F416327

General Info

Members Datasets Scaffolds Average Seq Length
345 204 690 327

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100015553|Ga0075430_1000155535
Length 387
Sequence MSADPTQQPTTANGDLVTGSEVRLADGRLMPAKDAPVGGQAVLEGVMMRGVSTWAVAVRAPAPDAAGQNGSSNGHHEHPLVEEAELGAEAAATTLAGVGPAAGNGALGDAGEVLGPIEIHTESFEPLMKRRRLYRVPVVRGVIALYESLKIGMKALGISANAQLEEPDEEISGKTWGFTIFLSLAFAIGLFFVLPVTVASFWKDELGSSVLFVVVEKLIRIAIFLGYLWAISHINDLRRVFEYHGAEHKVISCYEAGEPLTPENADKYSRLHVRCGTSFLLIVMIIAVFVFAPIGRPDLHWLILSRIVGIGLVAGLAYEVIRWAGRNRRKRWVRGLMWPGLQLQKLTTRPPSLDQLAVSIAALEAVLAVEDPSKSSEEDRLGMEVVA

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
75 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 5.51
Rhizosphere 86.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100015553 3300006846 Bacteria 6476
2 LJQas_1000698 3300000549 Bacteria 5346
3 LJQas_1002089 3300000549 Bacteria 2845
4 JGI25406J46586_10012475 3300003203 Bacteria 3685
5 JGI25407J50210_10000344 3300003373 Bacteria 8661
6 JGI25407J50210_10005029 3300003373 Bacteria 3234
7 JGI25407J50210_10008555 3300003373 Bacteria 2582
8 JGI25407J50210_10028578 3300003373 Bacteria 1446
9 JGI25407J50210_10041541 3300003373 Bacteria 1177
10 Ga0070683_100002956 3300005329 Bacteria 13626
11 Ga0070683_100146156 3300005329 Bacteria 2240
12 Ga0070680_100005441 3300005336 Bacteria 9636
13 Ga0070680_100105919 3300005336 Bacteria 2338
14 Ga0070682_100055786 3300005337 Bacteria 2483
15 Ga0068868_100013031 3300005338 Bacteria 6087
16 Ga0070660_100004196 3300005339 Bacteria 9952
17 Ga0070660_100065366 3300005339 Bacteria 2831
18 Ga0070691_10032096 3300005341 Bacteria 2466
19 Ga0070691_10068090 3300005341 Bacteria 1723
20 Ga0070661_100053126 3300005344 Bacteria 2965
21 Ga0070692_10006341 3300005345 Bacteria 5134
22 Ga0070668_100021360 3300005347 Bacteria 4889
23 Ga0070668_100343248 3300005347 Bacteria 1262
24 Ga0070675_100106468 3300005354 Bacteria 2367
25 Ga0070674_100024128 3300005356 Bacteria 3945
26 Ga0070674_100026117 3300005356 Bacteria 3810
27 Ga0070659_100013220 3300005366 Bacteria 6138
28 Ga0070659_100013683 3300005366 Bacteria 6046
29 Ga0070714_100224374 3300005435 Bacteria 1728
30 Ga0070713_100209170 3300005436 Bacteria 1765
31 Ga0070713_100237231 3300005436 Bacteria 1659
32 Ga0070701_10077528 3300005438 Bacteria 1791
33 Ga0070700_100026565 3300005441 Bacteria 3421
34 Ga0070694_100116079 3300005444 Bacteria 1914
35 Ga0070663_100149338 3300005455 Bacteria 1791
36 Ga0070662_100004751 3300005457 Bacteria 8601
37 Ga0070662_100025455 3300005457 Bacteria 4087
38 Ga0070681_10004093 3300005458 Bacteria 13782
39 Ga0068867_100054380 3300005459 Bacteria 2958
40 Ga0070679_100007176 3300005530 Bacteria 10405
41 Ga0070679_100203475 3300005530 Bacteria 1945
42 Ga0070684_100006488 3300005535 Bacteria 9059
43 Ga0070684_100009236 3300005535 Bacteria 7761
44 Ga0070684_100030915 3300005535 Bacteria 4554
45 Ga0068853_100075657 3300005539 Bacteria 2938
46 Ga0070672_100041985 3300005543 Bacteria 3519
47 Ga0070686_100016412 3300005544 Bacteria 4309
48 Ga0070665_100000776 3300005548 Bacteria 41977
49 Ga0070664_100041203 3300005564 Bacteria 3896
50 Ga0068856_100157548 3300005614 Bacteria 2281
51 Ga0068856_100339280 3300005614 Bacteria 1521
52 Ga0068852_100264091 3300005616 Bacteria 1654
53 Ga0068852_100318883 3300005616 Bacteria 1509
54 Ga0068864_100213006 3300005618 Bacteria 1780
55 Ga0068861_100151486 3300005719 Bacteria 1903
