F416306

General Info

Members Datasets Scaffolds Average Seq Length
345 218 690 326

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10087569|Ga0081455_100875693
Length 324
Sequence MKLPHRRQFLHLAAGAAALPAISRFAWAQAYPTRPVRIIVGFATGGATDILARLLGQVLSERLGQQFVIENRTGAATNIATEAVVRAPPDGYTLLLVVPANAISATLYDNLNFNFIRDITPVASLLRVPFVMVVNPSFPAKTVPEFITYAKANPGKVKWASTGNATVTHVAGELFKMMAGVNMVNVPYRGDPHVDLLGRQVDVYFSPMPASIEYIKAGKLHGLAVTTATRSEALPDMATVDEFVPGYESSGWYGVGGPTGTPAEIVNKLNNEINAALADPQLKARLADLGGTVIAGSPADFGKLIADETEKWGKVIRAANIKLQ

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
136 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
137 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
138 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
139 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
140 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
145 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
146 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
166 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
167 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
181 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
191 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
194 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
195 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.32
Nodule 0
Rhizoplane 4.06
Rhizosphere 93.62
Stem 0
Stem Tuber 0
Unclassified 5.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10087569 3300005937 Bacteria 2533
2 JGI24748J21848_1011247 3300002074 Bacteria 1054
3 Ga0065712_10133361 3300005290 Bacteria 1524
4 Ga0065707_10088917 3300005295 Bacteria 4513
5 Ga0065707_10175418 3300005295 Bacteria 1454
6 Ga0070670_100235581 3300005331 Bacteria 1593
7 Ga0068869_100000262 3300005334 Bacteria 27673
8 Ga0070666_10058195 3300005335 Unclassified 2613
9 Ga0070682_100001657 3300005337 Bacteria 12385
10 Ga0068868_100000230 3300005338 Bacteria 38066
11 Ga0070689_100007621 3300005340 Bacteria 7580
12 Ga0070689_100064112 3300005340 Bacteria 2859
13 Ga0070691_10002481 3300005341 Bacteria 8203
14 Ga0070691_10087669 3300005341 Bacteria 1531
15 Ga0070687_100000189 3300005343 Bacteria 21407
16 Ga0070687_100069949 3300005343 Bacteria 1881
17 Ga0070692_10014109 3300005345 Bacteria 3742
18 Ga0070692_10138570 3300005345 Bacteria 1374
19 Ga0070668_100074454 3300005347 Bacteria 2649
20 Ga0070668_100079210 3300005347 Bacteria 2572
21 Ga0070669_100002992 3300005353 Bacteria 12179
22 Ga0070669_100020639 3300005353 Bacteria 4705
23 Ga0070675_100056087 3300005354 Bacteria 3245
24 Ga0070675_100123131 3300005354 Bacteria 2204
25 Ga0070671_100296803 3300005355 Bacteria 1376
26 Ga0070673_100234361 3300005364 Bacteria 1593
27 Ga0070673_100294078 3300005364 Bacteria 1428
28 Ga0070667_100409921 3300005367 Bacteria 1234
29 Ga0070701_10000638 3300005438 Bacteria 12280
30 Ga0070701_10021220 3300005438 Bacteria 3096
31 Ga0070701_10125372 3300005438 Bacteria 1453
32 Ga0070700_100000145 3300005441 Bacteria 42177
33 Ga0070700_100018847 3300005441 Bacteria 3974
34 Ga0070694_100122490 3300005444 Bacteria 1868
35 Ga0070663_100231035 3300005455 Bacteria 1456
36 Ga0070678_100050645 3300005456 Bacteria 3006
37 Ga0070681_10140885 3300005458 Unclassified 2341
38 Ga0068867_100012147 3300005459 Bacteria 6084
39 Ga0068867_100086053 3300005459 Bacteria 2377
40 Ga0068867_100129884 3300005459 Bacteria 1957
41 Ga0070685_10132423 3300005466 Bacteria 1561
