F416329
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 345 | 178 | 345 | 328 |
Family's Representative Sequence
| Representative Sequence | 3300006847|Ga0075431_100026165|Ga0075431_1000261653 |
| Length | 332 |
| Sequence | MLRLPRFSYHEPTTVAEAVRLYAEAAPNVAYVAGGTDLYPNMKRRQQTPAVVVALHRIPELRTISGTPETGMTIGACVTLTELAAHEGIRARYSAVSHAAHVVSTPILRNMGTIGGNLLLDTRCNYYDQNYEWRKAINFCMKRDGEICWVAPSSPRCWAVQSSDGVPVAVALGAEVTLTSVRGMRRLPAAGLYRNDGIQYLEKAPDELLVAYHLPSVANGGWRATYRKLRRRDAFDFPVLGVAARVDFARDGSVSSARIVLGAVASYPQEIPEAAQAIVGSRLDETAIGAAADAAYRPAKPMDNTDFTLAWRKEMVRVHVQRALQDIRAQSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 51 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 82 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 127 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 128 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 129 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 130 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 131 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 132 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 133 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 134 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 135 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 136 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 137 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 138 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 139 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 146 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 147 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 148 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 150 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 151 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 152 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 153 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 154 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 159 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 160 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 161 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 162 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 163 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 164 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 165 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 166 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 167 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 168 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 169 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 171 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.9 |
| Rhizosphere | 95.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1000002 | 3300002074 | Bacteria | 426946 |
| 2 | JGI24034J26672_10000004 | 3300002239 | Bacteria | 426946 |
| 3 | Ga0065707_10088510 | 3300005295 | Unclassified | 4626 |
| 4 | Ga0065707_10120093 | 3300005295 | Bacteria | 2143 |
| 5 | Ga0070676_10166499 | 3300005328 | Unclassified | 1422 |
| 6 | Ga0070690_100023738 | 3300005330 | Bacteria | 3764 |
| 7 | Ga0070690_100188938 | 3300005330 | Bacteria | 1427 |
| 8 | Ga0070670_100000413 | 3300005331 | Bacteria | 35230 |
| 9 | Ga0068869_100027918 | 3300005334 | Bacteria | 3939 |
| 10 | Ga0068869_100028107 | 3300005334 | Unclassified | 3926 |
| 11 | Ga0070680_100000342 | 3300005336 | Bacteria | 31293 |
| 12 | Ga0070689_100010625 | 3300005340 | Bacteria | 6565 |
| 13 | Ga0070689_100116122 | 3300005340 | Bacteria | 2134 |
| 14 | Ga0070687_100133947 | 3300005343 | Unclassified | 1434 |
| 15 | Ga0070668_100010083 | 3300005347 | Bacteria | 7004 |
| 16 | Ga0070669_100243829 | 3300005353 | Bacteria | 1429 |
| 17 | Ga0070675_100081464 | 3300005354 | Bacteria | 2699 |
| 18 | Ga0070675_100279656 | 3300005354 | Unclassified | 1466 |
| 19 | Ga0070671_100004622 | 3300005355 | Bacteria | 10915 |
| 20 | Ga0070671_100143527 | 3300005355 | Bacteria | 2015 |
| 21 | Ga0070673_100015044 | 3300005364 | Bacteria | 5416 |
| 22 | Ga0070673_100025917 | 3300005364 | Bacteria | 4323 |
| 23 | Ga0070673_100187920 | 3300005364 | Bacteria | 1772 |
| 24 | Ga0070688_100066865 | 3300005365 | Bacteria | 2288 |
| 25 | Ga0070659_100001636 | 3300005366 | Bacteria | 16138 |
| 26 | Ga0070667_100168627 | 3300005367 | Unclassified | 1931 |
| 27 | Ga0070701_10112045 | 3300005438 | Bacteria | 1526 |
| 28 | Ga0070701_10136850 | 3300005438 | Unclassified | 1397 |
| 29 | Ga0070700_100023717 | 3300005441 | Bacteria | 3592 |
| 30 | Ga0070694_100088863 | 3300005444 | Unclassified | 2164 |
| 31 | Ga0070694_100092931 | 3300005444 | Unclassified | 2120 |
| 32 | Ga0070708_100000361 | 3300005445 | Bacteria | 34379 |
| 33 | Ga0070681_10000043 | 3300005458 | Bacteria | 86436 |
| 34 | Ga0070681_10029351 | 3300005458 | Bacteria | 5523 |
| 35 | Ga0070681_10118817 | 3300005458 | Bacteria | 2580 |
| 36 | Ga0068867_100049378 | 3300005459 | Unclassified | 3097 |
| 37 | Ga0070685_10008896 | 3300005466 | Bacteria | 5177 |
| 38 | Ga0070706_100000055 | 3300005467 | Bacteria | 137675 |
| 39 | Ga0070706_100004283 | 3300005467 | Bacteria | 13831 |
| 40 | Ga0070706_100024043 | 3300005467 | Bacteria | 5610 |
| 41 | Ga0070706_100026577 | 3300005467 | Bacteria | 5326 |
| 42 | Ga0070706_100037418 | 3300005467 | Unclassified | 4482 |
| 43 | Ga0070707_100002485 | 3300005468 | Bacteria | 17581 |
| 44 | Ga0070707_100020620 | 3300005468 | Bacteria | 6220 |
| 45 | Ga0070707_100045074 | 3300005468 | Unclassified | 4221 |
| 46 | Ga0070707_100264792 | 3300005468 | Bacteria | 1672 |
| 47 | Ga0070707_100272814 | 3300005468 | Unclassified | 1644 |
| 48 | Ga0070707_100347778 | 3300005468 | Bacteria | 1440 |
| 49 | Ga0070698_100004560 | 3300005471 | Bacteria | 15214 |
| 50 | Ga0070698_100009470 | 3300005471 | Bacteria | 10435 |
| 51 | Ga0070698_100014091 | 3300005471 | Bacteria | 8454 |
| 52 | Ga0070698_100016325 | 3300005471 | Bacteria | 7840 |
| 53 | Ga0070698_100017121 | 3300005471 | Bacteria | 7640 |
| 54 | Ga0070699_100007923 | 3300005518 | Bacteria | 9226 |
| 55 | Ga0070699_100015176 | 3300005518 | Bacteria | 6619 |
| 56 | Ga0070699_100021496 | 3300005518 | Bacteria | 5565 |
| 57 | Ga0070679_100000036 | 3300005530 | Bacteria | 101158 |
| 58 | Ga0070679_100033992 | 3300005530 | Bacteria | 5051 |
| 59 | Ga0070697_100001825 | 3300005536 | Bacteria | 16277 |