56 Ga0068861_100193907 3300005719 Bacteria 1701
57 Ga0068858_100040137 3300005842 Bacteria 4340
58 Ga0081455_10036383 3300005937 Bacteria 4384
59 Ga0081455_10072612 3300005937 Bacteria 2848
60 Ga0081455_10076612 3300005937 Bacteria 2754
61 Ga0081455_10199173 3300005937 Bacteria 1501
62 Ga0081538_10000011 3300005981 Bacteria 154554
63 Ga0081538_10000091 3300005981 Bacteria 88665
64 Ga0081538_10000233 3300005981 Bacteria 62537
65 Ga0081538_10000444 3300005981 Bacteria 46550
66 Ga0081538_10001186 3300005981 Bacteria 27434
67 Ga0081538_10001554 3300005981 Bacteria 23531
68 Ga0081538_10006039 3300005981 Bacteria 10764
69 Ga0081538_10006489 3300005981 Bacteria 10292
70 Ga0081538_10007920 3300005981 Bacteria 9100
71 Ga0081538_10016027 3300005981 Bacteria 5767
72 Ga0081538_10020969 3300005981 Bacteria 4791
73 Ga0081538_10040689 3300005981 Bacteria 2960
74 Ga0081538_10056226 3300005981 Bacteria 2307
75 Ga0081538_10065255 3300005981 Bacteria 2052
76 Ga0081538_10070718 3300005981 Bacteria 1924
77 Ga0081540_1001151 3300005983 Bacteria 23281
78 Ga0081540_1031389 3300005983 Bacteria 2921
79 Ga0081539_10004903 3300005985 Bacteria 14264
80 Ga0075365_10000463 3300006038 Bacteria 15223
81 Ga0075364_10056691 3300006051 Bacteria 2566
82 Ga0075432_10005687 3300006058 Bacteria 4245
83 Ga0070716_100027727 3300006173 Bacteria 3045
84 Ga0070712_100072902 3300006175 Bacteria 2461
85 Ga0075367_10161392 3300006178 Bacteria 1394
86 Ga0075428_100099733 3300006844 Bacteria 3167
87 Ga0075428_100109933 3300006844 Bacteria 3002
88 Ga0075428_100131518 3300006844 Bacteria 2722
89 Ga0075428_100213726 3300006844 Bacteria 2084
90 Ga0075430_100051963 3300006846 Bacteria 3451
91 Ga0075430_100061105 3300006846 Bacteria 3166
92 Ga0075431_100008731 3300006847 Bacteria 10152
93 Ga0075431_100033137 3300006847 Bacteria 5325
94 Ga0075431_100130193 3300006847 Bacteria 2596
95 Ga0075431_100283997 3300006847 Bacteria 1676
96 Ga0075433_10017790 3300006852 Bacteria 5896
97 Ga0075433_10047370 3300006852 Bacteria 3739
98 Ga0075434_100014499 3300006871 Bacteria 7534
99 Ga0075429_100006901 3300006880 Bacteria 9862
100 Ga0075429_100008903 3300006880 Bacteria 8724
101 Ga0068865_100004502 3300006881 Bacteria 8408
102 Ga0105240_10017196 3300009093 Bacteria 9756
103 Ga0111539_10014923 3300009094 Bacteria 9682
104 Ga0105245_10008989 3300009098 Bacteria 8714
105 Ga0105245_10023067 3300009098 Bacteria 5461
106 Ga0105245_10491698 3300009098 Bacteria 1242
107 Ga0114129_10021796 3300009147 Bacteria 9095
108 Ga0114129_10141047 3300009147 Bacteria 3303
109 Ga0114129_10287421 3300009147 Bacteria 2195
110 Ga0105243_10012056 3300009148 Bacteria 6536
111 Ga0105237_10414729 3300009545 Bacteria 1352
112 Ga0105238_10012459 3300009551 Bacteria 8576
113 Ga0105249_10005992 3300009553 Bacteria 10531
114 Ga0105239_10077873 3300010375 Bacteria 3648
115 Ga0105239_10095598 3300010375 Bacteria 3282
116 Ga0105239_10106180 3300010375 Bacteria 3111
117 Ga0157371_10254225 3300013102 Bacteria 1266
118 Ga0157370_10022541 3300013104 Bacteria 6266
119 Ga0163162_10015752 3300013306 Bacteria 7390
120 Ga0157372_10095526 3300013307 Bacteria 3387
121 Ga0157372_10158520 3300013307 Bacteria 2614
122 Ga0157375_10038951 3300013308 Bacteria 4569
123 Ga0163163_10475255 3300014325 Bacteria 1311
124 Ga0157377_10029153 3300014745 Bacteria 2977
125 Ga0157379_10212902 3300014968 Bacteria 1750
