025935 Unclassified 1456
225 Ga0207670_10096496 3300025936 Bacteria 2103
226 Ga0207670_10114764 3300025936 Viruses 1947
227 Ga0207669_10404075 3300025937 Bacteria 1071
228 Ga0207665_10000002 3300025939 Bacteria 267895
229 Ga0207665_10013822 3300025939 Bacteria 5308
230 Ga0207691_10007903 3300025940 Bacteria 10245
231 Ga0207711_10035643 3300025941 Bacteria 4219
232 Ga0207711_10053015 3300025941 Bacteria 3478
233 Ga0207711_10200707 3300025941 Unclassified 1820
234 Ga0207689_10001120 3300025942 Bacteria 25840
235 Ga0207689_10016171 3300025942 Bacteria 6319
236 Ga0207689_10101689 3300025942 Bacteria 2361
237 Ga0207689_10221300 3300025942 Bacteria 1564
238 Ga0207679_10107878 3300025945 Unclassified 2191
239 Ga0207667_10439903 3300025949 Bacteria 1326
240 Ga0207651_10001864 3300025960 Bacteria 9854
241 Ga0207651_10056067 3300025960 Bacteria 2710
242 Ga0207712_10000313 3300025961 Bacteria 44454
243 Ga0207712_10015854 3300025961 Unclassified 4869
244 Ga0207668_10011459 3300025972 Bacteria 5388
245 Ga0207703_10000589 3300026035 Bacteria 36985
246 Ga0207703_10124233 3300026035 Bacteria 2219
247 Ga0207639_10051015 3300026041 Bacteria 3144
248 Ga0207678_10392380 3300026067 Unclassified 1201
249 Ga0207708_10009371 3300026075 Bacteria 7248
250 Ga0207708_10244980 3300026075 Bacteria 1443
251 Ga0207708_10407976 3300026075 Bacteria 1125
252 Ga0207641_10122016 3300026088 Unclassified 2327
253 Ga0207648_10006393 3300026089 Bacteria 11710
254 Ga0207648_10331074 3300026089 Bacteria 1370
255 Ga0207676_10184060 3300026095 Bacteria 1832
256 Ga0207676_10336716 3300026095 Unclassified 1390
257 Ga0207676_10362666 3300026095 Bacteria 1343
258 Ga0207674_10000054 3300026116 Bacteria 114198
259 Ga0207675_100003544 3300026118 Bacteria 15224
260 Ga0207675_100006696 3300026118 Bacteria 10900
261 Ga0207698_10317776 3300026142 Bacteria 1457
262 Ga0268264_10014789 3300028381 Bacteria 6410
263 Ga0268264_10078678 3300028381 Unclassified 2812
264 Ga0268264_10163985 3300028381 Bacteria 2005
265 Ga0307408_100149891 3300031548 Bacteria 1840
266 Ga0307405_10226482 3300031731 Bacteria 1375
267 Ga0307405_10279520 3300031731 Bacteria 1256
268 Ga0307406_10020665 3300031901 Bacteria 3881
269 Ga0307406_10107556 3300031901 Bacteria 1913
270 Ga0307407_10175180 3300031903 Bacteria 1417
271 Ga0307412_10268545 3300031911 Unclassified 1334
272 Ga0307416_100121236 3300032002 Bacteria 2331
273 Ga0307416_100723434 3300032002 Bacteria 1086
274 Ga0307414_10085477 3300032004 Bacteria 2324
275 Ga0307411_10086378 3300032005 Bacteria 2176
276 Ga0307411_10200879 3300032005 Bacteria 1531
277 Ga0307415_100001042 3300032126 Bacteria 12862
278 Ga0307415_100237225 3300032126 Bacteria 1473
279 Ga0373951_0005408 3300035091 Bacteria 2968
280 Ga0395905_0186607 3300037471 Bacteria 1946
281 Ga0395905_0632628 3300037471 Unclassified 972
282 Ga0242420_000869 3300038996 Unclassified 3734
283 Ga0242420_017252 3300038996 Unclassified 1263
284 Ga0436365_0748815 3300039437 Bacteria 55323
285 Ga0436365_1195936 3300039437 Bacteria 50732
286 Ga0436365_1904845 3300039437 Bacteria 2928
287 Ga0451576_0021603 3300045051 Bacteria 6993
288 Ga0451576_0097954 3300045051 Bacteria 3050
289 Ga0495664_0086242 3300046477 Bacteria 1886
290 Ga0495632_0069493 3300046519 Bacteria 1695
291 Ga0495663_0000102 3300046525 Bacteria 35062
292 Ga0495598_0000045 3300046537 Bacteria 18787
293 Ga0495621_0048430 3300046539 Bacteria 1513
294 Ga0495672_0093951 3300047320 Unclassified 1641
295 Ga0496102_0010588 3300048905 Bacteria 7943
296 Ga0496102_0397670 3300048905 Bacteria 1296
297 Ga0496104_0069219 3300048907 Bacteria 3354