| 60 | Ga0070697_100004262 | 3300005536 | Bacteria | 10964 |
| 61 | Ga0070697_100063716 | 3300005536 | Bacteria | 3010 |
| 62 | Ga0070697_100070891 | 3300005536 | Unclassified | 2858 |
| 63 | Ga0068853_100014025 | 3300005539 | Bacteria | 6558 |
| 64 | Ga0068853_100359464 | 3300005539 | Unclassified | 1356 |
| 65 | Ga0068853_100483808 | 3300005539 | Unclassified | 1167 |
| 66 | Ga0070672_100052623 | 3300005543 | Bacteria | 3179 |
| 67 | Ga0070672_100190290 | 3300005543 | Bacteria | 1713 |
| 68 | Ga0070686_100009294 | 3300005544 | Bacteria | 5519 |
| 69 | Ga0070696_100154526 | 3300005546 | Unclassified | 1686 |
| 70 | Ga0068855_100354039 | 3300005563 | Bacteria | 1617 |
| 71 | Ga0070664_100003832 | 3300005564 | Bacteria | 12142 |
| 72 | Ga0070664_100332989 | 3300005564 | Unclassified | 1378 |
| 73 | Ga0068857_100001668 | 3300005577 | Bacteria | 17826 |
| 74 | Ga0068856_100031361 | 3300005614 | Bacteria | 5199 |
| 75 | Ga0070702_100077014 | 3300005615 | Bacteria | 1987 |
| 76 | Ga0070702_100147748 | 3300005615 | Bacteria | 1505 |
| 77 | Ga0068859_100027572 | 3300005617 | Bacteria | 5697 |
| 78 | Ga0068859_100054142 | 3300005617 | Bacteria | 4035 |
| 79 | Ga0068859_100163627 | 3300005617 | Bacteria | 2304 |
| 80 | Ga0068859_100448513 | 3300005617 | Unclassified | 1386 |
| 81 | Ga0068864_100035605 | 3300005618 | Bacteria | 4238 |
| 82 | Ga0068866_10049577 | 3300005718 | Unclassified | 2128 |
| 83 | Ga0068861_100016147 | 3300005719 | Bacteria | 5276 |
| 84 | Ga0068870_10083395 | 3300005840 | Unclassified | 1772 |
| 85 | Ga0068863_100163452 | 3300005841 | Unclassified | 2134 |
| 86 | Ga0068863_100198632 | 3300005841 | Viruses | 1928 |
| 87 | Ga0068858_100002375 | 3300005842 | Bacteria | 19040 |
| 88 | Ga0068858_100174618 | 3300005842 | Bacteria | 2027 |
| 89 | Ga0068858_100199925 | 3300005842 | Bacteria | 1890 |
| 90 | Ga0068858_100358931 | 3300005842 | Bacteria | 1397 |
| 91 | Ga0068860_100033702 | 3300005843 | Bacteria | 4913 |
| 92 | Ga0068860_100076654 | 3300005843 | Bacteria | 3180 |
| 93 | Ga0068860_100088695 | 3300005843 | Bacteria | 2944 |
| 94 | Ga0068860_100188766 | 3300005843 | Bacteria | 1994 |
| 95 | Ga0068860_100189048 | 3300005843 | Bacteria | 1992 |
| 96 | Ga0068862_100068855 | 3300005844 | Bacteria | 3054 |
| 97 | Ga0081539_10000033 | 3300005985 | Bacteria | 309306 |
| 98 | Ga0081539_10001274 | 3300005985 | Bacteria | 44371 |
| 99 | Ga0081539_10002860 | 3300005985 | Bacteria | 22952 |
| 100 | Ga0081539_10033343 | 3300005985 | Bacteria | 3138 |
| 101 | Ga0070715_10000019 | 3300006163 | Bacteria | 122990 |
| 102 | Ga0070716_100000001 | 3300006173 | Bacteria | 400668 |
| 103 | Ga0070716_100011114 | 3300006173 | Bacteria | 4531 |
| 104 | Ga0075431_100026165 | 3300006847 | Bacteria | 5985 |
| 105 | Ga0075431_100027484 | 3300006847 | Bacteria | 5838 |
| 106 | Ga0075433_10107475 | 3300006852 | Bacteria | 2474 |
| 107 | Ga0075433_10278991 | 3300006852 | Unclassified | 1480 |
| 108 | Ga0075434_100019153 | 3300006871 | Bacteria | 6619 |
| 109 | Ga0075434_100282989 | 3300006871 | Bacteria | 1678 |
| 110 | Ga0075434_100318167 | 3300006871 | Unclassified | 1577 |
| 111 | Ga0075429_100126941 | 3300006880 | Bacteria | 2231 |
| 112 | Ga0075429_100193234 | 3300006880 | Bacteria | 1783 |
| 113 | Ga0068865_100077498 | 3300006881 | Unclassified | 2376 |
| 114 | Ga0068865_100209791 | 3300006881 | Bacteria | 1517 |
| 115 | Ga0075436_100000015 | 3300006914 | Bacteria | 174598 |
| 116 | Ga0097620_100027570 | 3300006931 | Bacteria | 5697 |
| 117 | Ga0097620_100054143 | 3300006931 | Bacteria | 4035 |
| 118 | Ga0097620_100163631 | 3300006931 | Bacteria | 2304 |
| 119 | Ga0097620_100448491 | 3300006931 | Unclassified | 1386 |
| 120 | Ga0075435_100000410 | 3300007076 | Bacteria | 26372 |
| 121 | Ga0075435_100017182 | 3300007076 | Bacteria | 5469 |
| 122 | Ga0105251_10045850 | 3300009011 | Bacteria | 2106 |
| 123 | Ga0105247_10000005 | 3300009101 | Bacteria | 426989 |
| 124 | Ga0105247_10062101 | 3300009101 | Unclassified | 2317 |
| 125 | Ga0114129_10003875 | 3300009147 | Bacteria | 21099 |
| 126 | Ga0114129_10027104 | 3300009147 | Bacteria | 8113 |
| 127 | Ga0114129_10078668 | 3300009147 | Unclassified | 4586 |
| 128 | Ga0114129_10210158 | 3300009147 | Bacteria | 2631 |
| 129 | Ga0114129_10249433 | 3300009147 | Bacteria | 2384 |
| 130 | Ga0114129_10252430 | 3300009147 | Unclassified | 2367 |
| 131 | Ga0114129_10327476 | 3300009147 | Unclassified | 2035 |
| 132 | Ga0114129_10564365 | 3300009147 | Bacteria | 1479 |
| 133 | Ga0114129_10797294 | 3300009147 | Bacteria | 1205 |
| 134 | Ga0105243_10002722 | 3300009148 | Bacteria | 14692 |
| 135 | Ga0105243_10030928 | 3300009148 | Bacteria | 4125 |
| 136 | Ga0105243_10047688 | 3300009148 | Unclassified | 3374 |
| 137 | Ga0105243_10256169 | 3300009148 | Unclassified | 1565 |
| 138 | Ga0105241_10028499 | 3300009174 | Bacteria | 4162 |
| 139 | Ga0105241_10076400 | 3300009174 | Bacteria | 2612 |
| 140 | Ga0105242_10000227 | 3300009176 | Bacteria | 44246 |
| 141 | Ga0105242_10000507 | 3300009176 | Bacteria | 30734 |
| 142 | Ga0105242_10002537 | 3300009176 | Bacteria | 14333 |
| 143 | Ga0105242_10020232 | 3300009176 | Bacteria | 5218 |
| 144 | Ga0105248_10006595 | 3300009177 | Bacteria | 12722 |
| 145 | Ga0105248_10081124 | 3300009177 | Unclassified | 3646 |
| 146 | Ga0105248_10389938 | 3300009177 | Bacteria | 1568 |
| 147 | Ga0105248_10435129 | 3300009177 | Unclassified | 1477 |
| 148 | Ga0105248_10456022 | 3300009177 | Bacteria | 1441 |
| 149 | Ga0105249_10000375 | 3300009553 | Bacteria | 44344 |
| 150 | Ga0105249_10022736 | 3300009553 | Bacteria | 5620 |
| 151 | Ga0105249_10309687 | 3300009553 | Bacteria | 1587 |
| 152 | Ga0105239_10047024 | 3300010375 | Bacteria | 4728 |
| 153 | Ga0105239_10590676 | 3300010375 | Unclassified | 1266 |
| 154 | Ga0105246_10030376 | 3300011119 | Bacteria | 3568 |
| 155 | Ga0157373_10004467 | 3300013100 | Bacteria | 10527 |
| 156 | Ga0157374_10070109 | 3300013296 | Unclassified | 3302 |
| 157 | Ga0157378_10000067 | 3300013297 | Bacteria | 92867 |
| 158 | Ga0157378_10006655 | 3300013297 | Bacteria | 10097 |
| 159 | Ga0157378_10007638 | 3300013297 | Bacteria | 9438 |
| 160 | Ga0157378_10050935 | 3300013297 | Unclassified | 3684 |
| 161 | Ga0157378_10113153 | 3300013297 | Bacteria | 2491 |
| 162 | Ga0157378_10249997 | 3300013297 | Unclassified | 1697 |