42 Ga0070706_100053044 3300005467 Bacteria 3742
43 Ga0070698_100553850 3300005471 Bacteria 1089
44 Ga0070699_100165549 3300005518 Unclassified 1958
45 Ga0070699_100410863 3300005518 Bacteria 1224
46 Ga0070679_100011769 3300005530 Bacteria 8341
47 Ga0070697_100016772 3300005536 Bacteria 5761
48 Ga0070672_100093369 3300005543 Bacteria 2430
49 Ga0070686_100002139 3300005544 Bacteria 10886
50 Ga0070686_100167478 3300005544 Bacteria 1552
51 Ga0070695_100000178 3300005545 Bacteria 30212
52 Ga0070696_100000248 3300005546 Bacteria 32432
53 Ga0070693_100011756 3300005547 Bacteria 4414
54 Ga0070665_100174611 3300005548 Unclassified 2150
55 Ga0070704_100002435 3300005549 Bacteria 10440
56 Ga0068855_100034194 3300005563 Bacteria 6063
57 Ga0070702_100000014 3300005615 Bacteria 51486
58 Ga0070702_100143753 3300005615 Bacteria 1523
59 Ga0068852_100476371 3300005616 Bacteria 1240
60 Ga0068859_100003654 3300005617 Bacteria 15676
61 Ga0068859_100028841 3300005617 Bacteria 5566
62 Ga0068864_100141511 3300005618 Bacteria 2170
63 Ga0068866_10000777 3300005718 Bacteria 14329
64 Ga0068861_100000581 3300005719 Bacteria 21649
65 Ga0068861_100004645 3300005719 Bacteria 9218
66 Ga0068861_100038278 3300005719 Bacteria 3570
67 Ga0068861_100127262 3300005719 Bacteria 2063
68 Ga0068870_10001592 3300005840 Bacteria 9236
69 Ga0068870_10081177 3300005840 Bacteria 1793
70 Ga0068870_10136975 3300005840 Bacteria 1428
71 Ga0068863_100275289 3300005841 Bacteria 1630
72 Ga0068858_100004586 3300005842 Bacteria 13531
73 Ga0068858_100066833 3300005842 Bacteria 3329
74 Ga0068858_100140894 3300005842 Bacteria 2264
75 Ga0068860_100494119 3300005843 Bacteria 1221
76 Ga0068860_100509721 3300005843 Bacteria 1202
77 Ga0068862_100006705 3300005844 Bacteria 9555
78 Ga0068862_100089485 3300005844 Bacteria 2679
79 Ga0068862_100110790 3300005844 Bacteria 2409
80 Ga0068862_100411685 3300005844 Bacteria 1267
81 Ga0081455_10000162 3300005937 Bacteria 82078
82 Ga0081455_10017191 3300005937 Bacteria 6944
83 Ga0081455_10052110 3300005937 Bacteria 3506
84 Ga0081538_10017214 3300005981 Bacteria 5498
85 Ga0070717_10037487 3300006028 Bacteria 3937
86 Ga0075365_10010197 3300006038 Bacteria 5457
87 Ga0075365_10192275 3300006038 Bacteria 1428
88 Ga0075365_10294993 3300006038 Bacteria 1141
89 Ga0075364_10215374 3300006051 Bacteria 1303
90 Ga0075367_10115291 3300006178 Unclassified 1652
91 Ga0097621_100000525 3300006237 Bacteria 26865
92 Ga0068871_100003413 3300006358 Bacteria 10918
93 Ga0068871_100252491 3300006358 Bacteria 1536
94 Ga0075428_100132652 3300006844 Bacteria 2709
95 Ga0075430_100325776 3300006846 Bacteria 1270
96 Ga0075431_100187283 3300006847 Bacteria 2122
97 Ga0075431_100199432 3300006847 Unclassified 2048
98 Ga0075433_10001586 3300006852 Bacteria 16840
99 Ga0075433_10060272 3300006852 Plasmid 3322
100 Ga0075434_100023761 3300006871 Bacteria 5980
101 Ga0075429_100000078 3300006880 Bacteria 49626
102 Ga0068865_100004963 3300006881 Bacteria 8048
103 Ga0075436_100003801 3300006914 Bacteria 10357
104 Ga0075436_100008789 3300006914 Bacteria 6907
105 Ga0097620_100003654 3300006931 Bacteria 15676
106 Ga0097620_100028841 3300006931 Bacteria 5566
107 Ga0099794_10013248 3300007265 Bacteria 3584
108 Ga0099795_10044815 3300007788 Unclassified 1588
109 Ga0111539_10051895 3300009094 Bacteria 4883
110 Ga0111539_10109201 3300009094 Bacteria 3246
111 Ga0111539_10114142 3300009094 Unclassified 3168