298 Ga0496106_0002129 3300048909 Bacteria 14798
299 Ga0496106_0127857 3300048909 Unclassified 1991
300 Ga0496106_0165974 3300048909 Unclassified 1748
301 Ga0496108_0065248 3300048911 Bacteria 3069
302 Ga0496108_0277132 3300048911 Bacteria 1460
303 Ga0496112_0061100 3300048915 Unclassified 3714
304 Ga0496112_0322638 3300048915 Bacteria 1489
305 Ga0501290_011840 3300049513 Unclassified 1127
306 Ga0501291_008482 3300049514 Bacteria 1421
307 Ga0501297_004316 3300049520 Unclassified 1450
308 Ga0501298_001763 3300049521 Unclassified 3202
309 Ga0501298_009944 3300049521 Bacteria 1626
310 Ga0501031_0079027 3300049568 Bacteria 2144
311 Ga0501048_0164910 3300049582 Bacteria 1569
312 Ga0501075_0422616 3300049591 Bacteria 1016
313 Ga0501077_0146300 3300049593 Bacteria 1499
314 Ga0501198_000770 3300049649 Bacteria 3986
315 Ga0501198_006951 3300049649 Bacteria 1621
316 Ga0501216_003467 3300049660 Bacteria 2296
317 Ga0501217_027564 3300049661 Bacteria 1379
318 Ga0501223_007116 3300049663 Bacteria 2297
319 Ga0501223_015571 3300049663 Bacteria 1506
320 Ga0501233_008328 3300049668 Unclassified 1995
321 Ga0501243_014329 3300049675 Bacteria 1266
322 Ga0501259_021771 3300049688 Bacteria 1147
323 Ga0501260_002863 3300049689 Bacteria 1518
324 Ga0501225_0008170 3300049705 Bacteria 3010
325 Ga0501229_009600 3300049706 Bacteria 1216
326 Ga0501234_001973 3300049707 Bacteria 3240
327 Ga0501081_0228424 3300049743 Bacteria 1355
328 Ga0501283_002534 3300049779 Bacteria 2374
329 nmdc:mga05p37_121550_c1 3300050507 Bacteria 3207
330 nmdc:mga05p37_335_c1 3300050507 Bacteria 50466
331 nmdc:mga05p37_361740_c1 3300050507 Bacteria 1705
332 nmdc:mga05p37_543992_c1 3300050507 Bacteria 1323
333 nmdc:mga05p37_79710_c1 3300050507 Unclassified 1941
334 nmdc:mga09592_214168_c1 3300050508 Bacteria 1669
335 nmdc:mga09592_84080_c1 3300050508 Unclassified 2713
336 nmdc:mga0qj67_149180_c1 3300050509 Bacteria 1897
337 nmdc:mga0n895_175418_c1 3300050512 Bacteria 2174
338 nmdc:mga0n895_344435_c1 3300050512 Archaea 1509
339 nmdc:mga0n895_87094_c1 3300050512 Bacteria 3120
340 nmdc:mga0rr50_265_c1 3300050513 Bacteria 28369
341 nmdc:mga0rr50_268092_c1 3300050513 Bacteria 1422
342 nmdc:mga0rr50_97358_c1 3300050513 Bacteria 2304
343 nmdc:mga08x19_3_c1 3300050514 Bacteria 654433
344 nmdc:mga0a205_276896_c1 3300050515 Bacteria 1554
345 Ga0501082_0076475 3300060353 Bacteria 2886

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025908 Ga0207643_10151161 Ga0207643_101511612 284
2 3300049649 Ga0501198_006951 Ga0501198_006951_751_1611 286
3 3300005843 Ga0068860_100189048 Ga0068860_1001890482 289
4 3300005467 Ga0070706_100026577 Ga0070706_1000265772 297
5 3300025910 Ga0207684_10022712 Ga0207684_100227121 297
6 3300005334 Ga0068869_100028107 Ga0068869_1000281072 303
7 3300006852 Ga0075433_10278991 Ga0075433_102789911 303
8 3300025942 Ga0207689_10016171 Ga0207689_100161714 303
9 3300046477 Ga0495664_0086242 Ga0495664_0086242_280_1194 303
10 3300005615 Ga0070702_100077014 Ga0070702_1000770142 304
11 3300031731 Ga0307405_10226482 Ga0307405_102264822 304
12 3300031901 Ga0307406_10107556 Ga0307406_101075562 304
13 3300031903 Ga0307407_10175180 Ga0307407_101751801 304
14 3300049513 Ga0501290_011840 Ga0501290_011840_10_927 304
15 3300049591 Ga0501075_0422616 Ga0501075_0422616_40_957 305
16 3300050512 nmdc:mga0n895_344435_c1 nmdc:mga0n895_344435_c1_247_1164 305
17 3300006871 Ga0075434_100318167 Ga0075434_1003181672 306
18 3300031731 Ga0307405_10279520 Ga0307405_102795201 306
19 3300031901 Ga0307406_10020665 Ga0307406_100206651 306