| 163 | Ga0157378_10325240 | 3300013297 | Unclassified | 1495 |
| 164 | Ga0163162_10000162 | 3300013306 | Bacteria | 61820 |
| 165 | Ga0163162_10001341 | 3300013306 | Bacteria | 22917 |
| 166 | Ga0163162_10004188 | 3300013306 | Bacteria | 13864 |
| 167 | Ga0163162_10047180 | 3300013306 | Bacteria | 4317 |
| 168 | Ga0163162_10056960 | 3300013306 | Unclassified | 3936 |
| 169 | Ga0163162_10091654 | 3300013306 | Bacteria | 3122 |
| 170 | Ga0163162_10320102 | 3300013306 | Bacteria | 1684 |
| 171 | Ga0163162_10613078 | 3300013306 | Bacteria | 1214 |
| 172 | Ga0157375_10005624 | 3300013308 | Bacteria | 10912 |
| 173 | Ga0163163_10023043 | 3300014325 | Bacteria | 5904 |
| 174 | Ga0163163_10028033 | 3300014325 | Bacteria | 5403 |
| 175 | Ga0163163_10040958 | 3300014325 | Bacteria | 4527 |
| 176 | Ga0163163_10129753 | 3300014325 | Unclassified | 2561 |
| 177 | Ga0163163_10221712 | 3300014325 | Bacteria | 1940 |
| 178 | Ga0157380_10000349 | 3300014326 | Bacteria | 27635 |
| 179 | Ga0157379_10010606 | 3300014968 | Bacteria | 8032 |
| 180 | Ga0157379_10303057 | 3300014968 | Bacteria | 1456 |
| 181 | Ga0157376_10028062 | 3300014969 | Unclassified | 4470 |
| 182 | Ga0163161_10060603 | 3300017792 | Bacteria | 2755 |
| 183 | Ga0163161_10247349 | 3300017792 | Unclassified | 1389 |
| 184 | Ga0213876_10000104 | 3300021384 | Bacteria | 93860 |
| 185 | Ga0213876_10000577 | 3300021384 | Bacteria | 27304 |
| 186 | Ga0213876_10023223 | 3300021384 | Bacteria | 3276 |
| 187 | Ga0207672_1000315 | 3300025223 | Bacteria | 6488 |
| 188 | Ga0207697_10018857 | 3300025315 | Bacteria | 2827 |
| 189 | Ga0207653_10000180 | 3300025885 | Bacteria | 44353 |
| 190 | Ga0207642_10037670 | 3300025899 | Unclassified | 2086 |
| 191 | Ga0207710_10000004 | 3300025900 | Bacteria | 846540 |
| 192 | Ga0207710_10002291 | 3300025900 | Bacteria | 8955 |
| 193 | Ga0207710_10085090 | 3300025900 | Bacteria | 1472 |
| 194 | Ga0207685_10000021 | 3300025905 | Bacteria | 131248 |
| 195 | Ga0207643_10033896 | 3300025908 | Bacteria | 2858 |
| 196 | Ga0207643_10066754 | 3300025908 | Bacteria | 2064 |
| 197 | Ga0207643_10151161 | 3300025908 | Bacteria | 1392 |
| 198 | Ga0207684_10000171 | 3300025910 | Bacteria | 107398 |
| 199 | Ga0207684_10022712 | 3300025910 | Bacteria | 5355 |
| 200 | Ga0207684_10085309 | 3300025910 | Bacteria | 2690 |
| 201 | Ga0207684_10192030 | 3300025910 | Unclassified | 1761 |
| 202 | Ga0207707_10000030 | 3300025912 | Bacteria | 160015 |
| 203 | Ga0207707_10014025 | 3300025912 | Bacteria | 6986 |
| 204 | Ga0207707_10163493 | 3300025912 | Bacteria | 1946 |
| 205 | Ga0207660_10000376 | 3300025917 | Bacteria | 29145 |
| 206 | Ga0207662_10019253 | 3300025918 | Bacteria | 3881 |
| 207 | Ga0207662_10096781 | 3300025918 | Bacteria | 1824 |
| 208 | Ga0207652_10000086 | 3300025921 | Bacteria | 101164 |
| 209 | Ga0207646_10019481 | 3300025922 | Bacteria | 6306 |
| 210 | Ga0207681_10005479 | 3300025923 | Bacteria | 7795 |
| 211 | Ga0207650_10000304 | 3300025925 | Bacteria | 48674 |
| 212 | Ga0207659_10238039 | 3300025926 | Unclassified | 1471 |
| 213 | Ga0207687_10072771 | 3300025927 | Unclassified | 2460 |
| 214 | Ga0207644_10003135 | 3300025931 | Bacteria | 10650 |
| 215 | Ga0207644_10146080 | 3300025931 | Bacteria | 1826 |
| 216 | Ga0207690_10012623 | 3300025932 | Bacteria | 5058 |
| 217 | Ga0207686_10000213 | 3300025934 | Bacteria | 44250 |
| 218 | Ga0207686_10001463 | 3300025934 | Bacteria | 13344 |
| 219 | Ga0207686_10008445 | 3300025934 | Bacteria | 5560 |
| 220 | Ga0207686_10072427 | 3300025934 | Viruses | 2220 |
| 221 | Ga0207686_10172433 | 3300025934 | Bacteria | 1527 |
| 222 | Ga0207709_10000043 | 3300025935 | Bacteria | 248179 |
| 223 | Ga0207709_10001862 | 3300025935 | Bacteria | 14034 |
| 224 | Ga0207709_10190551 | 3300025935 | Unclassified | 1456 |
| 225 | Ga0207670_10096496 | 3300025936 | Bacteria | 2103 |
| 226 | Ga0207670_10114764 | 3300025936 | Viruses | 1947 |
| 227 | Ga0207669_10404075 | 3300025937 | Bacteria | 1071 |
| 228 | Ga0207665_10000002 | 3300025939 | Bacteria | 267895 |
| 229 | Ga0207665_10013822 | 3300025939 | Bacteria | 5308 |
| 230 | Ga0207691_10007903 | 3300025940 | Bacteria | 10245 |
| 231 | Ga0207711_10035643 | 3300025941 | Bacteria | 4219 |
| 232 | Ga0207711_10053015 | 3300025941 | Bacteria | 3478 |
| 233 | Ga0207711_10200707 | 3300025941 | Unclassified | 1820 |
| 234 | Ga0207689_10001120 | 3300025942 | Bacteria | 25840 |
| 235 | Ga0207689_10016171 | 3300025942 | Bacteria | 6319 |
| 236 | Ga0207689_10101689 | 3300025942 | Bacteria | 2361 |
| 237 | Ga0207689_10221300 | 3300025942 | Bacteria | 1564 |
| 238 | Ga0207679_10107878 | 3300025945 | Unclassified | 2191 |
| 239 | Ga0207667_10439903 | 3300025949 | Bacteria | 1326 |
| 240 | Ga0207651_10001864 | 3300025960 | Bacteria | 9854 |
| 241 | Ga0207651_10056067 | 3300025960 | Bacteria | 2710 |
| 242 | Ga0207712_10000313 | 3300025961 | Bacteria | 44454 |
| 243 | Ga0207712_10015854 | 3300025961 | Unclassified | 4869 |
| 244 | Ga0207668_10011459 | 3300025972 | Bacteria | 5388 |
| 245 | Ga0207703_10000589 | 3300026035 | Bacteria | 36985 |
| 246 | Ga0207703_10124233 | 3300026035 | Bacteria | 2219 |
| 247 | Ga0207639_10051015 | 3300026041 | Bacteria | 3144 |
| 248 | Ga0207678_10392380 | 3300026067 | Unclassified | 1201 |
| 249 | Ga0207708_10009371 | 3300026075 | Bacteria | 7248 |
| 250 | Ga0207708_10244980 | 3300026075 | Bacteria | 1443 |
| 251 | Ga0207708_10407976 | 3300026075 | Bacteria | 1125 |
| 252 | Ga0207641_10122016 | 3300026088 | Unclassified | 2327 |
| 253 | Ga0207648_10006393 | 3300026089 | Bacteria | 11710 |
| 254 | Ga0207648_10331074 | 3300026089 | Bacteria | 1370 |
| 255 | Ga0207676_10184060 | 3300026095 | Bacteria | 1832 |
| 256 | Ga0207676_10336716 | 3300026095 | Unclassified | 1390 |
| 257 | Ga0207676_10362666 | 3300026095 | Bacteria | 1343 |
| 258 | Ga0207674_10000054 | 3300026116 | Bacteria | 114198 |
| 259 | Ga0207675_100003544 | 3300026118 | Bacteria | 15224 |
| 260 | Ga0207675_100006696 | 3300026118 | Bacteria | 10900 |
| 261 | Ga0207698_10317776 | 3300026142 | Bacteria | 1457 |
| 262 | Ga0268264_10014789 | 3300028381 | Bacteria | 6410 |
| 263 | Ga0268264_10078678 | 3300028381 | Unclassified | 2812 |
| 264 | Ga0268264_10163985 | 3300028381 | Bacteria | 2005 |
| 265 | Ga0307408_100149891 | 3300031548 | Bacteria | 1840 |