126 Ga0163161_10044188 3300017792 Bacteria 3209
127 Ga0206355_1270016 3300020076 Bacteria 1391
128 Ga0206353_11002997 3300020082 Bacteria 3132
129 Ga0213873_10031859 3300021358 Bacteria 1314
130 Ga0213874_10013029 3300021377 Bacteria 2145
131 Ga0213876_10007246 3300021384 Bacteria 6046
132 Ga0213876_10008819 3300021384 Bacteria 5444
133 Ga0213876_10015466 3300021384 Bacteria 4037
134 Ga0207426_1034840 3300025302 Bacteria 1612
135 Ga0207692_10005291 3300025898 Bacteria 5159
136 Ga0207642_10063471 3300025899 Bacteria 1728
137 Ga0207688_10018570 3300025901 Bacteria 3782
138 Ga0207699_10052383 3300025906 Bacteria 2415
139 Ga0207705_10097964 3300025909 Bacteria 2154
140 Ga0207707_10011669 3300025912 Bacteria 7648
141 Ga0207695_10184397 3300025913 Bacteria 2007
142 Ga0207693_10008769 3300025915 Bacteria 8266
143 Ga0207663_10056257 3300025916 Bacteria 2472
144 Ga0207660_10009615 3300025917 Bacteria 6259
145 Ga0207657_10006078 3300025919 Bacteria 12559
146 Ga0207657_10090448 3300025919 Bacteria 2554
147 Ga0207649_10028563 3300025920 Bacteria 3285
148 Ga0207652_10106196 3300025921 Bacteria 2485
149 Ga0207652_10205997 3300025921 Bacteria 1770
150 Ga0207694_10072192 3300025924 Bacteria 2698
151 Ga0207659_10052029 3300025926 Bacteria 2915
152 Ga0207687_10052790 3300025927 Bacteria 2838
153 Ga0207700_10060907 3300025928 Bacteria 2860
154 Ga0207664_10098697 3300025929 Bacteria 2409
155 Ga0207690_10027785 3300025932 Bacteria 3578
156 Ga0207690_10114568 3300025932 Bacteria 1947
157 Ga0207706_10009597 3300025933 Bacteria 8883
158 Ga0207706_10016232 3300025933 Bacteria 6729
159 Ga0207670_10128431 3300025936 Bacteria 1853
160 Ga0207669_10190702 3300025937 Bacteria 1478
161 Ga0207704_10031510 3300025938 Bacteria 2988
162 Ga0207661_10005176 3300025944 Bacteria 9165
163 Ga0207661_10018285 3300025944 Bacteria 5206
164 Ga0207661_10076988 3300025944 Bacteria 2742
165 Ga0207668_10110509 3300025972 Bacteria 2061
166 Ga0207640_10076236 3300025981 Bacteria 2275
167 Ga0207677_10152276 3300026023 Bacteria 1786
168 Ga0207703_10217339 3300026035 Bacteria 1707
169 Ga0207639_10152994 3300026041 Bacteria 1934
170 Ga0207678_10082694 3300026067 Bacteria 2747
171 Ga0207708_10043827 3300026075 Bacteria 3410
172 Ga0207648_10108188 3300026089 Bacteria 2440
173 Ga0207674_10051441 3300026116 Bacteria 4204
174 Ga0207675_100015796 3300026118 Bacteria 7040
175 Ga0207675_100290429 3300026118 Bacteria 1590
176 Ga0207698_10020521 3300026142 Bacteria 4550
177 Ga0207698_10220969 3300026142 Bacteria 1712
178 Ga0207428_10020487 3300027907 Bacteria 5617
179 Ga0268266_10001853 3300028379 Bacteria 23874
180 Ga0268265_10063326 3300028380 Bacteria 2845
181 Ga0307408_100053979 3300031548 Bacteria 2905
182 Ga0307405_10011275 3300031731 Bacteria 4675
183 Ga0307405_10118543 3300031731 Bacteria 1807
184 Ga0307413_10021396 3300031824 Bacteria 3462
185 Ga0307413_10075922 3300031824 Bacteria 2134
186 Ga0307410_10035866 3300031852 Bacteria 3225
187 Ga0307406_10066940 3300031901 Bacteria 2340
188 Ga0307406_10109294 3300031901 Bacteria 1900
189 Ga0307407_10024152 3300031903 Bacteria 3183
190 Ga0307412_10068721 3300031911 Bacteria 2410
191 Ga0307409_100001728 3300031995 Bacteria 11014
192 Ga0307409_100023556 3300031995 Bacteria 4270
193 Ga0307409_100057459 3300031995 Bacteria 3015
194 Ga0307409_100163276 3300031995 Bacteria 1951
195 Ga0307416_100005034 3300032002 Bacteria 8058