20 3300032002 Ga0307416_100121236 Ga0307416_1001212362 306
21 3300032126 Ga0307415_100001042 Ga0307415_10000104211 306
22 3300048909 Ga0496106_0127857 Ga0496106_0127857_763_1683 306
23 3300037471 Ga0395905_0186607 Ga0395905_0186607_391_1320 308
24 3300037471 Ga0395905_0632628 Ga0395905_0632628_19_948 308
25 3300039437 Ga0436365_1904845 Ga0436365_1904845_212_1141 308
26 3300046519 Ga0495632_0069493 Ga0495632_0069493_698_1627 308
27 3300049593 Ga0501077_0146300 Ga0501077_0146300_111_1052 308
28 3300049688 Ga0501259_021771 Ga0501259_021771_201_1130 308
29 3300005546 Ga0070696_100154526 Ga0070696_1001545261 311
30 3300009177 Ga0105248_10081124 Ga0105248_100811244 312
31 3300025941 Ga0207711_10035643 Ga0207711_100356434 312
32 3300026142 Ga0207698_10317776 Ga0207698_103177762 312
33 3300049743 Ga0501081_0228424 Ga0501081_0228424_79_1068 317
34 3300045051 Ga0451576_0021603 Ga0451576_0021603_2895_3908 323
35 3300005295 Ga0065707_10120093 Ga0065707_101200931 324
36 3300005328 Ga0070676_10166499 Ga0070676_101664991 324
37 3300005340 Ga0070689_100116122 Ga0070689_1001161222 324
38 3300005354 Ga0070675_100081464 Ga0070675_1000814643 324
39 3300005364 Ga0070673_100025917 Ga0070673_1000259174 324
40 3300005365 Ga0070688_100066865 Ga0070688_1000668653 324
41 3300005367 Ga0070667_100168627 Ga0070667_1001686272 324
42 3300005438 Ga0070701_10136850 Ga0070701_101368502 324
43 3300005459 Ga0068867_100049378 Ga0068867_1000493783 324
44 3300005466 Ga0070685_10008896 Ga0070685_100088962 324
45 3300005468 Ga0070707_100264792 Ga0070707_1002647921 324
46 3300005539 Ga0068853_100483808 Ga0068853_1004838081 324
47 3300005543 Ga0070672_100052623 Ga0070672_1000526233 324
48 3300005564 Ga0070664_100332989 Ga0070664_1003329892 324
49 3300005617 Ga0068859_100448513 Ga0068859_1004485131 324
50 3300005618 Ga0068864_100035605 Ga0068864_1000356055 324
51 3300005840 Ga0068870_10083395 Ga0068870_100833952 324
52 3300005841 Ga0068863_100198632 Ga0068863_1001986322 324
53 3300005842 Ga0068858_100174618 Ga0068858_1001746182 324
54 3300006871 Ga0075434_100019153 Ga0075434_1000191533 324
55 3300006881 Ga0068865_100077498 Ga0068865_1000774982 324
56 3300006931 Ga0097620_100448491 Ga0097620_1004484911 324
57 3300009011 Ga0105251_10045850 Ga0105251_100458502 324
58 3300009148 Ga0105243_10002722 Ga0105243_1000272211 324
59 3300009148 Ga0105243_10030928 Ga0105243_100309286 324
60 3300009176 Ga0105242_10000507 Ga0105242_100005073 324
61 3300009176 Ga0105242_10020232 Ga0105242_100202326 324
62 3300009177 Ga0105248_10435129 Ga0105248_104351291 324
63 3300011119 Ga0105246_10030376 Ga0105246_100303763 324
64 3300013296 Ga0157374_10070109 Ga0157374_100701093 324
65 3300013297 Ga0157378_10000067 Ga0157378_1000006711 324
66 3300013308 Ga0157375_10005624 Ga0157375_1000562411 324
67 3300014325 Ga0163163_10129753 Ga0163163_101297532 324
68 3300014325 Ga0163163_10221712 Ga0163163_102217123 324
69 3300014968 Ga0157379_10303057 Ga0157379_103030572 324
70 3300014969 Ga0157376_10028062 Ga0157376_100280623 324
71 3300025315 Ga0207697_10018857 Ga0207697_100188573 324
72 3300025908 Ga0207643_10033896 Ga0207643_100338964 324
73 3300025908 Ga0207643_10066754 Ga0207643_100667543 324
74 3300025918 Ga0207662_10096781 Ga0207662_100967812 324
75 3300025927 Ga0207687_10072771 Ga0207687_100727712 324
76 3300025934 Ga0207686_10008445 Ga0207686_100084452 324
77 3300025934 Ga0207686_10072427 Ga0207686_100724272 324
78 3300025934 Ga0207686_10172433 Ga0207686_101724333 324
79 3300025935 Ga0207709_10001862 Ga0207709_1000186211 324
80 3300025935 Ga0207709_10190551 Ga0207709_101905512 324