112 Ga0111539_10165232 3300009094 Bacteria 2588
113 Ga0111539_10206616 3300009094 Bacteria 2289
114 Ga0105245_10001140 3300009098 Bacteria 24024
115 Ga0105245_10200256 3300009098 Bacteria 1917
116 Ga0105247_10142521 3300009101 Bacteria 1572
117 Ga0105247_10262261 3300009101 Bacteria 1185
118 Ga0114129_10000817 3300009147 Bacteria 40107
119 Ga0114129_10018955 3300009147 Bacteria 9801
120 Ga0114129_10225458 3300009147 Bacteria 2526
121 Ga0114129_10231264 3300009147 Bacteria 2490
122 Ga0105243_10049369 3300009148 Bacteria 3319
123 Ga0105243_10350583 3300009148 Bacteria 1355
124 Ga0105241_10018045 3300009174 Bacteria 5187
125 Ga0105242_10000610 3300009176 Bacteria 27965
126 Ga0105248_10091402 3300009177 Bacteria 3428
127 Ga0105237_10307148 3300009545 Bacteria 1589
128 Ga0105249_10033952 3300009553 Bacteria 4621
129 Ga0105249_10422725 3300009553 Bacteria 1367
130 Ga0099796_10003715 3300010159 Bacteria 3588
131 Ga0105239_10071817 3300010375 Bacteria 3803
132 Ga0105246_10035336 3300011119 Bacteria 3340
133 Ga0105246_10203948 3300011119 Bacteria 1539
134 Ga0157378_10001659 3300013297 Bacteria 20115
135 Ga0163162_10042157 3300013306 Bacteria 4567
136 Ga0163162_10294977 3300013306 Bacteria 1753
137 Ga0163162_10336812 3300013306 Bacteria 1641
138 Ga0157375_10197533 3300013308 Bacteria 2167
139 Ga0163163_10134394 3300014325 Bacteria 2514
140 Ga0157380_10006007 3300014326 Bacteria 8501
141 Ga0157380_10062907 3300014326 Bacteria 2975
142 Ga0157380_10064018 3300014326 Bacteria 2950
143 Ga0157377_10015417 3300014745 Bacteria 3910
144 Ga0157376_10073570 3300014969 Bacteria 2911
145 Ga0157376_10138459 3300014969 Bacteria 2181
146 Ga0157376_10274879 3300014969 Bacteria 1584
147 Ga0163161_10045938 3300017792 Bacteria 3150
148 Ga0207682_10001640 3300025893 Bacteria 10259
149 Ga0207642_10000667 3300025899 Bacteria 10555
150 Ga0207710_10024240 3300025900 Bacteria 2611
151 Ga0207688_10013697 3300025901 Bacteria 4408
152 Ga0207688_10029693 3300025901 Bacteria 3011
153 Ga0207688_10062145 3300025901 Bacteria 2106
154 Ga0207688_10223626 3300025901 Bacteria 1134
155 Ga0207680_10074918 3300025903 Unclassified 2109
156 Ga0207647_10058700 3300025904 Unclassified 2356
157 Ga0207685_10076509 3300025905 Bacteria 1372
158 Ga0207643_10039927 3300025908 Bacteria 2640
159 Ga0207643_10113825 3300025908 Bacteria 1596
160 Ga0207684_10182699 3300025910 Bacteria 1809
161 Ga0207654_10138513 3300025911 Unclassified 1549
162 Ga0207707_10216894 3300025912 Unclassified 1666
163 Ga0207660_10006068 3300025917 Bacteria 7841
164 Ga0207662_10000021 3300025918 Bacteria 72688
165 Ga0207662_10167389 3300025918 Bacteria 1408
166 Ga0207681_10070352 3300025923 Bacteria 2436
167 Ga0207650_10109713 3300025925 Bacteria 2134
168 Ga0207659_10050787 3300025926 Bacteria 2947
169 Ga0207659_10114123 3300025926 Bacteria 2059
170 Ga0207687_10000833 3300025927 Bacteria 20808
171 Ga0207686_10000804 3300025934 Bacteria 19247
172 Ga0207686_10286001 3300025934 Unclassified 1219
173 Ga0207709_10001152 3300025935 Bacteria 19245
174 Ga0207709_10004042 3300025935 Bacteria 8544
175 Ga0207670_10003028 3300025936 Bacteria 8861
176 Ga0207704_10000327 3300025938 Bacteria 22154
177 Ga0207704_10016809 3300025938 Bacteria 3772
178 Ga0207704_10267938 3300025938 Bacteria 1291
179 Ga0207704_10326794 3300025938 Bacteria 1185
180 Ga0207691_10015298 3300025940 Bacteria 7299
181 Ga0207691_10016533 3300025940 Bacteria 7006
182 Ga0207711_10182855 3300025941 Bacteria 1907