| 266 | Ga0307405_10226482 | 3300031731 | Bacteria | 1375 |
| 267 | Ga0307405_10279520 | 3300031731 | Bacteria | 1256 |
| 268 | Ga0307406_10020665 | 3300031901 | Bacteria | 3881 |
| 269 | Ga0307406_10107556 | 3300031901 | Bacteria | 1913 |
| 270 | Ga0307407_10175180 | 3300031903 | Bacteria | 1417 |
| 271 | Ga0307412_10268545 | 3300031911 | Unclassified | 1334 |
| 272 | Ga0307416_100121236 | 3300032002 | Bacteria | 2331 |
| 273 | Ga0307416_100723434 | 3300032002 | Bacteria | 1086 |
| 274 | Ga0307414_10085477 | 3300032004 | Bacteria | 2324 |
| 275 | Ga0307411_10086378 | 3300032005 | Bacteria | 2176 |
| 276 | Ga0307411_10200879 | 3300032005 | Bacteria | 1531 |
| 277 | Ga0307415_100001042 | 3300032126 | Bacteria | 12862 |
| 278 | Ga0307415_100237225 | 3300032126 | Bacteria | 1473 |
| 279 | Ga0373951_0005408 | 3300035091 | Bacteria | 2968 |
| 280 | Ga0395905_0186607 | 3300037471 | Bacteria | 1946 |
| 281 | Ga0395905_0632628 | 3300037471 | Unclassified | 972 |
| 282 | Ga0242420_000869 | 3300038996 | Unclassified | 3734 |
| 283 | Ga0242420_017252 | 3300038996 | Unclassified | 1263 |
| 284 | Ga0436365_0748815 | 3300039437 | Bacteria | 55323 |
| 285 | Ga0436365_1195936 | 3300039437 | Bacteria | 50732 |
| 286 | Ga0436365_1904845 | 3300039437 | Bacteria | 2928 |
| 287 | Ga0451576_0021603 | 3300045051 | Bacteria | 6993 |
| 288 | Ga0451576_0097954 | 3300045051 | Bacteria | 3050 |
| 289 | Ga0495664_0086242 | 3300046477 | Bacteria | 1886 |
| 290 | Ga0495632_0069493 | 3300046519 | Bacteria | 1695 |
| 291 | Ga0495663_0000102 | 3300046525 | Bacteria | 35062 |
| 292 | Ga0495598_0000045 | 3300046537 | Bacteria | 18787 |
| 293 | Ga0495621_0048430 | 3300046539 | Bacteria | 1513 |
| 294 | Ga0495672_0093951 | 3300047320 | Unclassified | 1641 |
| 295 | Ga0496102_0010588 | 3300048905 | Bacteria | 7943 |
| 296 | Ga0496102_0397670 | 3300048905 | Bacteria | 1296 |
| 297 | Ga0496104_0069219 | 3300048907 | Bacteria | 3354 |
| 298 | Ga0496106_0002129 | 3300048909 | Bacteria | 14798 |
| 299 | Ga0496106_0127857 | 3300048909 | Unclassified | 1991 |
| 300 | Ga0496106_0165974 | 3300048909 | Unclassified | 1748 |
| 301 | Ga0496108_0065248 | 3300048911 | Bacteria | 3069 |
| 302 | Ga0496108_0277132 | 3300048911 | Bacteria | 1460 |
| 303 | Ga0496112_0061100 | 3300048915 | Unclassified | 3714 |
| 304 | Ga0496112_0322638 | 3300048915 | Bacteria | 1489 |
| 305 | Ga0501290_011840 | 3300049513 | Unclassified | 1127 |
| 306 | Ga0501291_008482 | 3300049514 | Bacteria | 1421 |
| 307 | Ga0501297_004316 | 3300049520 | Unclassified | 1450 |
| 308 | Ga0501298_001763 | 3300049521 | Unclassified | 3202 |
| 309 | Ga0501298_009944 | 3300049521 | Bacteria | 1626 |
| 310 | Ga0501031_0079027 | 3300049568 | Bacteria | 2144 |
| 311 | Ga0501048_0164910 | 3300049582 | Bacteria | 1569 |
| 312 | Ga0501075_0422616 | 3300049591 | Bacteria | 1016 |
| 313 | Ga0501077_0146300 | 3300049593 | Bacteria | 1499 |
| 314 | Ga0501198_000770 | 3300049649 | Bacteria | 3986 |
| 315 | Ga0501198_006951 | 3300049649 | Bacteria | 1621 |
| 316 | Ga0501216_003467 | 3300049660 | Bacteria | 2296 |
| 317 | Ga0501217_027564 | 3300049661 | Bacteria | 1379 |
| 318 | Ga0501223_007116 | 3300049663 | Bacteria | 2297 |
| 319 | Ga0501223_015571 | 3300049663 | Bacteria | 1506 |
| 320 | Ga0501233_008328 | 3300049668 | Unclassified | 1995 |
| 321 | Ga0501243_014329 | 3300049675 | Bacteria | 1266 |
| 322 | Ga0501259_021771 | 3300049688 | Bacteria | 1147 |
| 323 | Ga0501260_002863 | 3300049689 | Bacteria | 1518 |
| 324 | Ga0501225_0008170 | 3300049705 | Bacteria | 3010 |
| 325 | Ga0501229_009600 | 3300049706 | Bacteria | 1216 |
| 326 | Ga0501234_001973 | 3300049707 | Bacteria | 3240 |
| 327 | Ga0501081_0228424 | 3300049743 | Bacteria | 1355 |
| 328 | Ga0501283_002534 | 3300049779 | Bacteria | 2374 |
| 329 | nmdc:mga05p37_121550_c1 | 3300050507 | Bacteria | 3207 |
| 330 | nmdc:mga05p37_335_c1 | 3300050507 | Bacteria | 50466 |
| 331 | nmdc:mga05p37_361740_c1 | 3300050507 | Bacteria | 1705 |
| 332 | nmdc:mga05p37_543992_c1 | 3300050507 | Bacteria | 1323 |
| 333 | nmdc:mga05p37_79710_c1 | 3300050507 | Unclassified | 1941 |
| 334 | nmdc:mga09592_214168_c1 | 3300050508 | Bacteria | 1669 |
| 335 | nmdc:mga09592_84080_c1 | 3300050508 | Unclassified | 2713 |
| 336 | nmdc:mga0qj67_149180_c1 | 3300050509 | Bacteria | 1897 |
| 337 | nmdc:mga0n895_175418_c1 | 3300050512 | Bacteria | 2174 |
| 338 | nmdc:mga0n895_344435_c1 | 3300050512 | Archaea | 1509 |
| 339 | nmdc:mga0n895_87094_c1 | 3300050512 | Bacteria | 3120 |
| 340 | nmdc:mga0rr50_265_c1 | 3300050513 | Bacteria | 28369 |
| 341 | nmdc:mga0rr50_268092_c1 | 3300050513 | Bacteria | 1422 |
| 342 | nmdc:mga0rr50_97358_c1 | 3300050513 | Bacteria | 2304 |
| 343 | nmdc:mga08x19_3_c1 | 3300050514 | Bacteria | 654433 |
| 344 | nmdc:mga0a205_276896_c1 | 3300050515 | Bacteria | 1554 |
| 345 | Ga0501082_0076475 | 3300060353 | Bacteria | 2886 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025908 | Ga0207643_10151161 | Ga0207643_101511612 | 284 |
| 2 | 3300049649 | Ga0501198_006951 | Ga0501198_006951_751_1611 | 286 |
| 3 | 3300005843 | Ga0068860_100189048 | Ga0068860_1001890482 | 289 |
| 4 | 3300005467 | Ga0070706_100026577 | Ga0070706_1000265772 | 297 |
| 5 | 3300025910 | Ga0207684_10022712 | Ga0207684_100227121 | 297 |
| 6 | 3300005334 | Ga0068869_100028107 | Ga0068869_1000281072 | 303 |
| 7 | 3300006852 | Ga0075433_10278991 | Ga0075433_102789911 | 303 |
| 8 | 3300025942 | Ga0207689_10016171 | Ga0207689_100161714 | 303 |
| 9 | 3300046477 | Ga0495664_0086242 | Ga0495664_0086242_280_1194 | 303 |
| 10 | 3300005615 | Ga0070702_100077014 | Ga0070702_1000770142 | 304 |
| 11 | 3300031731 | Ga0307405_10226482 | Ga0307405_102264822 | 304 |
| 12 | 3300031901 | Ga0307406_10107556 | Ga0307406_101075562 | 304 |
| 13 | 3300031903 | Ga0307407_10175180 | Ga0307407_101751801 | 304 |
| 14 | 3300049513 | Ga0501290_011840 | Ga0501290_011840_10_927 | 304 |
| 15 | 3300049591 | Ga0501075_0422616 | Ga0501075_0422616_40_957 | 305 |
| 16 | 3300050512 | nmdc:mga0n895_344435_c1 | nmdc:mga0n895_344435_c1_247_1164 | 305 |
| 17 | 3300006871 | Ga0075434_100318167 | Ga0075434_1003181672 | 306 |
| 18 | 3300031731 | Ga0307405_10279520 | Ga0307405_102795201 | 306 |
| 19 | 3300031901 | Ga0307406_10020665 | Ga0307406_100206651 | 306 |
| 20 | 3300032002 | Ga0307416_100121236 | Ga0307416_1001212362 | 306 |