81 3300025936 Ga0207670_10096496 Ga0207670_100964963 324
82 3300025936 Ga0207670_10114764 Ga0207670_101147642 324
83 3300025940 Ga0207691_10007903 Ga0207691_1000790310 324
84 3300025942 Ga0207689_10221300 Ga0207689_102213002 324
85 3300026089 Ga0207648_10006393 Ga0207648_1000639314 324
86 3300026095 Ga0207676_10184060 Ga0207676_101840602 324
87 3300026095 Ga0207676_10336716 Ga0207676_103367162 324
88 3300026118 Ga0207675_100003544 Ga0207675_1000035443 324
89 3300032005 Ga0307411_10086378 Ga0307411_100863782 324
90 3300032005 Ga0307411_10200879 Ga0307411_102008792 324
91 3300048905 Ga0496102_0397670 Ga0496102_0397670_261_1238 324
92 3300048909 Ga0496106_0002129 Ga0496106_0002129_10736_11713 324
93 3300048909 Ga0496106_0165974 Ga0496106_0165974_612_1589 324
94 3300048911 Ga0496108_0065248 Ga0496108_0065248_1257_2234 324
95 3300049514 Ga0501291_008482 Ga0501291_008482_354_1331 324
96 3300049520 Ga0501297_004316 Ga0501297_004316_432_1409 324
97 3300049521 Ga0501298_009944 Ga0501298_009944_130_1107 324
98 3300049660 Ga0501216_003467 Ga0501216_003467_1139_2116 324
99 3300049663 Ga0501223_015571 Ga0501223_015571_476_1453 324
100 3300049675 Ga0501243_014329 Ga0501243_014329_110_1087 324
101 3300049689 Ga0501260_002863 Ga0501260_002863_47_1024 324
102 3300049779 Ga0501283_002534 Ga0501283_002534_1223_2200 324
103 3300005354 Ga0070675_100279656 Ga0070675_1002796562 325
104 3300005366 Ga0070659_100001636 Ga0070659_1000016368 325
105 3300005444 Ga0070694_100088863 Ga0070694_1000888632 325
106 3300005458 Ga0070681_10029351 Ga0070681_100293513 325
107 3300005458 Ga0070681_10118817 Ga0070681_101188172 325
108 3300005467 Ga0070706_100000055 Ga0070706_10000005525 325
109 3300005467 Ga0070706_100037418 Ga0070706_1000374184 325
110 3300005468 Ga0070707_100020620 Ga0070707_1000206206 325
111 3300005471 Ga0070698_100004560 Ga0070698_1000045605 325
112 3300005471 Ga0070698_100016325 Ga0070698_1000163259 325
113 3300005530 Ga0070679_100033992 Ga0070679_1000339926 325
114 3300005536 Ga0070697_100070891 Ga0070697_1000708912 325
115 3300005539 Ga0068853_100014025 Ga0068853_1000140256 325
116 3300005563 Ga0068855_100354039 Ga0068855_1003540392 325
117 3300005564 Ga0070664_100003832 Ga0070664_1000038329 325
118 3300005577 Ga0068857_100001668 Ga0068857_10000166813 325
119 3300005617 Ga0068859_100027572 Ga0068859_1000275725 325
120 3300005617 Ga0068859_100054142 Ga0068859_1000541423 325
121 3300005617 Ga0068859_100163627 Ga0068859_1001636273 325
122 3300005718 Ga0068866_10049577 Ga0068866_100495773 325
123 3300005842 Ga0068858_100199925 Ga0068858_1001999251 325
124 3300005842 Ga0068858_100358931 Ga0068858_1003589312 325
125 3300005843 Ga0068860_100033702 Ga0068860_1000337026 325
126 3300005843 Ga0068860_100088695 Ga0068860_1000886954 325
127 3300005843 Ga0068860_100188766 Ga0068860_1001887661 325
128 3300005985 Ga0081539_10002860 Ga0081539_100028609 325
129 3300006173 Ga0070716_100011114 Ga0070716_1000111142 325
130 3300006931 Ga0097620_100027570 Ga0097620_1000275705 325
131 3300006931 Ga0097620_100054143 Ga0097620_1000541434 325
132 3300006931 Ga0097620_100163631 Ga0097620_1001636312 325
133 3300009174 Ga0105241_10028499 Ga0105241_100284993 325
134 3300009174 Ga0105241_10076400 Ga0105241_100764002 325
135 3300009177 Ga0105248_10006595 Ga0105248_1000659513 325
136 3300009553 Ga0105249_10022736 Ga0105249_100227362 325
137 3300010375 Ga0105239_10590676 Ga0105239_105906762 325
138 3300013100 Ga0157373_10004467 Ga0157373_100044675 325
139 3300013297 Ga0157378_10050935 Ga0157378_100509355 325