183 Ga0207689_10000426 3300025942 Bacteria 39509
184 Ga0207679_10293466 3300025945 Bacteria 1399
185 Ga0207667_10016330 3300025949 Bacteria 8390
186 Ga0207668_10003464 3300025972 Bacteria 9260
187 Ga0207668_10096904 3300025972 Bacteria 2181
188 Ga0207668_10195547 3300025972 Bacteria 1606
189 Ga0207640_10307804 3300025981 Bacteria 1256
190 Ga0207677_10028355 3300026023 Bacteria 3539
191 Ga0207703_10012010 3300026035 Bacteria 6745
192 Ga0207708_10000231 3300026075 Bacteria 44046
193 Ga0207708_10001982 3300026075 Bacteria 15088
194 Ga0207708_10285507 3300026075 Bacteria 1338
195 Ga0207648_10011511 3300026089 Bacteria 8329
196 Ga0207648_10035276 3300026089 Bacteria 4407
197 Ga0207648_10180259 3300026089 Bacteria 1869
198 Ga0207648_10363570 3300026089 Bacteria 1306
199 Ga0207676_10069541 3300026095 Bacteria 2819
200 Ga0207675_100000086 3300026118 Bacteria 72707
201 Ga0207675_100008419 3300026118 Bacteria 9723
202 Ga0207675_100261842 3300026118 Bacteria 1676
203 Ga0207683_10005215 3300026121 Bacteria 11157
204 Ga0207683_10062119 3300026121 Bacteria 3289
205 Ga0207683_10237152 3300026121 Bacteria 1664
206 Ga0207428_10000582 3300027907 Bacteria 43121
207 Ga0207428_10032659 3300027907 Bacteria 4279
208 Ga0268266_10035458 3300028379 Bacteria 4243
209 Ga0268266_10251336 3300028379 Unclassified 1635
210 Ga0268265_10001540 3300028380 Bacteria 19164
211 Ga0268265_10022052 3300028380 Bacteria 4470
212 Ga0268265_10043862 3300028380 Bacteria 3327
213 Ga0268265_10121355 3300028380 Bacteria 2154
214 Ga0268265_10267177 3300028380 Bacteria 1524
215 Ga0268264_10001620 3300028381 Bacteria 20799
216 Ga0268264_10470171 3300028381 Bacteria 1221
217 Ga0265330_10074630 3300031235 Bacteria 1465
218 Ga0265325_10017187 3300031241 Bacteria 4023
219 Ga0265329_10039234 3300031242 Bacteria 1522
220 Ga0265339_10055971 3300031249 Bacteria 2137
221 Ga0265316_10099153 3300031344 Bacteria 2216
222 Ga0373958_0006736 3300034819 Unclassified 1803
223 Ga0373926_0078831 3300035083 Bacteria 1216
224 Ga0373940_0008652 3300035088 Bacteria 2344
225 Ga0373944_0011075 3300035089 Bacteria 2467
226 Ga0373944_0033679 3300035089 Bacteria 1553
227 Ga0373949_0006402 3300035090 Bacteria 2590
228 Ga0373952_0003060 3300035092 Bacteria 3016
229 Ga0373932_0001975 3300035112 Bacteria 5413
230 Ga0373936_0016353 3300035113 Bacteria 2854
231 Ga0373939_0000701 3300035114 Bacteria 8291
232 Ga0373941_0024817 3300035115 Bacteria 1725
233 Ga0373945_0035618 3300035116 Bacteria 1779
234 Ga0373960_0002107 3300035121 Bacteria 4479
235 Ga0373943_0001929 3300035170 Bacteria 9394
236 Ga0373946_0003561 3300035171 Bacteria 5526
237 Ga0373942_0012654 3300035207 Unclassified 2020
238 Ga0373931_0001220 3300035691 Bacteria 10999
239 Ga0373931_0012121 3300035691 Bacteria 4173
240 Ga0373935_0001206 3300035692 Bacteria 14242
241 Ga0373935_0209452 3300035692 Bacteria 1350
242 Ga0373927_0016377 3300035695 Bacteria 4889
243 Ga0373927_0057138 3300035695 Bacteria 2523
244 Ga0373947_0003611 3300035725 Bacteria 9132
245 Ga0373947_0007033 3300035725 Bacteria 6522
246 Ga0373937_0247544 3300036401 Bacteria 1680
247 Ga0373925_0009636 3300037068 Bacteria 7036
248 Ga0373925_0026060 3300037068 Bacteria 4275
249 Ga0373925_0079590 3300037068 Bacteria 2490
250 Ga0373925_0100932 3300037068 Bacteria 2218
251 Ga0395898_0181969 3300037466 Bacteria 2009
252 Ga0395898_0231609 3300037466 Bacteria 1762
253 Ga0395901_0316264 3300038443 Bacteria 1616