| 21 | 3300032126 | Ga0307415_100001042 | Ga0307415_10000104211 | 306 |
| 22 | 3300048909 | Ga0496106_0127857 | Ga0496106_0127857_763_1683 | 306 |
| 23 | 3300037471 | Ga0395905_0186607 | Ga0395905_0186607_391_1320 | 308 |
| 24 | 3300037471 | Ga0395905_0632628 | Ga0395905_0632628_19_948 | 308 |
| 25 | 3300039437 | Ga0436365_1904845 | Ga0436365_1904845_212_1141 | 308 |
| 26 | 3300046519 | Ga0495632_0069493 | Ga0495632_0069493_698_1627 | 308 |
| 27 | 3300049593 | Ga0501077_0146300 | Ga0501077_0146300_111_1052 | 308 |
| 28 | 3300049688 | Ga0501259_021771 | Ga0501259_021771_201_1130 | 308 |
| 29 | 3300005546 | Ga0070696_100154526 | Ga0070696_1001545261 | 311 |
| 30 | 3300009177 | Ga0105248_10081124 | Ga0105248_100811244 | 312 |
| 31 | 3300025941 | Ga0207711_10035643 | Ga0207711_100356434 | 312 |
| 32 | 3300026142 | Ga0207698_10317776 | Ga0207698_103177762 | 312 |
| 33 | 3300049743 | Ga0501081_0228424 | Ga0501081_0228424_79_1068 | 317 |
| 34 | 3300045051 | Ga0451576_0021603 | Ga0451576_0021603_2895_3908 | 323 |
| 35 | 3300005295 | Ga0065707_10120093 | Ga0065707_101200931 | 324 |
| 36 | 3300005328 | Ga0070676_10166499 | Ga0070676_101664991 | 324 |
| 37 | 3300005340 | Ga0070689_100116122 | Ga0070689_1001161222 | 324 |
| 38 | 3300005354 | Ga0070675_100081464 | Ga0070675_1000814643 | 324 |
| 39 | 3300005364 | Ga0070673_100025917 | Ga0070673_1000259174 | 324 |
| 40 | 3300005365 | Ga0070688_100066865 | Ga0070688_1000668653 | 324 |
| 41 | 3300005367 | Ga0070667_100168627 | Ga0070667_1001686272 | 324 |
| 42 | 3300005438 | Ga0070701_10136850 | Ga0070701_101368502 | 324 |
| 43 | 3300005459 | Ga0068867_100049378 | Ga0068867_1000493783 | 324 |
| 44 | 3300005466 | Ga0070685_10008896 | Ga0070685_100088962 | 324 |
| 45 | 3300005468 | Ga0070707_100264792 | Ga0070707_1002647921 | 324 |
| 46 | 3300005539 | Ga0068853_100483808 | Ga0068853_1004838081 | 324 |
| 47 | 3300005543 | Ga0070672_100052623 | Ga0070672_1000526233 | 324 |
| 48 | 3300005564 | Ga0070664_100332989 | Ga0070664_1003329892 | 324 |
| 49 | 3300005617 | Ga0068859_100448513 | Ga0068859_1004485131 | 324 |
| 50 | 3300005618 | Ga0068864_100035605 | Ga0068864_1000356055 | 324 |
| 51 | 3300005840 | Ga0068870_10083395 | Ga0068870_100833952 | 324 |
| 52 | 3300005841 | Ga0068863_100198632 | Ga0068863_1001986322 | 324 |
| 53 | 3300005842 | Ga0068858_100174618 | Ga0068858_1001746182 | 324 |
| 54 | 3300006871 | Ga0075434_100019153 | Ga0075434_1000191533 | 324 |
| 55 | 3300006881 | Ga0068865_100077498 | Ga0068865_1000774982 | 324 |
| 56 | 3300006931 | Ga0097620_100448491 | Ga0097620_1004484911 | 324 |
| 57 | 3300009011 | Ga0105251_10045850 | Ga0105251_100458502 | 324 |
| 58 | 3300009148 | Ga0105243_10002722 | Ga0105243_1000272211 | 324 |
| 59 | 3300009148 | Ga0105243_10030928 | Ga0105243_100309286 | 324 |
| 60 | 3300009176 | Ga0105242_10000507 | Ga0105242_100005073 | 324 |
| 61 | 3300009176 | Ga0105242_10020232 | Ga0105242_100202326 | 324 |
| 62 | 3300009177 | Ga0105248_10435129 | Ga0105248_104351291 | 324 |
| 63 | 3300011119 | Ga0105246_10030376 | Ga0105246_100303763 | 324 |
| 64 | 3300013296 | Ga0157374_10070109 | Ga0157374_100701093 | 324 |
| 65 | 3300013297 | Ga0157378_10000067 | Ga0157378_1000006711 | 324 |
| 66 | 3300013308 | Ga0157375_10005624 | Ga0157375_1000562411 | 324 |
| 67 | 3300014325 | Ga0163163_10129753 | Ga0163163_101297532 | 324 |
| 68 | 3300014325 | Ga0163163_10221712 | Ga0163163_102217123 | 324 |
| 69 | 3300014968 | Ga0157379_10303057 | Ga0157379_103030572 | 324 |
| 70 | 3300014969 | Ga0157376_10028062 | Ga0157376_100280623 | 324 |
| 71 | 3300025315 | Ga0207697_10018857 | Ga0207697_100188573 | 324 |
| 72 | 3300025908 | Ga0207643_10033896 | Ga0207643_100338964 | 324 |
| 73 | 3300025908 | Ga0207643_10066754 | Ga0207643_100667543 | 324 |
| 74 | 3300025918 | Ga0207662_10096781 | Ga0207662_100967812 | 324 |
| 75 | 3300025927 | Ga0207687_10072771 | Ga0207687_100727712 | 324 |
| 76 | 3300025934 | Ga0207686_10008445 | Ga0207686_100084452 | 324 |
| 77 | 3300025934 | Ga0207686_10072427 | Ga0207686_100724272 | 324 |
| 78 | 3300025934 | Ga0207686_10172433 | Ga0207686_101724333 | 324 |
| 79 | 3300025935 | Ga0207709_10001862 | Ga0207709_1000186211 | 324 |
| 80 | 3300025935 | Ga0207709_10190551 | Ga0207709_101905512 | 324 |
| 81 | 3300025936 | Ga0207670_10096496 | Ga0207670_100964963 | 324 |
| 82 | 3300025936 | Ga0207670_10114764 | Ga0207670_101147642 | 324 |
| 83 | 3300025940 | Ga0207691_10007903 | Ga0207691_1000790310 | 324 |
| 84 | 3300025942 | Ga0207689_10221300 | Ga0207689_102213002 | 324 |
| 85 | 3300026089 | Ga0207648_10006393 | Ga0207648_1000639314 | 324 |
| 86 | 3300026095 | Ga0207676_10184060 | Ga0207676_101840602 | 324 |
| 87 | 3300026095 | Ga0207676_10336716 | Ga0207676_103367162 | 324 |
| 88 | 3300026118 | Ga0207675_100003544 | Ga0207675_1000035443 | 324 |
| 89 | 3300032005 | Ga0307411_10086378 | Ga0307411_100863782 | 324 |
| 90 | 3300032005 | Ga0307411_10200879 | Ga0307411_102008792 | 324 |
| 91 | 3300048905 | Ga0496102_0397670 | Ga0496102_0397670_261_1238 | 324 |
| 92 | 3300048909 | Ga0496106_0002129 | Ga0496106_0002129_10736_11713 | 324 |
| 93 | 3300048909 | Ga0496106_0165974 | Ga0496106_0165974_612_1589 | 324 |
| 94 | 3300048911 | Ga0496108_0065248 | Ga0496108_0065248_1257_2234 | 324 |
| 95 | 3300049514 | Ga0501291_008482 | Ga0501291_008482_354_1331 | 324 |
| 96 | 3300049520 | Ga0501297_004316 | Ga0501297_004316_432_1409 | 324 |
| 97 | 3300049521 | Ga0501298_009944 | Ga0501298_009944_130_1107 | 324 |
| 98 | 3300049660 | Ga0501216_003467 | Ga0501216_003467_1139_2116 | 324 |
| 99 | 3300049663 | Ga0501223_015571 | Ga0501223_015571_476_1453 | 324 |
| 100 | 3300049675 | Ga0501243_014329 | Ga0501243_014329_110_1087 | 324 |
| 101 | 3300049689 | Ga0501260_002863 | Ga0501260_002863_47_1024 | 324 |
| 102 | 3300049779 | Ga0501283_002534 | Ga0501283_002534_1223_2200 | 324 |
| 103 | 3300005354 | Ga0070675_100279656 | Ga0070675_1002796562 | 325 |
| 104 | 3300005366 | Ga0070659_100001636 | Ga0070659_1000016368 | 325 |
| 105 | 3300005444 | Ga0070694_100088863 | Ga0070694_1000888632 | 325 |
| 106 | 3300005458 | Ga0070681_10029351 | Ga0070681_100293513 | 325 |
| 107 | 3300005458 | Ga0070681_10118817 | Ga0070681_101188172 | 325 |
| 108 | 3300005467 | Ga0070706_100000055 | Ga0070706_10000005525 | 325 |
| 109 | 3300005467 | Ga0070706_100037418 | Ga0070706_1000374184 | 325 |