140 3300013306 Ga0163162_10004188 Ga0163162_100041888 325
141 3300013306 Ga0163162_10091654 Ga0163162_100916544 325
142 3300013306 Ga0163162_10320102 Ga0163162_103201023 325
143 3300013306 Ga0163162_10613078 Ga0163162_106130782 325
144 3300014325 Ga0163163_10028033 Ga0163163_100280336 325
145 3300014325 Ga0163163_10040958 Ga0163163_100409586 325
146 3300014968 Ga0157379_10010606 Ga0157379_100106065 325
147 3300025899 Ga0207642_10037670 Ga0207642_100376703 325
148 3300025900 Ga0207710_10085090 Ga0207710_100850902 325
149 3300025910 Ga0207684_10000171 Ga0207684_1000017125 325
150 3300025912 Ga0207707_10014025 Ga0207707_100140252 325
151 3300025912 Ga0207707_10163493 Ga0207707_101634934 325
152 3300025926 Ga0207659_10238039 Ga0207659_102380391 325
153 3300025932 Ga0207690_10012623 Ga0207690_100126233 325
154 3300025939 Ga0207665_10013822 Ga0207665_100138222 325
155 3300025941 Ga0207711_10053015 Ga0207711_100530152 325
156 3300025945 Ga0207679_10107878 Ga0207679_101078782 325
157 3300025949 Ga0207667_10439903 Ga0207667_104399031 325
158 3300026035 Ga0207703_10124233 Ga0207703_101242331 325
159 3300026041 Ga0207639_10051015 Ga0207639_100510152 325
160 3300026067 Ga0207678_10392380 Ga0207678_103923802 325
161 3300026075 Ga0207708_10244980 Ga0207708_102449802 325
162 3300026075 Ga0207708_10407976 Ga0207708_104079761 325
163 3300026089 Ga0207648_10331074 Ga0207648_103310742 325
164 3300026095 Ga0207676_10362666 Ga0207676_103626662 325
165 3300026116 Ga0207674_10000054 Ga0207674_1000005425 325
166 3300028381 Ga0268264_10014789 Ga0268264_100147896 325
167 3300028381 Ga0268264_10078678 Ga0268264_100786782 325
168 3300028381 Ga0268264_10163985 Ga0268264_101639851 325
169 3300031548 Ga0307408_100149891 Ga0307408_1001498911 325
170 3300031911 Ga0307412_10268545 Ga0307412_102685452 325
171 3300035091 Ga0373951_0005408 Ga0373951_0005408_1965_2945 325
172 3300048911 Ga0496108_0277132 Ga0496108_0277132_131_1111 325
173 3300048915 Ga0496112_0061100 Ga0496112_0061100_979_1959 325
174 3300048915 Ga0496112_0322638 Ga0496112_0322638_184_1164 325
175 3300005336 Ga0070680_100000342 Ga0070680_10000034223 326
176 3300005355 Ga0070671_100004622 Ga0070671_1000046228 326
177 3300005444 Ga0070694_100092931 Ga0070694_1000929312 326
178 3300005458 Ga0070681_10000043 Ga0070681_1000004325 326
179 3300005530 Ga0070679_100000036 Ga0070679_10000003625 326
180 3300005539 Ga0068853_100359464 Ga0068853_1003594641 326
181 3300005614 Ga0068856_100031361 Ga0068856_1000313615 326
182 3300005719 Ga0068861_100016147 Ga0068861_1000161471 326
183 3300005843 Ga0068860_100076654 Ga0068860_1000766542 326
184 3300005985 Ga0081539_10033343 Ga0081539_100333432 326
185 3300006852 Ga0075433_10107475 Ga0075433_101074753 326
186 3300006871 Ga0075434_100282989 Ga0075434_1002829892 326
187 3300007076 Ga0075435_100017182 Ga0075435_1000171826 326
188 3300009147 Ga0114129_10027104 Ga0114129_100271047 326
189 3300009148 Ga0105243_10256169 Ga0105243_102561692 326
190 3300009177 Ga0105248_10456022 Ga0105248_104560222 326
191 3300013297 Ga0157378_10325240 Ga0157378_103252402 326
192 3300013306 Ga0163162_10047180 Ga0163162_100471803 326
193 3300014326 Ga0157380_10000349 Ga0157380_1000034912 326
194 3300025900 Ga0207710_10002291 Ga0207710_100022912 326
195 3300025912 Ga0207707_10000030 Ga0207707_1000003091 326
196 3300025917 Ga0207660_10000376 Ga0207660_1000037619 326
197 3300025921 Ga0207652_10000086 Ga0207652_1000008649 326
198 3300025941 Ga0207711_10200707 Ga0207711_102007071 326
199 3300032002 Ga0307416_100723434 Ga0307416_1007234341 326
200 3300032004 Ga0307414_10085477 Ga0307414_100854771 326