254 Ga0395901_0323165 3300038443 Bacteria 1596
255 Ga0439453_0002432 3300041408 Bacteria 2570
256 Ga0453684_0126095 3300044712 Bacteria 3081
257 Ga0451576_0008768 3300045051 Bacteria 11831
258 Ga0495603_0014011 3300046455 Bacteria 4849
259 Ga0495603_0015984 3300046455 Bacteria 4537
260 Ga0495603_0054652 3300046455 Bacteria 2366
261 Ga0495641_0028493 3300046461 Bacteria 2702
262 Ga0495580_0002399 3300046472 Bacteria 16371
263 Ga0495582_0003860 3300046473 Bacteria 8437
264 Ga0495605_0131905 3300046474 Bacteria 1126
265 Ga0495639_0035410 3300046475 Bacteria 2233
266 Ga0495584_0053234 3300046491 Bacteria 2037
267 Ga0495585_0118812 3300046492 Bacteria 1400
268 Ga0495585_0136661 3300046492 Bacteria 1286
269 Ga0495585_0168803 3300046492 Bacteria 1131
270 Ga0495594_0088224 3300046499 Bacteria 1736
271 Ga0495594_0098604 3300046499 Bacteria 1643
272 Ga0495594_0211275 3300046499 Bacteria 1106
273 Ga0495630_0189459 3300046517 Bacteria 1569
274 Ga0495631_0088247 3300046518 Bacteria 1335
275 Ga0495637_0040980 3300046520 Bacteria 1990
276 Ga0495644_0095613 3300046523 Bacteria 1122
277 Ga0495666_0012998 3300046526 Bacteria 4150
278 Ga0495666_0037712 3300046526 Bacteria 2351
279 Ga0495586_0022564 3300046535 Bacteria 3359
280 Ga0495609_0085533 3300046538 Bacteria 1375
281 Ga0495621_0029827 3300046539 Bacteria 1861
282 Ga0495633_0082239 3300046558 Bacteria 1498
283 Ga0495656_0121240 3300046615 Bacteria 1234
284 Ga0495611_0133296 3300046648 Bacteria 1159
285 Ga0495659_0076949 3300046664 Bacteria 1259
286 Ga0495659_0085366 3300046664 Bacteria 1204
287 Ga0495661_0168423 3300046665 Bacteria 1170
288 Ga0495588_0189164 3300046674 Bacteria 1087
289 Ga0495647_0015034 3300046681 Bacteria 2706
290 Ga0495647_0026547 3300046681 Bacteria 2122
291 Ga0495658_0025506 3300046683 Bacteria 3160
292 Ga0495658_0026064 3300046683 Bacteria 3129
293 Ga0495669_0006976 3300046684 Bacteria 4730
294 Ga0495669_0016731 3300046684 Bacteria 3144
295 Ga0495624_0013593 3300046690 Bacteria 5549
296 Ga0495670_0134604 3300046691 Bacteria 1290
297 Ga0495670_0150305 3300046691 Bacteria 1221
298 Ga0495649_0142748 3300046694 Bacteria 1260
299 Ga0495589_0157514 3300046794 Bacteria 1082
300 Ga0495581_0140913 3300047315 Bacteria 1406
301 Ga0495676_0014517 3300047321 Bacteria 7048
302 Ga0495676_0014754 3300047321 Bacteria 6978
303 Ga0495676_0053955 3300047321 Bacteria 3199
304 Ga0495683_0076307 3300047323 Bacteria 1640
305 Ga0495677_0062653 3300047445 Bacteria 1380
306 Ga0495685_071415 3300047447 Bacteria 1162
307 Ga0496101_0238261 3300048904 Bacteria 1415
308 Ga0496104_0054914 3300048907 Bacteria 3765
309 Ga0496104_0281188 3300048907 Bacteria 1577
310 Ga0496104_0394266 3300048907 Bacteria 1296
311 Ga0496105_0117325 3300048908 Bacteria 2195
312 Ga0496106_0113506 3300048909 Unclassified 2112
313 Ga0496106_0127632 3300048909 Bacteria 1992
314 Ga0496108_0105092 3300048911 Bacteria 2410
315 Ga0496109_0088706 3300048912 Bacteria 2858
316 Ga0496109_0549476 3300048912 Bacteria 1089
317 Ga0496111_0189367 3300048914 Bacteria 1529
318 Ga0496111_0381010 3300048914 Bacteria 1043
319 Ga0496112_0101927 3300048915 Bacteria 2840
320 Ga0496115_0313853 3300048918 Bacteria 1283
321 Ga0501079_0158902 3300049741 Bacteria 1762
322 nmdc:mga03683_32105_c1 3300050489 Bacteria 2110
323 nmdc:mga00v17_26631_c1 3300050491 Bacteria 3371
324 nmdc:mga0yw44_189173_c1 3300050492 Bacteria 1357
325 nmdc:mga05p37_1018_c1 3300050507 Bacteria 31888
326 nmdc:mga05p37_124488_c1 3300050507 Bacteria 3166
327 nmdc:mga05p37_16727_c1 3300050507 Bacteria 8841
328 nmdc:mga05p37_354066_c1 3300050507 Bacteria 1728
329 nmdc:mga05p37_706_c1 3300050507 Bacteria 37016
330 nmdc:mga09592_4763_c1 3300050508 Bacteria 10996
331 nmdc:mga0qj67_12031_c1 3300050509 Bacteria 6504
332 nmdc:mga06r32_111922_c1 3300050510 Bacteria 2331
333 nmdc:mga06r32_52042_c1 3300050510 Bacteria 3921
334 nmdc:mga08y16_41060_c1 3300050511 Bacteria 4847
335 nmdc:mga08y16_67523_c1 3300050511 Bacteria 3729
336 nmdc:mga08y16_69027_c1 3300050511 Bacteria 3685
337 nmdc:mga08y16_84085_c1 3300050511 Unclassified 3317
338 nmdc:mga0n895_117824_c1 3300050512 Bacteria 2675
339 nmdc:mga0n895_129547_c1 3300050512 Bacteria 2548
340 nmdc:mga0a205_16778_c1 3300050515 Bacteria 6858
341 nmdc:mga0a205_80878_c1 3300050515 Plasmid 3139
342 nmdc:mga0a205_8592_c2 3300050515 Bacteria 5440
343 Ga0495601_0151170 3300053077 Bacteria 1516
344 Ga0495655_0032649 3300053083 Bacteria 1275
345 Ga0501084_0273608 3300054114 Bacteria 1426
346 Ga0081455_10087569
347 JGI24748J21848_1011247
348 Ga0065712_10133361
349 Ga0065707_10088917
350 Ga0065707_10175418
351 Ga0070670_100235581
352 Ga0068869_100000262
353 Ga0070666_10058195
354 Ga0070682_100001657
355 Ga0068868_100000230
356 Ga0070689_100007621
357 Ga0070689_100064112
358 Ga0070691_10002481
359 Ga0070691_10087669
360 Ga0070687_100000189
361 Ga0070687_100069949
362 Ga0070692_10014109
363 Ga0070692_10138570
364 Ga0070668_100074454
365 Ga0070668_100079210
366 Ga0070669_100002992
367 Ga0070669_100020639
368 Ga0070675_100056087
369 Ga0070675_100123131
370 Ga0070671_100296803
371 Ga0070673_100234361
372 Ga0070673_100294078
373 Ga0070667_100409921
374 Ga0070701_10000638
375 Ga0070701_10021220
376 Ga0070701_10125372
377 Ga0070700_100000145
378 Ga0070700_100018847
379 Ga0070694_100122490
380 Ga0070663_100231035
381 Ga0070678_100050645
382 Ga0070681_10140885
383 Ga0068867_100012147
384 Ga0068867_100086053
385 Ga0068867_100129884
386 Ga0070685_10132423
387 Ga0070706_100053044
388 Ga0070698_100553850
389 Ga0070699_100165549
390 Ga0070699_100410863
391 Ga0070679_100011769
392 Ga0070697_100016772
393 Ga0070672_100093369
394 Ga0070686_100002139
395 Ga0070686_100167478
396 Ga0070695_100000178
397 Ga0070696_100000248
398 Ga0070693_100011756
399 Ga0070665_100174611
400 Ga0070704_100002435
401 Ga0068855_100034194
402 Ga0070702_100000014
403 Ga0070702_100143753
404 Ga0068852_100476371
405 Ga0068859_100003654
406 Ga0068859_100028841
407 Ga0068864_100141511
408 Ga0068866_10000777
409 Ga0068861_100000581
410 Ga0068861_100004645
411 Ga0068861_100038278
412 Ga0068861_100127262
413 Ga0068870_10001592
414 Ga0068870_10081177
415 Ga0068870_10136975
416 Ga0068863_100275289
417 Ga0068858_100004586
418 Ga0068858_100066833
419 Ga0068858_100140894
420 Ga0068860_100494119
421 Ga0068860_100509721
422 Ga0068862_100006705
423 Ga0068862_100089485
424 Ga0068862_100110790
425 Ga0068862_100411685
426 Ga0081455_10000162
427 Ga0081455_10017191
428 Ga0081455_10052110
429 Ga0081538_10017214
430 Ga0070717_10037487
431 Ga0075365_10010197
432 Ga0075365_10192275
433 Ga0075365_10294993
434 Ga0075364_10215374
435 Ga0075367_10115291
436 Ga0097621_100000525
437 Ga0068871_100003413
438 Ga0068871_100252491
439 Ga0075428_100132652
440 Ga0075430_100325776
441 Ga0075431_100187283
442 Ga0075431_100199432
443 Ga0075433_10001586
444 Ga0075433_10060272
445 Ga0075434_100023761
446 Ga0075429_100000078
447 Ga0068865_100004963
448 Ga0075436_100003801
449 Ga0075436_100008789
450 Ga0097620_100003654
451 Ga0097620_100028841
452 Ga0099794_10013248
453 Ga0099795_10044815
454 Ga0111539_10051895
455 Ga0111539_10109201
456 Ga0111539_10114142
457 Ga0111539_10165232
458 Ga0111539_10206616
459 Ga0105245_10001140
460 Ga0105245_10200256
461 Ga0105247_10142521
462 Ga0105247_10262261
463 Ga0114129_10000817
464 Ga0114129_10018955
465 Ga0114129_10225458
466 Ga0114129_10231264
467 Ga0105243_10049369
468 Ga0105243_10350583
469 Ga0105241_10018045
470 Ga0105242_10000610
471 Ga0105248_10091402
472 Ga0105237_10307148
473 Ga0105249_10033952
474 Ga0105249_10422725
475 Ga0099796_10003715
476 Ga0105239_10071817
477 Ga0105246_10035336
478 Ga0105246_10203948
479 Ga0157378_10001659
480 Ga0163162_10042157
481 Ga0163162_10294977
482 Ga0163162_10336812
483 Ga0157375_10197533
484 Ga0163163_10134394
485 Ga0157380_10006007
486 Ga0157380_10062907
487 Ga0157380_10064018
488 Ga0157377_10015417
489 Ga0157376_10073570
490 Ga0157376_10138459
491 Ga0157376_10274879
492 Ga0163161_10045938
493 Ga0207682_10001640
494 Ga0207642_10000667
495 Ga0207710_10024240
496 Ga0207688_10013697
497 Ga0207688_10029693
498 Ga0207688_10062145
499 Ga0207688_10223626
500 Ga0207680_10074918
501 Ga0207647_10058700
502 Ga0207685_10076509
503 Ga0207643_10039927
504 Ga0207643_10113825
505 Ga0207684_10182699
506 Ga0207654_10138513
507 Ga0207707_10216894
508 Ga0207660_10006068
509 Ga0207662_10000021
510 Ga0207662_10167389
511 Ga0207681_10070352
512 Ga0207650_10109713
513 Ga0207659_10050787
514 Ga0207659_10114123
515 Ga0207687_10000833
516 Ga0207686_10000804
517 Ga0207686_10286001
518 Ga0207709_10001152
519 Ga0207709_10004042
520 Ga0207670_10003028
521 Ga0207704_10000327
522 Ga0207704_10016809
523 Ga0207704_10267938
524 Ga0207704_10326794
525 Ga0207691_10015298
526 Ga0207691_10016533
527 Ga0207711_10182855
528 Ga0207689_10000426
529 Ga0207679_10293466
530 Ga0207667_10016330
531 Ga0207668_10003464
532 Ga0207668_10096904
533 Ga0207668_10195547
534 Ga0207640_10307804
535 Ga0207677_10028355
536 Ga0207703_10012010
537 Ga0207708_10000231
538 Ga0207708_10001982
539 Ga0207708_10285507
540 Ga0207648_10011511
541 Ga0207648_10035276
542 Ga0207648_10180259
543 Ga0207648_10363570
544 Ga0207676_10069541
545 Ga0207675_100000086
546 Ga0207675_100008419
547 Ga0207675_100261842
548 Ga0207683_10005215
549 Ga0207683_10062119
550 Ga0207683_10237152
551 Ga0207428_10000582
552 Ga0207428_10032659
553 Ga0268266_10035458
554 Ga0268266_10251336
555 Ga0268265_10001540
556 Ga0268265_10022052
557 Ga0268265_10043862
558 Ga0268265_10121355
559 Ga0268265_10267177
560 Ga0268264_10001620
561 Ga0268264_10470171
562 Ga0265330_10074630
563 Ga0265325_10017187
564 Ga0265329_10039234
565 Ga0265339_10055971
566 Ga0265316_10099153
567 Ga0373958_0006736
568 Ga0373926_0078831
569 Ga0373940_0008652
570 Ga0373944_0011075
571 Ga0373944_0033679
572 Ga0373949_0006402
573 Ga0373952_0003060
574 Ga0373932_0001975
575 Ga0373936_0016353
576 Ga0373939_0000701
577 Ga0373941_0024817
578 Ga0373945_0035618
579 Ga0373960_0002107
580 Ga0373943_0001929
581 Ga0373946_0003561
582 Ga0373942_0012654
583 Ga0373931_0001220
584 Ga0373931_0012121
585 Ga0373935_0001206
586 Ga0373935_0209452
587 Ga0373927_0016377
588 Ga0373927_0057138
589 Ga0373947_0003611
590 Ga0373947_0007033
591 Ga0373937_0247544
592 Ga0373925_0009636
593 Ga0373925_0026060
594 Ga0373925_0079590
595 Ga0373925_0100932
596 Ga0395898_0181969
597 Ga0395898_0231609
598 Ga0395901_0316264
599 Ga0395901_0323165
600 Ga0439453_0002432
601 Ga0453684_0126095
602 Ga0451576_0008768
603 Ga0495603_0014011
604 Ga0495603_0015984
605 Ga0495603_0054652
606 Ga0495641_0028493
607 Ga0495580_0002399
608 Ga0495582_0003860
609 Ga0495605_0131905
610 Ga0495639_0035410
611 Ga0495584_0053234
612 Ga0495585_0118812
613 Ga0495585_0136661
614 Ga0495585_0168803
615 Ga0495594_0088224
616 Ga0495594_0098604
617 Ga0495594_0211275
618 Ga0495630_0189459
619 Ga0495631_0088247
620 Ga0495637_0040980
621 Ga0495644_0095613
622 Ga0495666_0012998
623 Ga0495666_0037712
624 Ga0495586_0022564
625 Ga0495609_0085533
626 Ga0495621_0029827
627 Ga0495633_0082239
628 Ga0495656_0121240
629 Ga0495611_0133296
630 Ga0495659_0076949
631 Ga0495659_0085366
632 Ga0495661_0168423
633 Ga0495588_0189164
634 Ga0495647_0015034
635 Ga0495647_0026547
636 Ga0495658_0025506
637 Ga0495658_0026064
638 Ga0495669_0006976
639 Ga0495669_0016731
640 Ga0495624_0013593
641 Ga0495670_0134604
642 Ga0495670_0150305
643 Ga0495649_0142748
644 Ga0495589_0157514
645 Ga0495581_0140913
646 Ga0495676_0014517
647 Ga0495676_0014754
648 Ga0495676_0053955
649 Ga0495683_0076307
650 Ga0495677_0062653
651 Ga0495685_071415
652 Ga0496101_0238261
653 Ga0496104_0054914
654 Ga0496104_0281188
655 Ga0496104_0394266
656 Ga0496105_0117325
657 Ga0496106_0113506
658 Ga0496106_0127632
659 Ga0496108_0105092
660 Ga0496109_0088706
661 Ga0496109_0549476
662 Ga0496111_0189367
663 Ga0496111_0381010
664 Ga0496112_0101927
665 Ga0496115_0313853
666 Ga0501079_0158902
667 nmdc:mga03683_32105_c1
668 nmdc:mga00v17_26631_c1
669 nmdc:mga0yw44_189173_c1
670 nmdc:mga05p37_1018_c1
671 nmdc:mga05p37_124488_c1
672 nmdc:mga05p37_16727_c1
673 nmdc:mga05p37_354066_c1
674 nmdc:mga05p37_706_c1
675 nmdc:mga09592_4763_c1
676 nmdc:mga0qj67_12031_c1
677 nmdc:mga06r32_111922_c1
678 nmdc:mga06r32_52042_c1
679 nmdc:mga08y16_41060_c1
680 nmdc:mga08y16_67523_c1
681 nmdc:mga08y16_69027_c1
682 nmdc:mga08y16_84085_c1
683 nmdc:mga0n895_117824_c1
684 nmdc:mga0n895_129547_c1
685 nmdc:mga0a205_16778_c1
686 nmdc:mga0a205_80878_c1
687 nmdc:mga0a205_8592_c2
688 Ga0495601_0151170
689 Ga0495655_0032649
690 Ga0501084_0273608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

51

321

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9753 31 324
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9662 35 326
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9622 30 326
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9562 31 324
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9531 31 324
ID Description Score Start End Superfamily
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9579 130 245 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9567 129 250 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9553 129 245 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.942 129 250 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9346 129 250 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A537THX8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9838 178 323
AF-A0A1F4AHA8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9806 56 323
AF-A0A1F4B8I5-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9802 26 324
AF-A0A5C8CF86-F1-model_v4 deleted 0.9802 42 326
AF-A0A1J5PQ67-F1-model_v4 Tripartite tricarboxylate transporter family receptor 0.9797 68 324

Map