| 110 | 3300005468 | Ga0070707_100020620 | Ga0070707_1000206206 | 325 |
| 111 | 3300005471 | Ga0070698_100004560 | Ga0070698_1000045605 | 325 |
| 112 | 3300005471 | Ga0070698_100016325 | Ga0070698_1000163259 | 325 |
| 113 | 3300005530 | Ga0070679_100033992 | Ga0070679_1000339926 | 325 |
| 114 | 3300005536 | Ga0070697_100070891 | Ga0070697_1000708912 | 325 |
| 115 | 3300005539 | Ga0068853_100014025 | Ga0068853_1000140256 | 325 |
| 116 | 3300005563 | Ga0068855_100354039 | Ga0068855_1003540392 | 325 |
| 117 | 3300005564 | Ga0070664_100003832 | Ga0070664_1000038329 | 325 |
| 118 | 3300005577 | Ga0068857_100001668 | Ga0068857_10000166813 | 325 |
| 119 | 3300005617 | Ga0068859_100027572 | Ga0068859_1000275725 | 325 |
| 120 | 3300005617 | Ga0068859_100054142 | Ga0068859_1000541423 | 325 |
| 121 | 3300005617 | Ga0068859_100163627 | Ga0068859_1001636273 | 325 |
| 122 | 3300005718 | Ga0068866_10049577 | Ga0068866_100495773 | 325 |
| 123 | 3300005842 | Ga0068858_100199925 | Ga0068858_1001999251 | 325 |
| 124 | 3300005842 | Ga0068858_100358931 | Ga0068858_1003589312 | 325 |
| 125 | 3300005843 | Ga0068860_100033702 | Ga0068860_1000337026 | 325 |
| 126 | 3300005843 | Ga0068860_100088695 | Ga0068860_1000886954 | 325 |
| 127 | 3300005843 | Ga0068860_100188766 | Ga0068860_1001887661 | 325 |
| 128 | 3300005985 | Ga0081539_10002860 | Ga0081539_100028609 | 325 |
| 129 | 3300006173 | Ga0070716_100011114 | Ga0070716_1000111142 | 325 |
| 130 | 3300006931 | Ga0097620_100027570 | Ga0097620_1000275705 | 325 |
| 131 | 3300006931 | Ga0097620_100054143 | Ga0097620_1000541434 | 325 |
| 132 | 3300006931 | Ga0097620_100163631 | Ga0097620_1001636312 | 325 |
| 133 | 3300009174 | Ga0105241_10028499 | Ga0105241_100284993 | 325 |
| 134 | 3300009174 | Ga0105241_10076400 | Ga0105241_100764002 | 325 |
| 135 | 3300009177 | Ga0105248_10006595 | Ga0105248_1000659513 | 325 |
| 136 | 3300009553 | Ga0105249_10022736 | Ga0105249_100227362 | 325 |
| 137 | 3300010375 | Ga0105239_10590676 | Ga0105239_105906762 | 325 |
| 138 | 3300013100 | Ga0157373_10004467 | Ga0157373_100044675 | 325 |
| 139 | 3300013297 | Ga0157378_10050935 | Ga0157378_100509355 | 325 |
| 140 | 3300013306 | Ga0163162_10004188 | Ga0163162_100041888 | 325 |
| 141 | 3300013306 | Ga0163162_10091654 | Ga0163162_100916544 | 325 |
| 142 | 3300013306 | Ga0163162_10320102 | Ga0163162_103201023 | 325 |
| 143 | 3300013306 | Ga0163162_10613078 | Ga0163162_106130782 | 325 |
| 144 | 3300014325 | Ga0163163_10028033 | Ga0163163_100280336 | 325 |
| 145 | 3300014325 | Ga0163163_10040958 | Ga0163163_100409586 | 325 |
| 146 | 3300014968 | Ga0157379_10010606 | Ga0157379_100106065 | 325 |
| 147 | 3300025899 | Ga0207642_10037670 | Ga0207642_100376703 | 325 |
| 148 | 3300025900 | Ga0207710_10085090 | Ga0207710_100850902 | 325 |
| 149 | 3300025910 | Ga0207684_10000171 | Ga0207684_1000017125 | 325 |
| 150 | 3300025912 | Ga0207707_10014025 | Ga0207707_100140252 | 325 |
| 151 | 3300025912 | Ga0207707_10163493 | Ga0207707_101634934 | 325 |
| 152 | 3300025926 | Ga0207659_10238039 | Ga0207659_102380391 | 325 |
| 153 | 3300025932 | Ga0207690_10012623 | Ga0207690_100126233 | 325 |
| 154 | 3300025939 | Ga0207665_10013822 | Ga0207665_100138222 | 325 |
| 155 | 3300025941 | Ga0207711_10053015 | Ga0207711_100530152 | 325 |
| 156 | 3300025945 | Ga0207679_10107878 | Ga0207679_101078782 | 325 |
| 157 | 3300025949 | Ga0207667_10439903 | Ga0207667_104399031 | 325 |
| 158 | 3300026035 | Ga0207703_10124233 | Ga0207703_101242331 | 325 |
| 159 | 3300026041 | Ga0207639_10051015 | Ga0207639_100510152 | 325 |
| 160 | 3300026067 | Ga0207678_10392380 | Ga0207678_103923802 | 325 |
| 161 | 3300026075 | Ga0207708_10244980 | Ga0207708_102449802 | 325 |
| 162 | 3300026075 | Ga0207708_10407976 | Ga0207708_104079761 | 325 |
| 163 | 3300026089 | Ga0207648_10331074 | Ga0207648_103310742 | 325 |
| 164 | 3300026095 | Ga0207676_10362666 | Ga0207676_103626662 | 325 |
| 165 | 3300026116 | Ga0207674_10000054 | Ga0207674_1000005425 | 325 |
| 166 | 3300028381 | Ga0268264_10014789 | Ga0268264_100147896 | 325 |
| 167 | 3300028381 | Ga0268264_10078678 | Ga0268264_100786782 | 325 |
| 168 | 3300028381 | Ga0268264_10163985 | Ga0268264_101639851 | 325 |
| 169 | 3300031548 | Ga0307408_100149891 | Ga0307408_1001498911 | 325 |
| 170 | 3300031911 | Ga0307412_10268545 | Ga0307412_102685452 | 325 |
| 171 | 3300035091 | Ga0373951_0005408 | Ga0373951_0005408_1965_2945 | 325 |
| 172 | 3300048911 | Ga0496108_0277132 | Ga0496108_0277132_131_1111 | 325 |
| 173 | 3300048915 | Ga0496112_0061100 | Ga0496112_0061100_979_1959 | 325 |
| 174 | 3300048915 | Ga0496112_0322638 | Ga0496112_0322638_184_1164 | 325 |
| 175 | 3300005336 | Ga0070680_100000342 | Ga0070680_10000034223 | 326 |
| 176 | 3300005355 | Ga0070671_100004622 | Ga0070671_1000046228 | 326 |
| 177 | 3300005444 | Ga0070694_100092931 | Ga0070694_1000929312 | 326 |
| 178 | 3300005458 | Ga0070681_10000043 | Ga0070681_1000004325 | 326 |
| 179 | 3300005530 | Ga0070679_100000036 | Ga0070679_10000003625 | 326 |
| 180 | 3300005539 | Ga0068853_100359464 | Ga0068853_1003594641 | 326 |
| 181 | 3300005614 | Ga0068856_100031361 | Ga0068856_1000313615 | 326 |
| 182 | 3300005719 | Ga0068861_100016147 | Ga0068861_1000161471 | 326 |
| 183 | 3300005843 | Ga0068860_100076654 | Ga0068860_1000766542 | 326 |
| 184 | 3300005985 | Ga0081539_10033343 | Ga0081539_100333432 | 326 |
| 185 | 3300006852 | Ga0075433_10107475 | Ga0075433_101074753 | 326 |
| 186 | 3300006871 | Ga0075434_100282989 | Ga0075434_1002829892 | 326 |
| 187 | 3300007076 | Ga0075435_100017182 | Ga0075435_1000171826 | 326 |
| 188 | 3300009147 | Ga0114129_10027104 | Ga0114129_100271047 | 326 |
| 189 | 3300009148 | Ga0105243_10256169 | Ga0105243_102561692 | 326 |
| 190 | 3300009177 | Ga0105248_10456022 | Ga0105248_104560222 | 326 |
| 191 | 3300013297 | Ga0157378_10325240 | Ga0157378_103252402 | 326 |
| 192 | 3300013306 | Ga0163162_10047180 | Ga0163162_100471803 | 326 |
| 193 | 3300014326 | Ga0157380_10000349 | Ga0157380_1000034912 | 326 |
| 194 | 3300025900 | Ga0207710_10002291 | Ga0207710_100022912 | 326 |
| 195 | 3300025912 | Ga0207707_10000030 | Ga0207707_1000003091 | 326 |
| 196 | 3300025917 | Ga0207660_10000376 | Ga0207660_1000037619 | 326 |
| 197 | 3300025921 | Ga0207652_10000086 | Ga0207652_1000008649 | 326 |
| 198 | 3300025941 | Ga0207711_10200707 | Ga0207711_102007071 | 326 |