201 3300038996 Ga0242420_017252 Ga0242420_017252_233_1216 326
202 3300048905 Ga0496102_0010588 Ga0496102_0010588_5393_6376 326
203 3300048907 Ga0496104_0069219 Ga0496104_0069219_609_1592 326
204 3300049521 Ga0501298_001763 Ga0501298_001763_617_1600 326
205 3300049649 Ga0501198_000770 Ga0501198_000770_446_1429 326
206 3300049661 Ga0501217_027564 Ga0501217_027564_339_1322 326
207 3300049663 Ga0501223_007116 Ga0501223_007116_57_1040 326
208 3300049668 Ga0501233_008328 Ga0501233_008328_637_1620 326
209 3300049705 Ga0501225_0008170 Ga0501225_0008170_2004_2987 326
210 3300049706 Ga0501229_009600 Ga0501229_009600_61_1044 326
211 3300049707 Ga0501234_001973 Ga0501234_001973_2239_3222 326
212 3300050507 nmdc:mga05p37_121550_c1 nmdc:mga05p37_121550_c1_795_1778 326
213 3300050512 nmdc:mga0n895_87094_c1 nmdc:mga0n895_87094_c1_691_1674 326
214 3300050513 nmdc:mga0rr50_268092_c1 nmdc:mga0rr50_268092_c1_163_1146 326
215 3300050513 nmdc:mga0rr50_97358_c1 nmdc:mga0rr50_97358_c1_402_1388 326
216 3300050515 nmdc:mga0a205_276896_c1 nmdc:mga0a205_276896_c1_514_1497 326
217 3300005330 Ga0070690_100023738 Ga0070690_1000237383 327
218 3300005343 Ga0070687_100133947 Ga0070687_1001339472 327
219 3300005355 Ga0070671_100143527 Ga0070671_1001435272 327
220 3300005438 Ga0070701_10112045 Ga0070701_101120451 327
221 3300005445 Ga0070708_100000361 Ga0070708_10000036130 327
222 3300005467 Ga0070706_100024043 Ga0070706_1000240433 327
223 3300005468 Ga0070707_100002485 Ga0070707_10000248512 327
224 3300005468 Ga0070707_100272814 Ga0070707_1002728142 327
225 3300005471 Ga0070698_100017121 Ga0070698_1000171218 327
226 3300005518 Ga0070699_100015176 Ga0070699_1000151762 327
227 3300005536 Ga0070697_100004262 Ga0070697_1000042628 327
228 3300005844 Ga0068862_100068855 Ga0068862_1000688553 327
229 3300005985 Ga0081539_10000033 Ga0081539_1000003330 327
230 3300005985 Ga0081539_10001274 Ga0081539_1000127431 327
231 3300006847 Ga0075431_100026165 Ga0075431_1000261653 327
232 3300006847 Ga0075431_100027484 Ga0075431_1000274844 327
233 3300006880 Ga0075429_100126941 Ga0075429_1001269412 327
234 3300009147 Ga0114129_10078668 Ga0114129_100786686 327
235 3300009147 Ga0114129_10210158 Ga0114129_102101583 327
236 3300009147 Ga0114129_10249433 Ga0114129_102494332 327
237 3300009147 Ga0114129_10252430 Ga0114129_102524302 327
238 3300009147 Ga0114129_10564365 Ga0114129_105643651 327
239 3300009147 Ga0114129_10797294 Ga0114129_107972941 327
240 3300009148 Ga0105243_10047688 Ga0105243_100476884 327
241 3300009176 Ga0105242_10002537 Ga0105242_1000253714 327
242 3300009177 Ga0105248_10389938 Ga0105248_103899382 327
243 3300013297 Ga0157378_10006655 Ga0157378_100066555 327
244 3300013306 Ga0163162_10056960 Ga0163162_100569605 327
245 3300017792 Ga0163161_10060603 Ga0163161_100606033 327
246 3300021384 Ga0213876_10000104 Ga0213876_1000010450 327
247 3300021384 Ga0213876_10000577 Ga0213876_100005776 327
248 3300021384 Ga0213876_10023223 Ga0213876_100232234 327
249 3300025910 Ga0207684_10192030 Ga0207684_101920302 327
250 3300025918 Ga0207662_10019253 Ga0207662_100192532 327
251 3300025931 Ga0207644_10146080 Ga0207644_101460801 327
252 3300025934 Ga0207686_10001463 Ga0207686_1000146310 327
253 3300025961 Ga0207712_10015854 Ga0207712_100158542 327
254 3300032126 Ga0307415_100237225 Ga0307415_1002372252 327
255 3300039437 Ga0436365_0748815 Ga0436365_0748815_22951_23943 327
256 3300039437 Ga0436365_1195936 Ga0436365_1195936_28891_29883 327
257 3300045051 Ga0451576_0097954 Ga0451576_0097954_1319_2308 327