196 Ga0307416_100023775 3300032002 Bacteria 4456
197 Ga0307416_100043782 3300032002 Bacteria 3509
198 Ga0307414_10021244 3300032004 Bacteria 4067
199 Ga0307411_10071558 3300032005 Bacteria 2351
200 Ga0307415_100005151 3300032126 Bacteria 6897
201 Ga0307415_100095522 3300032126 Bacteria 2164
202 Ga0307415_100363821 3300032126 Bacteria 1222
203 Ga0373954_0050238 3300035118 Bacteria 1957
204 Ga0373931_0014480 3300035691 Bacteria 3856
205 Ga0373937_0072056 3300036401 Bacteria 3186
206 Ga0316584_0087574 3300036712 Bacteria 2331
207 Ga0395900_0132140 3300037418 Bacteria 2558
208 Ga0395900_0220077 3300037418 Bacteria 1914
209 Ga0395900_0463244 3300037418 Bacteria 1222
210 Ga0395898_0066310 3300037466 Bacteria 3498
211 Ga0395898_0081960 3300037466 Bacteria 3110
212 Ga0395898_0469213 3300037466 Bacteria 1198
213 Ga0436364_0062488 3300037853 Bacteria 26175
214 Ga0436364_0358878 3300037853 Bacteria 2281
215 Ga0436364_0526722 3300037853 Bacteria 13047
216 Ga0436364_0978753 3300037853 Bacteria 1579
217 Ga0436364_1103593 3300037853 Bacteria 4437
218 Ga0436364_1224456 3300037853 Bacteria 5825
219 Ga0436364_1460198 3300037853 Bacteria 7566
220 Ga0395901_0006219 3300038443 Bacteria 12101
221 Ga0395901_0019378 3300038443 Bacteria 6956
222 Ga0395901_0140847 3300038443 Bacteria 2535
223 Ga0395901_0171741 3300038443 Bacteria 2275
224 Ga0436365_0285868 3300039437 Bacteria 4129
225 Ga0436365_0446783 3300039437 Bacteria 11833
226 Ga0436365_0554312 3300039437 Bacteria 3948
227 Ga0436365_1047232 3300039437 Bacteria 5467
228 Ga0436365_1278948 3300039437 Bacteria 27018
229 Ga0436365_1609438 3300039437 Bacteria 9660
230 Ga0436365_1727451 3300039437 Bacteria 14479
231 Ga0436360_0766804 3300039438 Bacteria 1389
232 Ga0436363_0415408 3300039450 Bacteria 1026
233 Ga0436363_1134294 3300039450 Bacteria 1920
234 Ga0436363_1592253 3300039450 Bacteria 1960
235 Ga0436362_0244100 3300039453 Bacteria 1094
236 Ga0436362_1276229 3300039453 Bacteria 2661
237 Ga0451577_0289639 3300042876 Bacteria 1484
238 Ga0453683_0000087 3300044673 Bacteria 138993
239 Ga0466966_0045784 3300044684 Bacteria 2796
240 Ga0466966_0103266 3300044684 Bacteria 1762
241 Ga0466961_0028722 3300044693 Bacteria 3577
242 Ga0466963_0001684 3300044694 Bacteria 12042
243 Ga0466963_0023468 3300044694 Bacteria 3919
244 Ga0466963_0095692 3300044694 Bacteria 2027
245 Ga0453684_0003198 3300044712 Bacteria 37537
246 Ga0466971_0003776 3300044719 Bacteria 6484
247 Ga0466970_0055587 3300044765 Bacteria 2114
248 Ga0466957_0015491 3300044842 Bacteria 4453
249 Ga0466957_0044371 3300044842 Bacteria 2694
250 Ga0466960_0103430 3300044901 Bacteria 1470
251 Ga0466959_0046156 3300045049 Bacteria 3206
252 Ga0466959_0108663 3300045049 Bacteria 1981
253 Ga0466959_0153455 3300045049 Bacteria 1622
254 Ga0466959_0215429 3300045049 Bacteria 1333
255 Ga0466959_0225119 3300045049 Bacteria 1300
256 Ga0466958_0011248 3300045836 Bacteria 5038
257 Ga0466958_0014109 3300045836 Bacteria 4559
258 Ga0466958_0019445 3300045836 Bacteria 3953
259 Ga0466967_0010810 3300045976 Bacteria 6869
260 Ga0466967_0014208 3300045976 Bacteria 6192
261 Ga0466967_0116030 3300045976 Bacteria 2466
262 Ga0495641_0149629 3300046461 Bacteria 1043
263 Ga0495651_0045717 3300046462 Bacteria 3391
264 Ga0495664_0040250 3300046477 Bacteria 2763
265 Ga0495608_0150988 3300046511 Bacteria 1480
266 Ga0495630_0014342 3300046517 Bacteria 5772
267 Ga0495630_0129407 3300046517 Bacteria 1917
268 Ga0495644_0066998 3300046523 Bacteria 1349
269 Ga0495640_0061314 3300046533 Bacteria 2555
270 Ga0495587_0007039 3300046536 Bacteria 7302
271 Ga0495599_0131248 3300046678 Bacteria 1556
272 Ga0495646_0034559 3300046680 Bacteria 3139
273 Ga0495658_0087067 3300046683 Bacteria 1844
274 Ga0495604_0008577 3300047317 Bacteria 8075
275 Ga0495674_0058428 3300047319 Bacteria 3372
276 Ga0495672_0030816 3300047320 Bacteria 3356
277 Ga0495680_0018362 3300047322 Bacteria 5939
278 Ga0495675_0132590 3300047444 Bacteria 1548
279 Ga0495684_0040360 3300047471 Bacteria 3578
280 Ga0495602_0011353 3300048088 Bacteria 9215
281 Ga0496100_0156925 3300048903 Bacteria 1628
282 Ga0496102_0204203 3300048905 Bacteria 1863
283 Ga0496104_0280524 3300048907 Bacteria 1579
284 Ga0496104_0404203 3300048907 Bacteria 1278
285 Ga0496104_0465689 3300048907 Bacteria 1175
286 Ga0496105_0301029 3300048908 Bacteria 1289
287 Ga0496106_0028378 3300048909 Bacteria 4169
288 Ga0496106_0215622 3300048909 Bacteria 1530
289 Ga0496108_0022532 3300048911 Bacteria 5179
290 Ga0496109_0069977 3300048912 Bacteria 3219
291 Ga0496109_0089656 3300048912 Bacteria 2843
292 Ga0496110_0425255 3300048913 Bacteria 1211
293 Ga0496110_0527139 3300048913 Bacteria 1074
294 Ga0496110_0565268 3300048913 Bacteria 1033
295 Ga0496111_0039598 3300048914 Bacteria 3380
296 Ga0496111_0063382 3300048914 Bacteria 2681
297 Ga0496111_0137498 3300048914 Bacteria 1810
298 Ga0496112_0099704 3300048915 Bacteria 2875
299 Ga0496113_0330375 3300048916 Bacteria 1222
300 Ga0501036_0188083 3300049572 Bacteria 1738
301 Ga0501036_0399243 3300049572 Bacteria 1147
302 Ga0501041_0049423 3300049577 Bacteria 2562
303 Ga0501041_0093040 3300049577 Bacteria 1862
304 Ga0501067_0149186 3300049583 Bacteria 1303
305 Ga0501072_0018023 3300049588 Bacteria 5429
306 Ga0501072_0140816 3300049588 Bacteria 1923
307 Ga0501076_0023794 3300049592 Bacteria 4726
308 Ga0501076_0117154 3300049592 Bacteria 2156
309 Ga0501077_0011904 3300049593 Bacteria 5442
310 Ga0501083_0136256 3300049744 Bacteria 1609
311 Ga0501045_0020595 3300049824 Bacteria 4713
312 Ga0501045_0099088 3300049824 Bacteria 2156
313 nmdc:mga00v17_52560_c1 3300050491 Bacteria 2479
314 nmdc:mga00v17_5503_c1 3300050491 Bacteria 6671
315 nmdc:mga05p37_151010_c1 3300050507 Bacteria 2841
316 nmdc:mga05p37_2618_c1 3300050507 Bacteria 20945
317 nmdc:mga05p37_271927_c1 3300050507 Bacteria 2024
318 nmdc:mga05p37_303623_c1 3300050507 Bacteria 1895
319 nmdc:mga05p37_324890_c1 3300050507 Bacteria 1820
320 nmdc:mga05p37_4742_c1 3300050507 Bacteria 15887
321 nmdc:mga05p37_482000_c1 3300050507 Bacteria 1428
322 nmdc:mga09592_7694_c1 3300050508 Bacteria 8755
323 nmdc:mga0qj67_11008_c1 3300050509 Bacteria 6771
324 nmdc:mga0qj67_18039_c1 3300050509 Bacteria 5376
325 nmdc:mga06r32_187219_c1 3300050510 Bacteria 2057
326 nmdc:mga06r32_23742_c1 3300050510 Bacteria 5680
327 nmdc:mga06r32_29438_c1 3300050510 Bacteria 5147
328 nmdc:mga06r32_37589_c1 3300050510 Bacteria 4580
329 nmdc:mga08y16_114004_c1 3300050511 Bacteria 2814
330 nmdc:mga08y16_24581_c1 3300050511 Bacteria 6357
331 nmdc:mga0n895_137129_c1 3300050512 Bacteria 2474
332 nmdc:mga0rr50_17593_c1 3300050513 Bacteria 4776
333 nmdc:mga0a205_18783_c1 3300050515 Bacteria 6507
334 nmdc:mga0a205_62257_c1 3300050515 Bacteria 3605
335 Ga0495601_0098179 3300053077 Bacteria 1890
336 Ga0495655_0031456 3300053083 Bacteria 1291
337 Ga0501084_0026582 3300054114 Bacteria 4831
338 Ga0501084_0088060 3300054114 Bacteria 2607
339 Ga0501082_0109679 3300060353 Bacteria 2389
340 Ga0501082_0178613 3300060353 Bacteria 1846
341 Ga0466962_0026256 3300061719 Bacteria 2797
342 Ga0530510_0000691 3300061734 Bacteria 21833
343 Ga0530510_0033167 3300061734 Bacteria 3717
344 Ga0530510_0084143 3300061734 Bacteria 2317
345 Ga0530510_0188694 3300061734 Bacteria 1530
346 Ga0075430_100015553
347 LJQas_1000698
348 LJQas_1002089
349 JGI25406J46586_10012475
350 JGI25407J50210_10000344
351 JGI25407J50210_10005029
352 JGI25407J50210_10008555
353 JGI25407J50210_10028578
354 JGI25407J50210_10041541
355 Ga0070683_100002956
356 Ga0070683_100146156
357 Ga0070680_100005441
358 Ga0070680_100105919
359 Ga0070682_100055786
360 Ga0068868_100013031
361 Ga0070660_100004196
362 Ga0070660_100065366
363 Ga0070691_10032096
364 Ga0070691_10068090
365 Ga0070661_100053126
366 Ga0070692_10006341
367 Ga0070668_100021360
368 Ga0070668_100343248
369 Ga0070675_100106468
370 Ga0070674_100024128
371 Ga0070674_100026117
372 Ga0070659_100013220
373 Ga0070659_100013683
374 Ga0070714_100224374
375 Ga0070713_100209170
376 Ga0070713_100237231
377 Ga0070701_10077528
378 Ga0070700_100026565
379 Ga0070694_100116079
380 Ga0070663_100149338
381 Ga0070662_100004751
382 Ga0070662_100025455
383 Ga0070681_10004093
384 Ga0068867_100054380
385 Ga0070679_100007176
386 Ga0070679_100203475
387 Ga0070684_100006488
388 Ga0070684_100009236
389 Ga0070684_100030915
390 Ga0068853_100075657
391 Ga0070672_100041985
392 Ga0070686_100016412
393 Ga0070665_100000776
394 Ga0070664_100041203
395 Ga0068856_100157548
396 Ga0068856_100339280
397 Ga0068852_100264091
398 Ga0068852_100318883
399 Ga0068864_100213006
400 Ga0068861_100151486
401 Ga0068861_100193907
402 Ga0068858_100040137
403 Ga0081455_10036383
404 Ga0081455_10072612
405 Ga0081455_10076612
406 Ga0081455_10199173
407 Ga0081538_10000011
408 Ga0081538_10000091
409 Ga0081538_10000233
410 Ga0081538_10000444
411 Ga0081538_10001186
412 Ga0081538_10001554
413 Ga0081538_10006039
414 Ga0081538_10006489
415 Ga0081538_10007920
416 Ga0081538_10016027
417 Ga0081538_10020969
418 Ga0081538_10040689
419 Ga0081538_10056226
420 Ga0081538_10065255
421 Ga0081538_10070718
422 Ga0081540_1001151
423 Ga0081540_1031389
424 Ga0081539_10004903
425 Ga0075365_10000463
426 Ga0075364_10056691
427 Ga0075432_10005687
428 Ga0070716_100027727
429 Ga0070712_100072902
430 Ga0075367_10161392
431 Ga0075428_100099733
432 Ga0075428_100109933
433 Ga0075428_100131518
434 Ga0075428_100213726
435 Ga0075430_100051963
436 Ga0075430_100061105
437 Ga0075431_100008731
438 Ga0075431_100033137
439 Ga0075431_100130193
440 Ga0075431_100283997
441 Ga0075433_10017790
442 Ga0075433_10047370
443 Ga0075434_100014499
444 Ga0075429_100006901
445 Ga0075429_100008903
446 Ga0068865_100004502
447 Ga0105240_10017196
448 Ga0111539_10014923
449 Ga0105245_10008989
450 Ga0105245_10023067
451 Ga0105245_10491698
452 Ga0114129_10021796
453 Ga0114129_10141047
454 Ga0114129_10287421
455 Ga0105243_10012056
456 Ga0105237_10414729
457 Ga0105238_10012459
458 Ga0105249_10005992
459 Ga0105239_10077873
460 Ga0105239_10095598
461 Ga0105239_10106180
462 Ga0157371_10254225
463 Ga0157370_10022541
464 Ga0163162_10015752
465 Ga0157372_10095526
466 Ga0157372_10158520
467 Ga0157375_10038951
468 Ga0163163_10475255
469 Ga0157377_10029153
470 Ga0157379_10212902
471 Ga0163161_10044188
472 Ga0206355_1270016
473 Ga0206353_11002997
474 Ga0213873_10031859
475 Ga0213874_10013029
476 Ga0213876_10007246
477 Ga0213876_10008819
478 Ga0213876_10015466
479 Ga0207426_1034840
480 Ga0207692_10005291
481 Ga0207642_10063471
482 Ga0207688_10018570
483 Ga0207699_10052383
484 Ga0207705_10097964
485 Ga0207707_10011669
486 Ga0207695_10184397
487 Ga0207693_10008769
488 Ga0207663_10056257
489 Ga0207660_10009615
490 Ga0207657_10006078
491 Ga0207657_10090448
492 Ga0207649_10028563
493 Ga0207652_10106196
494 Ga0207652_10205997
495 Ga0207694_10072192
496 Ga0207659_10052029
497 Ga0207687_10052790
498 Ga0207700_10060907
499 Ga0207664_10098697
500 Ga0207690_10027785
501 Ga0207690_10114568
502 Ga0207706_10009597
503 Ga0207706_10016232
504 Ga0207670_10128431
505 Ga0207669_10190702
506 Ga0207704_10031510
507 Ga0207661_10005176
508 Ga0207661_10018285
509 Ga0207661_10076988
510 Ga0207668_10110509
511 Ga0207640_10076236
512 Ga0207677_10152276
513 Ga0207703_10217339
514 Ga0207639_10152994
515 Ga0207678_10082694
516 Ga0207708_10043827
517 Ga0207648_10108188
518 Ga0207674_10051441
519 Ga0207675_100015796
520 Ga0207675_100290429
521 Ga0207698_10020521
522 Ga0207698_10220969
523 Ga0207428_10020487
524 Ga0268266_10001853
525 Ga0268265_10063326
526 Ga0307408_100053979
527 Ga0307405_10011275
528 Ga0307405_10118543
529 Ga0307413_10021396
530 Ga0307413_10075922
531 Ga0307410_10035866
532 Ga0307406_10066940
533 Ga0307406_10109294
534 Ga0307407_10024152
535 Ga0307412_10068721
536 Ga0307409_100001728
537 Ga0307409_100023556
538 Ga0307409_100057459
539 Ga0307409_100163276
540 Ga0307416_100005034
541 Ga0307416_100023775
542 Ga0307416_100043782
543 Ga0307414_10021244
544 Ga0307411_10071558
545 Ga0307415_100005151
546 Ga0307415_100095522
547 Ga0307415_100363821
548 Ga0373954_0050238
549 Ga0373931_0014480
550 Ga0373937_0072056
551 Ga0316584_0087574
552 Ga0395900_0132140
553 Ga0395900_0220077
554 Ga0395900_0463244
555 Ga0395898_0066310
556 Ga0395898_0081960
557 Ga0395898_0469213
558 Ga0436364_0062488
559 Ga0436364_0358878
560 Ga0436364_0526722
561 Ga0436364_0978753
562 Ga0436364_1103593
563 Ga0436364_1224456
564 Ga0436364_1460198
565 Ga0395901_0006219
566 Ga0395901_0019378
567 Ga0395901_0140847
568 Ga0395901_0171741
569 Ga0436365_0285868
570 Ga0436365_0446783
571 Ga0436365_0554312
572 Ga0436365_1047232
573 Ga0436365_1278948
574 Ga0436365_1609438
575 Ga0436365_1727451
576 Ga0436360_0766804
577 Ga0436363_0415408
578 Ga0436363_1134294
579 Ga0436363_1592253
580 Ga0436362_0244100
581 Ga0436362_1276229
582 Ga0451577_0289639
583 Ga0453683_0000087
584 Ga0466966_0045784
585 Ga0466966_0103266
586 Ga0466961_0028722
587 Ga0466963_0001684
588 Ga0466963_0023468
589 Ga0466963_0095692
590 Ga0453684_0003198
591 Ga0466971_0003776
592 Ga0466970_0055587
593 Ga0466957_0015491
594 Ga0466957_0044371
595 Ga0466960_0103430
596 Ga0466959_0046156
597 Ga0466959_0108663
598 Ga0466959_0153455
599 Ga0466959_0215429
600 Ga0466959_0225119
601 Ga0466958_0011248
602 Ga0466958_0014109
603 Ga0466958_0019445
604 Ga0466967_0010810
605 Ga0466967_0014208
606 Ga0466967_0116030
607 Ga0495641_0149629
608 Ga0495651_0045717
609 Ga0495664_0040250
610 Ga0495608_0150988
611 Ga0495630_0014342
612 Ga0495630_0129407
613 Ga0495644_0066998
614 Ga0495640_0061314
615 Ga0495587_0007039
616 Ga0495599_0131248
617 Ga0495646_0034559
618 Ga0495658_0087067
619 Ga0495604_0008577
620 Ga0495674_0058428
621 Ga0495672_0030816
622 Ga0495680_0018362
623 Ga0495675_0132590
624 Ga0495684_0040360
625 Ga0495602_0011353
626 Ga0496100_0156925
627 Ga0496102_0204203
628 Ga0496104_0280524
629 Ga0496104_0404203
630 Ga0496104_0465689
631 Ga0496105_0301029
632 Ga0496106_0028378
633 Ga0496106_0215622
634 Ga0496108_0022532
635 Ga0496109_0069977
636 Ga0496109_0089656
637 Ga0496110_0425255
638 Ga0496110_0527139
639 Ga0496110_0565268
640 Ga0496111_0039598
641 Ga0496111_0063382
642 Ga0496111_0137498
643 Ga0496112_0099704
644 Ga0496113_0330375
645 Ga0501036_0188083
646 Ga0501036_0399243
647 Ga0501041_0049423
648 Ga0501041_0093040
649 Ga0501067_0149186
650 Ga0501072_0018023
651 Ga0501072_0140816
652 Ga0501076_0023794
653 Ga0501076_0117154
654 Ga0501077_0011904
655 Ga0501083_0136256
656 Ga0501045_0020595
657 Ga0501045_0099088
658 nmdc:mga00v17_52560_c1
659 nmdc:mga00v17_5503_c1
660 nmdc:mga05p37_151010_c1
661 nmdc:mga05p37_2618_c1
662 nmdc:mga05p37_271927_c1
663 nmdc:mga05p37_303623_c1
664 nmdc:mga05p37_324890_c1
665 nmdc:mga05p37_4742_c1
666 nmdc:mga05p37_482000_c1
667 nmdc:mga09592_7694_c1
668 nmdc:mga0qj67_11008_c1
669 nmdc:mga0qj67_18039_c1
670 nmdc:mga06r32_187219_c1
671 nmdc:mga06r32_23742_c1
672 nmdc:mga06r32_29438_c1
673 nmdc:mga06r32_37589_c1
674 nmdc:mga08y16_114004_c1
675 nmdc:mga08y16_24581_c1
676 nmdc:mga0n895_137129_c1
677 nmdc:mga0rr50_17593_c1
678 nmdc:mga0a205_18783_c1
679 nmdc:mga0a205_62257_c1
680 Ga0495601_0098179
681 Ga0495655_0031456
682 Ga0501084_0026582
683 Ga0501084_0088060
684 Ga0501082_0109679
685 Ga0501082_0178613
686 Ga0466962_0026256
687 Ga0530510_0000691
688 Ga0530510_0033167
689 Ga0530510_0084143
690 Ga0530510_0188694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07136

DUF1385

Protein of unknown function (DUF1385)

136

369

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b5h-assembly1.cif.gz_AO cryo-em structure of the contractile injection system base plate from anabaena pcc7120 0.4366 1 59
8coi-assembly10.cif.gz_J human adenovirus-derived synthetic addobody binder 0.3912 6 72
2lbf-assembly1.cif.gz_A solution structure of the dimerization domain of human ribosomal protein p1/p2 heterodimer 0.3814 163 229
2lbf-assembly1.cif.gz_A solution structure of the dimerization domain of human ribosomal protein p1/p2 heterodimer 0.331 163 229
7f02-assembly1.cif.gz_F cytochrome c-type biogenesis protein ccmabcd from e. coli 0.2549 54 307
ID Description Score Start End Superfamily
af_Q7T3E6_120_233_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.2869 1 53 3.10.20.90
af_Q55EQ7_392_598_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2788 59 290 1.20.1250.20
af_Q9FNC1_271_433_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2785 142 308 1.20.1250.20
af_Q55EQ7_392_598_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2605 59 290 1.20.1250.20
af_Q4D6D2_13_151_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.2525 1 41 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A3B9USD5-F1-model_v4 DUF1385 domain-containing protein 0.9778 132 213 GO:0016020
AF-A0A1Q7WYG1-F1-model_v4 Metal-dependent enzyme 0.9734 1 296 GO:0016020
AF-A0A1M3BN02-F1-model_v4 Metal-dependent enzyme 0.9635 1 309 GO:0016020
AF-A0A842UB63-F1-model_v4 DUF1385 domain-containing protein 0.9609 6 289 GO:0016020
AF-A0A1V4X6G0-F1-model_v4 DUF1385 domain-containing protein 0.9601 6 288 GO:0016020

Map