| 199 | 3300032002 | Ga0307416_100723434 | Ga0307416_1007234341 | 326 |
| 200 | 3300032004 | Ga0307414_10085477 | Ga0307414_100854771 | 326 |
| 201 | 3300038996 | Ga0242420_017252 | Ga0242420_017252_233_1216 | 326 |
| 202 | 3300048905 | Ga0496102_0010588 | Ga0496102_0010588_5393_6376 | 326 |
| 203 | 3300048907 | Ga0496104_0069219 | Ga0496104_0069219_609_1592 | 326 |
| 204 | 3300049521 | Ga0501298_001763 | Ga0501298_001763_617_1600 | 326 |
| 205 | 3300049649 | Ga0501198_000770 | Ga0501198_000770_446_1429 | 326 |
| 206 | 3300049661 | Ga0501217_027564 | Ga0501217_027564_339_1322 | 326 |
| 207 | 3300049663 | Ga0501223_007116 | Ga0501223_007116_57_1040 | 326 |
| 208 | 3300049668 | Ga0501233_008328 | Ga0501233_008328_637_1620 | 326 |
| 209 | 3300049705 | Ga0501225_0008170 | Ga0501225_0008170_2004_2987 | 326 |
| 210 | 3300049706 | Ga0501229_009600 | Ga0501229_009600_61_1044 | 326 |
| 211 | 3300049707 | Ga0501234_001973 | Ga0501234_001973_2239_3222 | 326 |
| 212 | 3300050507 | nmdc:mga05p37_121550_c1 | nmdc:mga05p37_121550_c1_795_1778 | 326 |
| 213 | 3300050512 | nmdc:mga0n895_87094_c1 | nmdc:mga0n895_87094_c1_691_1674 | 326 |
| 214 | 3300050513 | nmdc:mga0rr50_268092_c1 | nmdc:mga0rr50_268092_c1_163_1146 | 326 |
| 215 | 3300050513 | nmdc:mga0rr50_97358_c1 | nmdc:mga0rr50_97358_c1_402_1388 | 326 |
| 216 | 3300050515 | nmdc:mga0a205_276896_c1 | nmdc:mga0a205_276896_c1_514_1497 | 326 |
| 217 | 3300005330 | Ga0070690_100023738 | Ga0070690_1000237383 | 327 |
| 218 | 3300005343 | Ga0070687_100133947 | Ga0070687_1001339472 | 327 |
| 219 | 3300005355 | Ga0070671_100143527 | Ga0070671_1001435272 | 327 |
| 220 | 3300005438 | Ga0070701_10112045 | Ga0070701_101120451 | 327 |
| 221 | 3300005445 | Ga0070708_100000361 | Ga0070708_10000036130 | 327 |
| 222 | 3300005467 | Ga0070706_100024043 | Ga0070706_1000240433 | 327 |
| 223 | 3300005468 | Ga0070707_100002485 | Ga0070707_10000248512 | 327 |
| 224 | 3300005468 | Ga0070707_100272814 | Ga0070707_1002728142 | 327 |
| 225 | 3300005471 | Ga0070698_100017121 | Ga0070698_1000171218 | 327 |
| 226 | 3300005518 | Ga0070699_100015176 | Ga0070699_1000151762 | 327 |
| 227 | 3300005536 | Ga0070697_100004262 | Ga0070697_1000042628 | 327 |
| 228 | 3300005844 | Ga0068862_100068855 | Ga0068862_1000688553 | 327 |
| 229 | 3300005985 | Ga0081539_10000033 | Ga0081539_1000003330 | 327 |
| 230 | 3300005985 | Ga0081539_10001274 | Ga0081539_1000127431 | 327 |
| 231 | 3300006847 | Ga0075431_100026165 | Ga0075431_1000261653 | 327 |
| 232 | 3300006847 | Ga0075431_100027484 | Ga0075431_1000274844 | 327 |
| 233 | 3300006880 | Ga0075429_100126941 | Ga0075429_1001269412 | 327 |
| 234 | 3300009147 | Ga0114129_10078668 | Ga0114129_100786686 | 327 |
| 235 | 3300009147 | Ga0114129_10210158 | Ga0114129_102101583 | 327 |
| 236 | 3300009147 | Ga0114129_10249433 | Ga0114129_102494332 | 327 |
| 237 | 3300009147 | Ga0114129_10252430 | Ga0114129_102524302 | 327 |
| 238 | 3300009147 | Ga0114129_10564365 | Ga0114129_105643651 | 327 |
| 239 | 3300009147 | Ga0114129_10797294 | Ga0114129_107972941 | 327 |
| 240 | 3300009148 | Ga0105243_10047688 | Ga0105243_100476884 | 327 |
| 241 | 3300009176 | Ga0105242_10002537 | Ga0105242_1000253714 | 327 |
| 242 | 3300009177 | Ga0105248_10389938 | Ga0105248_103899382 | 327 |
| 243 | 3300013297 | Ga0157378_10006655 | Ga0157378_100066555 | 327 |
| 244 | 3300013306 | Ga0163162_10056960 | Ga0163162_100569605 | 327 |
| 245 | 3300017792 | Ga0163161_10060603 | Ga0163161_100606033 | 327 |
| 246 | 3300021384 | Ga0213876_10000104 | Ga0213876_1000010450 | 327 |
| 247 | 3300021384 | Ga0213876_10000577 | Ga0213876_100005776 | 327 |
| 248 | 3300021384 | Ga0213876_10023223 | Ga0213876_100232234 | 327 |
| 249 | 3300025910 | Ga0207684_10192030 | Ga0207684_101920302 | 327 |
| 250 | 3300025918 | Ga0207662_10019253 | Ga0207662_100192532 | 327 |
| 251 | 3300025931 | Ga0207644_10146080 | Ga0207644_101460801 | 327 |
| 252 | 3300025934 | Ga0207686_10001463 | Ga0207686_1000146310 | 327 |
| 253 | 3300025961 | Ga0207712_10015854 | Ga0207712_100158542 | 327 |
| 254 | 3300032126 | Ga0307415_100237225 | Ga0307415_1002372252 | 327 |
| 255 | 3300039437 | Ga0436365_0748815 | Ga0436365_0748815_22951_23943 | 327 |
| 256 | 3300039437 | Ga0436365_1195936 | Ga0436365_1195936_28891_29883 | 327 |
| 257 | 3300045051 | Ga0451576_0097954 | Ga0451576_0097954_1319_2308 | 327 |
| 258 | 3300049568 | Ga0501031_0079027 | Ga0501031_0079027_716_1714 | 327 |
| 259 | 3300049582 | Ga0501048_0164910 | Ga0501048_0164910_452_1450 | 327 |
| 260 | 3300050507 | nmdc:mga05p37_335_c1 | nmdc:mga05p37_335_c1_8784_9776 | 327 |
| 261 | 3300050507 | nmdc:mga05p37_361740_c1 | nmdc:mga05p37_361740_c1_329_1318 | 327 |
| 262 | 3300050507 | nmdc:mga05p37_543992_c1 | nmdc:mga05p37_543992_c1_246_1247 | 327 |
| 263 | 3300050507 | nmdc:mga05p37_79710_c1 | nmdc:mga05p37_79710_c1_68_1057 | 327 |
| 264 | 3300050508 | nmdc:mga09592_84080_c1 | nmdc:mga09592_84080_c1_1193_2182 | 327 |
| 265 | 3300050509 | nmdc:mga0qj67_149180_c1 | nmdc:mga0qj67_149180_c1_136_1134 | 327 |
| 266 | 3300050512 | nmdc:mga0n895_175418_c1 | nmdc:mga0n895_175418_c1_976_1974 | 327 |
| 267 | 3300060353 | Ga0501082_0076475 | Ga0501082_0076475_697_1695 | 327 |
| 268 | 3300005364 | Ga0070673_100015044 | Ga0070673_1000150442 | 328 |
| 269 | 3300025960 | Ga0207651_10001864 | Ga0207651_100018641 | 328 |
| 270 | 3300005331 | Ga0070670_100000413 | Ga0070670_1000004133 | 329 |
| 271 | 3300005340 | Ga0070689_100010625 | Ga0070689_1000106255 | 329 |
| 272 | 3300005347 | Ga0070668_100010083 | Ga0070668_1000100835 | 329 |
| 273 | 3300005543 | Ga0070672_100190290 | Ga0070672_1001902902 | 329 |
| 274 | 3300005841 | Ga0068863_100163452 | Ga0068863_1001634522 | 329 |
| 275 | 3300009101 | Ga0105247_10062101 | Ga0105247_100621014 | 329 |
| 276 | 3300009147 | Ga0114129_10003875 | Ga0114129_1000387518 | 329 |
| 277 | 3300009147 | Ga0114129_10327476 | Ga0114129_103274761 | 329 |
| 278 | 3300009553 | Ga0105249_10000375 | Ga0105249_1000037510 | 329 |
| 279 | 3300009553 | Ga0105249_10309687 | Ga0105249_103096872 | 329 |
| 280 | 3300013297 | Ga0157378_10249997 | Ga0157378_102499971 | 329 |
| 281 | 3300013306 | Ga0163162_10000162 | Ga0163162_1000016234 | 329 |
| 282 | 3300017792 | Ga0163161_10247349 | Ga0163161_102473492 | 329 |
| 283 | 3300025923 | Ga0207681_10005479 | Ga0207681_100054794 | 329 |