258 3300049568 Ga0501031_0079027 Ga0501031_0079027_716_1714 327
259 3300049582 Ga0501048_0164910 Ga0501048_0164910_452_1450 327
260 3300050507 nmdc:mga05p37_335_c1 nmdc:mga05p37_335_c1_8784_9776 327
261 3300050507 nmdc:mga05p37_361740_c1 nmdc:mga05p37_361740_c1_329_1318 327
262 3300050507 nmdc:mga05p37_543992_c1 nmdc:mga05p37_543992_c1_246_1247 327
263 3300050507 nmdc:mga05p37_79710_c1 nmdc:mga05p37_79710_c1_68_1057 327
264 3300050508 nmdc:mga09592_84080_c1 nmdc:mga09592_84080_c1_1193_2182 327
265 3300050509 nmdc:mga0qj67_149180_c1 nmdc:mga0qj67_149180_c1_136_1134 327
266 3300050512 nmdc:mga0n895_175418_c1 nmdc:mga0n895_175418_c1_976_1974 327
267 3300060353 Ga0501082_0076475 Ga0501082_0076475_697_1695 327
268 3300005364 Ga0070673_100015044 Ga0070673_1000150442 328
269 3300025960 Ga0207651_10001864 Ga0207651_100018641 328
270 3300005331 Ga0070670_100000413 Ga0070670_1000004133 329
271 3300005340 Ga0070689_100010625 Ga0070689_1000106255 329
272 3300005347 Ga0070668_100010083 Ga0070668_1000100835 329
273 3300005543 Ga0070672_100190290 Ga0070672_1001902902 329
274 3300005841 Ga0068863_100163452 Ga0068863_1001634522 329
275 3300009101 Ga0105247_10062101 Ga0105247_100621014 329
276 3300009147 Ga0114129_10003875 Ga0114129_1000387518 329
277 3300009147 Ga0114129_10327476 Ga0114129_103274761 329
278 3300009553 Ga0105249_10000375 Ga0105249_1000037510 329
279 3300009553 Ga0105249_10309687 Ga0105249_103096872 329
280 3300013297 Ga0157378_10249997 Ga0157378_102499971 329
281 3300013306 Ga0163162_10000162 Ga0163162_1000016234 329
282 3300017792 Ga0163161_10247349 Ga0163161_102473492 329
283 3300025923 Ga0207681_10005479 Ga0207681_100054794 329
284 3300025925 Ga0207650_10000304 Ga0207650_1000030412 329
285 3300025961 Ga0207712_10000313 Ga0207712_1000031335 329
286 3300025972 Ga0207668_10011459 Ga0207668_100114596 329
287 3300026088 Ga0207641_10122016 Ga0207641_101220162 329
288 3300046525 Ga0495663_0000102 Ga0495663_0000102_8645_9646 329
289 3300046537 Ga0495598_0000045 Ga0495598_0000045_4981_5982 329
290 3300046539 Ga0495621_0048430 Ga0495621_0048430_329_1330 329
291 3300005471 Ga0070698_100009470 Ga0070698_1000094706 330
292 3300006880 Ga0075429_100193234 Ga0075429_1001932342 330
293 3300050508 nmdc:mga09592_214168_c1 nmdc:mga09592_214168_c1_336_1370 330
294 3300005295 Ga0065707_10088510 Ga0065707_100885103 331
295 3300005330 Ga0070690_100188938 Ga0070690_1001889382 331
296 3300005334 Ga0068869_100027918 Ga0068869_1000279182 331
297 3300005353 Ga0070669_100243829 Ga0070669_1002438292 331
298 3300005441 Ga0070700_100023717 Ga0070700_1000237172 331
299 3300005467 Ga0070706_100004283 Ga0070706_1000042832 331
300 3300005468 Ga0070707_100347778 Ga0070707_1003477782 331
301 3300005471 Ga0070698_100014091 Ga0070698_1000140915 331
302 3300005518 Ga0070699_100007923 Ga0070699_1000079237 331
303 3300005518 Ga0070699_100021496 Ga0070699_1000214962 331
304 3300005536 Ga0070697_100001825 Ga0070697_1000018259 331
305 3300005544 Ga0070686_100009294 Ga0070686_1000092943 331
306 3300006881 Ga0068865_100209791 Ga0068865_1002097912 331
307 3300006914 Ga0075436_100000015 Ga0075436_10000001514 331
308 3300007076 Ga0075435_100000410 Ga0075435_10000041022 331
309 3300009176 Ga0105242_10000227 Ga0105242_1000022719 331
310 3300013297 Ga0157378_10007638 Ga0157378_100076385 331
311 3300014325 Ga0163163_10023043 Ga0163163_100230437 331
312 3300025885 Ga0207653_10000180 Ga0207653_1000018034 331
313 3300025934 Ga0207686_10000213 Ga0207686_1000021319 331
314 3300025935 Ga0207709_10000043 Ga0207709_1000004319 331
315 3300025937 Ga0207669_10404075 Ga0207669_104040751 331
316 3300025942 Ga0207689_10001120 Ga0207689_1000112018 331
317 3300025942 Ga0207689_10101689 Ga0207689_101016892 331
318 3300026075 Ga0207708_10009371 Ga0207708_1000937110 331
319 3300047320 Ga0495672_0093951 Ga0495672_0093951_515_1531 331
320 3300050513 nmdc:mga0rr50_265_c1 nmdc:mga0rr50_265_c1_10117_11136 331
321 3300050514 nmdc:mga08x19_3_c1 nmdc:mga08x19_3_c1_11356_12375 331
322 3300005364 Ga0070673_100187920 Ga0070673_1001879202 332
323 3300005536 Ga0070697_100063716 Ga0070697_1000637162 332
324 3300005615 Ga0070702_100147748 Ga0070702_1001477482 332
325 3300006163 Ga0070715_10000019 Ga0070715_1000001977 332
326 3300006173 Ga0070716_100000001 Ga0070716_100000001230 332
327 3300010375 Ga0105239_10047024 Ga0105239_100470243 332
328 3300013297 Ga0157378_10113153 Ga0157378_101131532 332
329 3300013306 Ga0163162_10001341 Ga0163162_100013417 332
330 3300025905 Ga0207685_10000021 Ga0207685_1000002143 332
331 3300025939 Ga0207665_10000002 Ga0207665_10000002107 332
332 3300025960 Ga0207651_10056067 Ga0207651_100560672 332
333 3300026118 Ga0207675_100006696 Ga0207675_1000066962 332
334 3300038996 Ga0242420_000869 Ga0242420_000869_2645_3664 332
335 3300005468 Ga0070707_100045074 Ga0070707_1000450741 335
336 3300025910 Ga0207684_10085309 Ga0207684_100853091 335
337 3300025922 Ga0207646_10019481 Ga0207646_100194817 335
338 3300002074 JGI24748J21848_1000002 JGI24748J21848_100000215 338
339 3300002239 JGI24034J26672_10000004 JGI24034J26672_10000004357 338
340 3300005842 Ga0068858_100002375 Ga0068858_10000237510 338
341 3300009101 Ga0105247_10000005 Ga0105247_10000005347 338
342 3300025223 Ga0207672_1000315 Ga0207672_10003153 338
343 3300025900 Ga0207710_10000004 Ga0207710_10000004345 338
344 3300025931 Ga0207644_10003135 Ga0207644_100031352 338
345 3300026035 Ga0207703_10000589 Ga0207703_1000058927 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

5

217

0.98

PF03450

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain

224

327

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dqx-assembly1.cif.gz_E crystal structure of xanthine dehydrogenase family protein 0.9061 1 333
1ffu-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor 0.9021 1 334
1ffv-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9007 1 334
7dqx-assembly1.cif.gz_B crystal structure of xanthine dehydrogenase family protein 0.8953 1 333
1t3q-assembly1.cif.gz_F crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 0.8883 1 334
ID Description Score Start End Superfamily
1ffuF01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9103 1 54 3.30.43.10
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9078 60 214 3.30.465.10
4zohB03 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.9002 220 335 3.30.390.50
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9002 60 214 3.30.465.10
af_P77324_1_53_3.30.43.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.8997 3 55 3.30.43.10
ID Description Score Start End GO Terms
AF-A0A1F2QS64-F1-model_v4 CO dehydrogenase flavoprotein C-terminal domain-containing protein 0.9304 186 335
AF-A0A2W0B037-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9261 1 98 GO:0016491
GO:0071949
AF-A0A7V2P6P1-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.922 3 117 GO:0016491
GO:0071949
AF-A0A1V4RR24-F1-model_v4 Molybdopterin dehydrogenase 0.9215 1 337 GO:0016491
GO:0071949
AF-A0A6A7LWW5-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9199 3 117 GO:0016491
GO:0071949

Feature Viewer

pLDDT pTM Quality
77.17 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map