| 284 | 3300025925 | Ga0207650_10000304 | Ga0207650_1000030412 | 329 |
| 285 | 3300025961 | Ga0207712_10000313 | Ga0207712_1000031335 | 329 |
| 286 | 3300025972 | Ga0207668_10011459 | Ga0207668_100114596 | 329 |
| 287 | 3300026088 | Ga0207641_10122016 | Ga0207641_101220162 | 329 |
| 288 | 3300046525 | Ga0495663_0000102 | Ga0495663_0000102_8645_9646 | 329 |
| 289 | 3300046537 | Ga0495598_0000045 | Ga0495598_0000045_4981_5982 | 329 |
| 290 | 3300046539 | Ga0495621_0048430 | Ga0495621_0048430_329_1330 | 329 |
| 291 | 3300005471 | Ga0070698_100009470 | Ga0070698_1000094706 | 330 |
| 292 | 3300006880 | Ga0075429_100193234 | Ga0075429_1001932342 | 330 |
| 293 | 3300050508 | nmdc:mga09592_214168_c1 | nmdc:mga09592_214168_c1_336_1370 | 330 |
| 294 | 3300005295 | Ga0065707_10088510 | Ga0065707_100885103 | 331 |
| 295 | 3300005330 | Ga0070690_100188938 | Ga0070690_1001889382 | 331 |
| 296 | 3300005334 | Ga0068869_100027918 | Ga0068869_1000279182 | 331 |
| 297 | 3300005353 | Ga0070669_100243829 | Ga0070669_1002438292 | 331 |
| 298 | 3300005441 | Ga0070700_100023717 | Ga0070700_1000237172 | 331 |
| 299 | 3300005467 | Ga0070706_100004283 | Ga0070706_1000042832 | 331 |
| 300 | 3300005468 | Ga0070707_100347778 | Ga0070707_1003477782 | 331 |
| 301 | 3300005471 | Ga0070698_100014091 | Ga0070698_1000140915 | 331 |
| 302 | 3300005518 | Ga0070699_100007923 | Ga0070699_1000079237 | 331 |
| 303 | 3300005518 | Ga0070699_100021496 | Ga0070699_1000214962 | 331 |
| 304 | 3300005536 | Ga0070697_100001825 | Ga0070697_1000018259 | 331 |
| 305 | 3300005544 | Ga0070686_100009294 | Ga0070686_1000092943 | 331 |
| 306 | 3300006881 | Ga0068865_100209791 | Ga0068865_1002097912 | 331 |
| 307 | 3300006914 | Ga0075436_100000015 | Ga0075436_10000001514 | 331 |
| 308 | 3300007076 | Ga0075435_100000410 | Ga0075435_10000041022 | 331 |
| 309 | 3300009176 | Ga0105242_10000227 | Ga0105242_1000022719 | 331 |
| 310 | 3300013297 | Ga0157378_10007638 | Ga0157378_100076385 | 331 |
| 311 | 3300014325 | Ga0163163_10023043 | Ga0163163_100230437 | 331 |
| 312 | 3300025885 | Ga0207653_10000180 | Ga0207653_1000018034 | 331 |
| 313 | 3300025934 | Ga0207686_10000213 | Ga0207686_1000021319 | 331 |
| 314 | 3300025935 | Ga0207709_10000043 | Ga0207709_1000004319 | 331 |
| 315 | 3300025937 | Ga0207669_10404075 | Ga0207669_104040751 | 331 |
| 316 | 3300025942 | Ga0207689_10001120 | Ga0207689_1000112018 | 331 |
| 317 | 3300025942 | Ga0207689_10101689 | Ga0207689_101016892 | 331 |
| 318 | 3300026075 | Ga0207708_10009371 | Ga0207708_1000937110 | 331 |
| 319 | 3300047320 | Ga0495672_0093951 | Ga0495672_0093951_515_1531 | 331 |
| 320 | 3300050513 | nmdc:mga0rr50_265_c1 | nmdc:mga0rr50_265_c1_10117_11136 | 331 |
| 321 | 3300050514 | nmdc:mga08x19_3_c1 | nmdc:mga08x19_3_c1_11356_12375 | 331 |
| 322 | 3300005364 | Ga0070673_100187920 | Ga0070673_1001879202 | 332 |
| 323 | 3300005536 | Ga0070697_100063716 | Ga0070697_1000637162 | 332 |
| 324 | 3300005615 | Ga0070702_100147748 | Ga0070702_1001477482 | 332 |
| 325 | 3300006163 | Ga0070715_10000019 | Ga0070715_1000001977 | 332 |
| 326 | 3300006173 | Ga0070716_100000001 | Ga0070716_100000001230 | 332 |
| 327 | 3300010375 | Ga0105239_10047024 | Ga0105239_100470243 | 332 |
| 328 | 3300013297 | Ga0157378_10113153 | Ga0157378_101131532 | 332 |
| 329 | 3300013306 | Ga0163162_10001341 | Ga0163162_100013417 | 332 |
| 330 | 3300025905 | Ga0207685_10000021 | Ga0207685_1000002143 | 332 |
| 331 | 3300025939 | Ga0207665_10000002 | Ga0207665_10000002107 | 332 |
| 332 | 3300025960 | Ga0207651_10056067 | Ga0207651_100560672 | 332 |
| 333 | 3300026118 | Ga0207675_100006696 | Ga0207675_1000066962 | 332 |
| 334 | 3300038996 | Ga0242420_000869 | Ga0242420_000869_2645_3664 | 332 |
| 335 | 3300005468 | Ga0070707_100045074 | Ga0070707_1000450741 | 335 |
| 336 | 3300025910 | Ga0207684_10085309 | Ga0207684_100853091 | 335 |
| 337 | 3300025922 | Ga0207646_10019481 | Ga0207646_100194817 | 335 |
| 338 | 3300002074 | JGI24748J21848_1000002 | JGI24748J21848_100000215 | 338 |
| 339 | 3300002239 | JGI24034J26672_10000004 | JGI24034J26672_10000004357 | 338 |
| 340 | 3300005842 | Ga0068858_100002375 | Ga0068858_10000237510 | 338 |
| 341 | 3300009101 | Ga0105247_10000005 | Ga0105247_10000005347 | 338 |
| 342 | 3300025223 | Ga0207672_1000315 | Ga0207672_10003153 | 338 |
| 343 | 3300025900 | Ga0207710_10000004 | Ga0207710_10000004345 | 338 |
| 344 | 3300025931 | Ga0207644_10003135 | Ga0207644_100031352 | 338 |
| 345 | 3300026035 | Ga0207703_10000589 | Ga0207703_1000058927 | 338 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7dqx-assembly1.cif.gz_E | crystal structure of xanthine dehydrogenase family protein | 0.9061 | 1 | 333 |
| 1ffu-assembly1.cif.gz_F | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor | 0.9021 | 1 | 334 |
| 1ffv-assembly1.cif.gz_F | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9007 | 1 | 334 |
| 7dqx-assembly1.cif.gz_B | crystal structure of xanthine dehydrogenase family protein | 0.8953 | 1 | 333 |
| 1t3q-assembly1.cif.gz_F | crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 | 0.8883 | 1 | 334 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ffuF01 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 | 0.9103 | 1 | 54 | 3.30.43.10 |
| 1ffvC03 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9078 | 60 | 214 | 3.30.465.10 |
| 4zohB03 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain | 0.9002 | 220 | 335 | 3.30.390.50 |
| 1ffvC03 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9002 | 60 | 214 | 3.30.465.10 |
| af_P77324_1_53_3.30.43.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 | 0.8997 | 3 | 55 | 3.30.43.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F2QS64-F1-model_v4 | CO dehydrogenase flavoprotein C-terminal domain-containing protein | 0.9304 | 186 | 335 |
|
| AF-A0A2W0B037-F1-model_v4 | Xanthine dehydrogenase family protein subunit M | 0.9261 | 1 | 98 |
GO:0016491
GO:0071949 |
| AF-A0A7V2P6P1-F1-model_v4 | FAD-binding PCMH-type domain-containing protein | 0.922 | 3 | 117 |
GO:0016491
GO:0071949 |
| AF-A0A1V4RR24-F1-model_v4 | Molybdopterin dehydrogenase | 0.9215 | 1 | 337 |
GO:0016491
GO:0071949 |
| AF-A0A6A7LWW5-F1-model_v4 | Xanthine dehydrogenase family protein subunit M | 0.9199 | 3 | 117 |
GO:0016491
GO:0071949 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar