F416271

General Info

Members Datasets Scaffolds Average Seq Length
345 169 690 319

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100034310|Ga0070708_1000343102
Length 333
Sequence MMTIMALYLITGIGGFIGSSLARALLGRGERVRGVDNFATGKRENLTDIRGQIDLREASILDPDAMKSICSGVDYVLHQAAIPSVPKSVLDPIGNNQANVDGTVNVLVAARDAKVRRVVYAASSSAYGDTPTLPKHEEMTPSPISPYAVAKLASEHYMTSFYRCYGLETVSLRYFNIFGPHQDPSSPYSGVLAKFITQMLCGDRPTIFGDGEQSRDFTFIDNAVQANLLACEAPVSQAAGRVFNIATGRRVTLNEMFSALQKLTGYSGTPEYGPERGGDIKHSLADISKAEKHLGYKPKVNFEQGLGLTVDWYRQQRKALPENKDKETASLPS

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
56 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
57 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
98 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
99 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 1.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.48
Rhizosphere 95.65
Stem 0
Stem Tuber 0
Unclassified 7.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100034310 3300005445 Bacteria 4414
2 LJNas_1002092 3300000546 Bacteria 2523
3 Ga0058861_10047353 3300004800 Bacteria 1353
4 Ga0068869_100265171 3300005334 Bacteria 1376
5 Ga0070680_100026622 3300005336 Bacteria 4625
6 Ga0070680_100455625 3300005336 Bacteria 1093
7 Ga0070682_100050244 3300005337 Bacteria 2603
8 Ga0070682_100055464 3300005337 Bacteria 2489
9 Ga0070703_10002102 3300005406 Bacteria 5806
10 Ga0070709_10009672 3300005434 Bacteria 5325
11 Ga0070709_10011843 3300005434 Bacteria 4870
12 Ga0070709_10046280 3300005434 Bacteria 2704
13 Ga0070709_10081144 3300005434 Bacteria 2116
14 Ga0070709_10092445 3300005434 Bacteria 1998
15 Ga0070714_100004121 3300005435 Bacteria 10930
16 Ga0070714_100070544 3300005435 Bacteria 3020
17 Ga0070713_100000243 3300005436 Bacteria 35877
18 Ga0070713_100001016 3300005436 Bacteria 17953
19 Ga0070713_100035746 3300005436 Bacteria 4003
20 Ga0070710_10022089 3300005437 Bacteria 3325
21 Ga0070711_100000185 3300005439 Bacteria 32884
22 Ga0070711_100013088 3300005439 Bacteria 5203
23 Ga0070711_100025132 3300005439 Bacteria 3894
24 Ga0070711_100289475 3300005439 Bacteria 1299
25 Ga0070705_100009713 3300005440 Bacteria 4793
26 Ga0070694_100023705 3300005444 Bacteria 3951
27 Ga0070708_100000117 3300005445 Bacteria 52877
28 Ga0070708_100045475 3300005445 Unclassified 3867
29 Ga0070708_100066717 3300005445 Unclassified 3230
30 Ga0070708_100101384 3300005445 Unclassified 2636
31 Ga0070708_100195038 3300005445 Bacteria 1895
32 Ga0070708_100210177 3300005445 Unclassified 1823
33 Ga0070708_100393673 3300005445 Bacteria 1306
34 Ga0070681_10015200 3300005458 Bacteria 7656
35 Ga0070681_10162598 3300005458 Bacteria 2156
36 Ga0070706_100001122 3300005467 Bacteria 28963
37 Ga0070707_100000816 3300005468 Bacteria 30839
38 Ga0070707_100236083 3300005468 Bacteria 1780
39 Ga0070707_100290510 3300005468 Bacteria 1588
40 Ga0070707_100297244 3300005468 Bacteria 1569
41 Ga0070698_100002599 3300005471 Bacteria 19891
42 Ga0070698_100004564 3300005471 Bacteria 15208
43 Ga0070698_100007303 3300005471 Bacteria 11962
44 Ga0070699_100001000 3300005518 Bacteria 26291
45 Ga0070699_100009381 3300005518 Bacteria 8477
46 Ga0070699_100020200 3300005518 Bacteria 5741
47 Ga0070699_100025660 3300005518 Bacteria 5080
48 Ga0070699_100034179 3300005518 Unclassified 4394
49 Ga0070699_100314382 3300005518 Bacteria 1406
50 Ga0070679_100004271 3300005530 Bacteria 13179
51 Ga0070679_100004575 3300005530 Bacteria 12772
52 Ga0070679_100103833 3300005530 Unclassified 2828
53 Ga0070697_100004037 3300005536 Bacteria 11258
54 Ga0070697_100043767 3300005536 Unclassified 3626
55 Ga0070697_100065185 3300005536 Bacteria 2976
56 Ga0070695_100000093 3300005545 Bacteria 38335
57 Ga0070695_100030705 3300005545 Bacteria 3347
58 Ga0070696_100002002 3300005546 Bacteria 13360
59 Ga0070693_100001159 3300005547 Bacteria 11829
60 Ga0070665_100000967 3300005548 Bacteria 36509
61 Ga0070704_100000727 3300005549 Bacteria 16101
62 Ga0068859_100056869 3300005617 Bacteria 3939
63 Ga0068859_100157240 3300005617 Bacteria 2351
64 Ga0068863_100001420 3300005841 Bacteria 23717
65 Ga0068863_100002633 3300005841 Bacteria 17773
66 Ga0068863_100182412 3300005841 Bacteria 2015
67 Ga0068858_100027128 3300005842 Bacteria 5321
68 Ga0068858_100233412 3300005842 Bacteria 1744
69 Ga0070717_10016077 3300006028 Bacteria 5795
70 Ga0070717_10036136 3300006028 Bacteria 4004
71 Ga0070717_10037200 3300006028 Bacteria 3951
72 Ga0070717_10091337 3300006028 Bacteria 2571
73 Ga0070715_10016471 3300006163 Bacteria 2778
74 Ga0070716_100000484 3300006173 Bacteria 16473
75 Ga0070716_100002630 3300006173 Bacteria 8297
76 Ga0070716_100021952 3300006173 Bacteria 3369
77 Ga0070716_100024022 3300006173 Bacteria 3240
78 Ga0070716_100111130 3300006173 Bacteria 1698
79 Ga0070716_100159363 3300006173 Bacteria 1460
80 Ga0070712_100000103 3300006175 Bacteria 43249
81 Ga0070712_100030440 3300006175 Bacteria 3626
82 Ga0070712_100155277 3300006175 Bacteria 1762
83 Ga0070712_100164523 3300006175 Bacteria 1716
84 Ga0097621_100173214 3300006237 Bacteria 1861
85 Ga0068871_100045595 3300006358 Bacteria 3529
86 Ga0075428_100206786 3300006844 Bacteria 2121
87 Ga0075433_10122475 3300006852 Bacteria 2310
88 Ga0075434_100004133 3300006871 Bacteria 13015
89 Ga0075434_100019018 3300006871 Bacteria 6639
90 Ga0075434_100023506 3300006871 Bacteria 6009
91 Ga0075434_100070937 3300006871 Bacteria 3475
92 Ga0075436_100000934 3300006914 Bacteria 19503
93 Ga0075436_100003119 3300006914 Bacteria 11359
94 Ga0075436_100008385 3300006914 Bacteria 7068
95 Ga0097620_100056869 3300006931 Bacteria 3939
96 Ga0097620_100157241 3300006931 Bacteria 2351
97 Ga0075435_100042463 3300007076 Bacteria 3638
98 Ga0075435_100061907 3300007076 Bacteria 3037
99 Ga0075435_100091015 3300007076 Bacteria 2517
100 Ga0075435_100157090 3300007076 Bacteria 1914
101 Ga0075435_100170331 3300007076 Bacteria 1837
102 Ga0099794_10001542 3300007265 Bacteria 8115
103 Ga0099794_10003170 3300007265 Bacteria 6235
104 Ga0099794_10004448 3300007265 Bacteria 5511
105 Ga0099794_10006057 3300007265 Bacteria 4884
106 Ga0099794_10006998 3300007265 Bacteria 4603
107 Ga0099794_10022261 3300007265 Bacteria 2888
108 Ga0099794_10026389 3300007265 Bacteria 2685
109 Ga0099794_10028818 3300007265 Bacteria 2584
110 Ga0099794_10040865 3300007265 Bacteria 2207
111 Ga0099794_10049291 3300007265 Bacteria 2023
112 Ga0099794_10072170 3300007265 Bacteria 1692
113 Ga0099794_10137334 3300007265 Bacteria 1237
114 Ga0099795_10015004 3300007788 Bacteria 2416
115 Ga0105240_10013818 3300009093 Bacteria 11060
116 Ga0105240_10105881 3300009093 Unclassified 3413
117 Ga0105247_10044629 3300009101 Bacteria 2719
118 Ga0114129_10131781 3300009147 Unclassified 3432
119 Ga0105237_10045467 3300009545 Bacteria 4418
120 Ga0099796_10012157 3300010159 Bacteria 2422
121 Ga0105239_10120561 3300010375 Bacteria 2912
122 Ga0157369_10073481 3300013105 Bacteria 3669
123 Ga0157369_10170287 3300013105 Bacteria 2295
124 Ga0157378_10009864 3300013297 Bacteria 8323
125 Ga0157378_10452430 3300013297 Bacteria 1275
126 Ga0163162_10009110 3300013306 Bacteria 9652
127 Ga0157375_10330063 3300013308 Bacteria 1690
128 Ga0157375_10358864 3300013308 Unclassified 1623
129 Ga0157376_10000017 3300014969 Bacteria 268501
130 Ga0157376_10000143 3300014969 Bacteria 49045
131 Ga0157376_10187009 3300014969 Bacteria 1897
132 Ga0224570_100557 3300022730 Bacteria 2944
133 Ga0228598_1000471 3300024227 Bacteria 8229
134 Ga0228598_1013041 3300024227 Unclassified 1646
135 Ga0228598_1032931 3300024227 Unclassified 1021
136 Ga0207653_10000535 3300025885 Bacteria 14220
137 Ga0207692_10005442 3300025898 Bacteria 5101
138 Ga0207692_10019219 3300025898 Bacteria 3084
139 Ga0207692_10141492 3300025898 Bacteria 1369
140 Ga0207685_10033249 3300025905 Unclassified 1862
141 Ga0207685_10053890 3300025905 Bacteria 1564
142 Ga0207699_10000703 3300025906 Bacteria 15956
143 Ga0207699_10008698 3300025906 Bacteria 5022
144 Ga0207699_10008912 3300025906 Bacteria 4974
145 Ga0207699_10059624 3300025906 Bacteria 2288
146 Ga0207699_10069937 3300025906 Bacteria 2142
147 Ga0207699_10107134 3300025906 Bacteria 1785
148 Ga0207699_10341624 3300025906 Bacteria 1055
149 Ga0207684_10002584 3300025910 Bacteria 18133
150 Ga0207684_10017928 3300025910 Bacteria 6069
151 Ga0207684_10238521 3300025910 Bacteria 1569
152 Ga0207707_10035423 3300025912 Bacteria 4365
153 Ga0207693_10000653 3300025915 Bacteria 31074
154 Ga0207693_10000901 3300025915 Bacteria 26654
155 Ga0207693_10025993 3300025915 Bacteria 4636
156 Ga0207693_10143882 3300025915 Bacteria 1875
157 Ga0207663_10026244 3300025916 Bacteria 3379
158 Ga0207663_10087805 3300025916 Bacteria 2055
159 Ga0207663_10114105 3300025916 Bacteria 1838
160 Ga0207663_10267206 3300025916 Bacteria 1266
161 Ga0207663_10296624 3300025916 Bacteria 1206
162 Ga0207660_10000731 3300025917 Bacteria 21858
163 Ga0207660_10070197 3300025917 Bacteria 2546
164 Ga0207652_10006946 3300025921 Bacteria 9120
165 Ga0207652_10041567 3300025921 Bacteria 3909
166 Ga0207646_10000086 3300025922 Bacteria 125294
167 Ga0207646_10032663 3300025922 Bacteria 4709
168 Ga0207646_10072547 3300025922 Bacteria 3075
169 Ga0207646_10077736 3300025922 Bacteria 2965
170 Ga0207646_10213572 3300025922 Bacteria 1742
171 Ga0207646_10280991 3300025922 Bacteria 1504
172 Ga0207700_10000137 3300025928 Bacteria 43639
173 Ga0207700_10000146 3300025928 Bacteria 41769
174 Ga0207700_10011204 3300025928 Bacteria 5708
175 Ga0207700_10137202 3300025928 Bacteria 2005
176 Ga0207700_10140029 3300025928 Bacteria 1987
177 Ga0207700_10389288 3300025928 Bacteria 1220
178 Ga0207664_10081067 3300025929 Bacteria 2639
179 Ga0207665_10000023 3300025939 Bacteria 104745
180 Ga0207665_10002298 3300025939 Bacteria 12907
181 Ga0207665_10003692 3300025939 Bacteria 10226
182 Ga0207665_10019503 3300025939 Bacteria 4458
183 Ga0207665_10031120 3300025939 Bacteria 3530
184 Ga0207665_10072998 3300025939 Bacteria 2345
185 Ga0207665_10073533 3300025939 Bacteria 2338
186 Ga0207665_10114805 3300025939 Unclassified 1896
187 Ga0207665_10170208 3300025939 Bacteria 1572
188 Ga0207665_10178786 3300025939 Bacteria 1536
189 Ga0207665_10254574 3300025939 Bacteria 1298
190 Ga0207711_10156950 3300025941 Bacteria 2057
191 Ga0207703_10134005 3300026035 Bacteria 2143
192 Ga0207703_10257901 3300026035 Bacteria 1575
193 Ga0207702_10063225 3300026078 Bacteria 3164
194 Ga0207641_10002610 3300026088 Bacteria 16534
195 Ga0207641_10032783 3300026088 Bacteria 4314
196 Ga0207641_10052214 3300026088 Bacteria 3462
197 Ga0209588_1004065 3300027671 Bacteria 4096
198 Ga0209588_1008111 3300027671 Bacteria 3107
199 Ga0209588_1009361 3300027671 Bacteria 2927
200 Ga0209588_1009605 3300027671 Unclassified 2894
201 Ga0209588_1027132 3300027671 Bacteria 1821
202 Ga0209588_1050491 3300027671 Bacteria 1345
203 Ga0265356_1000172 3300028017 Bacteria 11961
204 Ga0268266_10000444 3300028379 Bacteria 61604
205 Ga0268264_10058007 3300028381 Bacteria 3240
206 Ga0265338_10002715 3300028800 Bacteria 25972
207 Ga0265338_10025817 3300028800 Bacteria 5946
208 Ga0265338_10027961 3300028800 Bacteria 5641
209 Ga0265338_10228127 3300028800 Bacteria 1387
210 Ga0265338_10347604 3300028800 Bacteria 1067
211 Ga0265762_1001680 3300030760 Bacteria 4027
212 Ga0265765_1002485 3300030879 Bacteria 1790
213 Ga0265760_10032723 3300031090 Bacteria 1536
214 Ga0265330_10030798 3300031235 Bacteria 2407
215 Ga0265325_10023850 3300031241 Bacteria 3334
216 Ga0265340_10010790 3300031247 Bacteria 4880
217 Ga0265339_10015061 3300031249 Unclassified 4647
218 Ga0265331_10019310 3300031250 Bacteria 3520
219 Ga0265331_10022280 3300031250 Bacteria 3234
220 Ga0265316_10021878 3300031344 Bacteria 5406
221 Ga0265316_10095073 3300031344 Bacteria 2270
222 Ga0265316_10179929 3300031344 Archaea 1574
223 Ga0307408_100093118 3300031548 Bacteria 2279
224 Ga0265313_10018104 3300031595 Bacteria 3970
225 Ga0265313_10063037 3300031595 Unclassified 1730
226 Ga0265313_10077961 3300031595 Bacteria 1512
227 Ga0307410_10003541 3300031852 Bacteria 7856
228 Ga0307406_10012989 3300031901 Bacteria 4761
229 Ga0307409_100015271 3300031995 Bacteria 5033
230 Ga0307409_100033831 3300031995 Bacteria 3725
231 Ga0307414_10288757 3300032004 Bacteria 1382
232 Ga0307411_10057110 3300032005 Bacteria 2576
233 Ga0307415_100018193 3300032126 Bacteria 4237
234 Ga0316212_1000375 3300033547 Bacteria 5314
235 Ga0373926_0022065 3300035083 Bacteria 2208
236 Ga0373926_0029707 3300035083 Bacteria 1922
237 Ga0373953_0005768 3300035117 Bacteria 4041
238 Ga0373954_0001367 3300035118 Bacteria 9844
239 Ga0373956_0002288 3300035119 Bacteria 7878
240 Ga0373956_0007073 3300035119 Bacteria 4514
241 Ga0373957_0015708 3300035120 Bacteria 2611
242 Ga0373943_0062424 3300035170 Bacteria 1865
243 Ga0373946_0005752 3300035171 Bacteria 4486
244 Ga0373955_0000607 3300035172 Bacteria 15291
245 Ga0373927_0003703 3300035695 Bacteria 10873
246 Ga0373933_0000748 3300035724 Bacteria 19856
247 Ga0373933_0002836 3300035724 Bacteria 9679
248 Ga0373947_0062551 3300035725 Bacteria 2265
249 Ga0373937_0000170 3300036401 Bacteria 63587
250 Ga0373937_0005465 3300036401 Bacteria 10881
251 Ga0373937_0008132 3300036401 Bacteria 9105
252 Ga0373937_0230728 3300036401 Bacteria 1743
253 Ga0373925_0106510 3300037068 Bacteria 2161
254 Ga0395900_0191552 3300037418 Unclassified 2074
255 Ga0395898_0123846 3300037466 Bacteria 2477
256 Ga0395898_0127867 3300037466 Unclassified 2434
257 Ga0395905_0127928 3300037471 Bacteria 2389
258 Ga0395901_0042257 3300038443 Bacteria 4726
259 Ga0436365_0408380 3300039437 Unclassified 1718
260 Ga0436363_0908516 3300039450 Bacteria 1362
261 Ga0451577_0025947 3300042876 Bacteria 5310
262 Ga0453683_0014294 3300044673 Bacteria 5157
263 Ga0466963_0000795 3300044694 Bacteria 15738
264 Ga0466963_0058279 3300044694 Bacteria 2575
265 Ga0453684_0002640 3300044712 Bacteria 42842
266 Ga0451576_0026217 3300045051 Bacteria 6270
267 Ga0495603_0038390 3300046455 Bacteria 2872
268 Ga0495603_0050736 3300046455 Bacteria 2466
269 Ga0495629_0000005 3300046459 Bacteria 404868
270 Ga0495629_0014400 3300046459 Bacteria 5689
271 Ga0495629_0039021 3300046459 Bacteria 3344
272 Ga0495641_0022657 3300046461 Bacteria 3137
273 Ga0495651_0011232 3300046462 Bacteria 6883
274 Ga0495651_0245160 3300046462 Bacteria 1226
275 Ga0495653_0215764 3300046463 Bacteria 1293
276 Ga0495580_0000773 3300046472 Bacteria 27533
277 Ga0495580_0032605 3300046472 Bacteria 3758
278 Ga0495580_0043190 3300046472 Unclassified 3209
279 Ga0495580_0046184 3300046472 Bacteria 3091
280 Ga0495580_0064459 3300046472 Bacteria 2568
281 Ga0495582_0007285 3300046473 Bacteria 6129
282 Ga0495582_0007326 3300046473 Bacteria 6113
283 Ga0495582_0050216 3300046473 Bacteria 2298
284 Ga0495639_0016710 3300046475 Unclassified 3187
285 Ga0495662_0136319 3300046476 Bacteria 1207
286 Ga0495664_0031654 3300046477 Bacteria 3102
287 Ga0495594_0093283 3300046499 Bacteria 1688
288 Ga0495628_0046090 3300046516 Bacteria 3464
289 Ga0495630_0023123 3300046517 Bacteria 4593
290 Ga0495666_0025303 3300046526 Bacteria 2931
291 Ga0495652_0020036 3300046529 Bacteria 5949
292 Ga0495652_0156546 3300046529 Bacteria 1774
293 Ga0495586_0044619 3300046535 Unclassified 2388
294 Ga0495587_0001244 3300046536 Bacteria 16917
295 Ga0495587_0002448 3300046536 Bacteria 12391
296 Ga0495587_0111587 3300046536 Bacteria 1570
297 Ga0495645_0061827 3300046543 Bacteria 2713
298 Ga0495622_0039565 3300046557 Bacteria 2196
299 Ga0495635_0030379 3300046663 Bacteria 3755
300 Ga0495623_0048383 3300046679 Bacteria 2697
301 Ga0495647_0007727 3300046681 Bacteria 3610
302 Ga0495658_0010869 3300046683 Bacteria 4561
303 Ga0495613_0017447 3300046689 Bacteria 5345
304 Ga0495624_0025223 3300046690 Bacteria 3906
305 Ga0495604_0000424 3300047317 Bacteria 38047
306 Ga0495604_0037598 3300047317 Bacteria 3811
307 Ga0495674_0063808 3300047319 Bacteria 3203
308 Ga0495676_0152151 3300047321 Bacteria 1645
309 Ga0495680_0039847 3300047322 Bacteria 3745
310 Ga0495675_0006645 3300047444 Bacteria 7083
311 Ga0495684_0029425 3300047471 Unclassified 4216
312 Ga0495602_0000456 3300048088 Bacteria 38089
313 Ga0495602_0004422 3300048088 Bacteria 14666
314 Ga0495614_0052874 3300048089 Bacteria 1741
315 Ga0496100_0102115 3300048903 Bacteria 1978
316 Ga0496102_0050225 3300048905 Bacteria 3797
317 Ga0496103_0066377 3300048906 Unclassified 2252
318 Ga0496106_0048769 3300048909 Bacteria 3190
319 Ga0496107_0038772 3300048910 Bacteria 3417
320 Ga0496107_0041224 3300048910 Bacteria 3315
321 Ga0496110_0348618 3300048913 Bacteria 1349
322 Ga0496114_0015423 3300048917 Bacteria 6146
323 Ga0496114_0497661 3300048917 Bacteria 1078
324 Ga0496115_0005417 3300048918 Bacteria 9281
325 Ga0496115_0038920 3300048918 Bacteria 3776
326 Ga0496115_0087239 3300048918 Bacteria 2546
327 nmdc:mga05p37_193953_c1 3300050507 Unclassified 2464
328 nmdc:mga06r32_330051_c1 3300050510 Bacteria 1510
329 nmdc:mga0n895_100992_c1 3300050512 Bacteria 2894
330 nmdc:mga0n895_20213_c1 3300050512 Bacteria 6204
331 nmdc:mga0n895_73746_c1 3300050512 Bacteria 3389
332 nmdc:mga0rr50_129494_c1 3300050513 Bacteria 2018
333 nmdc:mga0rr50_13496_c1 3300050513 Bacteria 5320
334 nmdc:mga0rr50_182036_c1 3300050513 Bacteria 1718
335 nmdc:mga0rr50_255252_c1 3300050513 Bacteria 1457
336 nmdc:mga0rr50_26657_c1 3300050513 Bacteria 4036
337 nmdc:mga0rr50_281242_c1 3300050513 Bacteria 1388
338 nmdc:mga0rr50_34426_c1 3300050513 Bacteria 3627
339 nmdc:mga0rr50_70829_c1 3300050513 Bacteria 2658
340 nmdc:mga08x19_123_c1 3300050514 Bacteria 68147
341 nmdc:mga08x19_32226_c1 3300050514 Unclassified 3301
342 nmdc:mga08x19_413_c1 3300050514 Bacteria 29764
343 nmdc:mga08x19_7590_c1 3300050514 Bacteria 6442
344 nmdc:mga0a205_109906_c1 3300050515 Bacteria 2655
345 Ga0495601_0011527 3300053077 Bacteria 5295
346 Ga0070708_100034310
347 LJNas_1002092
348 Ga0058861_10047353
349 Ga0068869_100265171
350 Ga0070680_100026622
351 Ga0070680_100455625
352 Ga0070682_100050244
353 Ga0070682_100055464
354 Ga0070703_10002102
355 Ga0070709_10009672
356 Ga0070709_10011843
357 Ga0070709_10046280
358 Ga0070709_10081144
359 Ga0070709_10092445
360 Ga0070714_100004121
361 Ga0070714_100070544
362 Ga0070713_100000243
363 Ga0070713_100001016
364 Ga0070713_100035746
365 Ga0070710_10022089
366 Ga0070711_100000185
367 Ga0070711_100013088
368 Ga0070711_100025132
369 Ga0070711_100289475
370 Ga0070705_100009713
371 Ga0070694_100023705
372 Ga0070708_100000117
373 Ga0070708_100045475
374 Ga0070708_100066717
375 Ga0070708_100101384
376 Ga0070708_100195038
377 Ga0070708_100210177
378 Ga0070708_100393673
379 Ga0070681_10015200
380 Ga0070681_10162598
381 Ga0070706_100001122
382 Ga0070707_100000816
383 Ga0070707_100236083
384 Ga0070707_100290510
385 Ga0070707_100297244
386 Ga0070698_100002599
387 Ga0070698_100004564
388 Ga0070698_100007303
389 Ga0070699_100001000
390 Ga0070699_100009381
391 Ga0070699_100020200
392 Ga0070699_100025660
393 Ga0070699_100034179
394 Ga0070699_100314382
395 Ga0070679_100004271
396 Ga0070679_100004575
397 Ga0070679_100103833
398 Ga0070697_100004037
399 Ga0070697_100043767
400 Ga0070697_100065185
401 Ga0070695_100000093
402 Ga0070695_100030705
403 Ga0070696_100002002
404 Ga0070693_100001159
405 Ga0070665_100000967
406 Ga0070704_100000727
407 Ga0068859_100056869
408 Ga0068859_100157240
409 Ga0068863_100001420
410 Ga0068863_100002633
411 Ga0068863_100182412
412 Ga0068858_100027128
413 Ga0068858_100233412
414 Ga0070717_10016077
415 Ga0070717_10036136
416 Ga0070717_10037200
417 Ga0070717_10091337
418 Ga0070715_10016471
419 Ga0070716_100000484
420 Ga0070716_100002630
421 Ga0070716_100021952
422 Ga0070716_100024022
423 Ga0070716_100111130
424 Ga0070716_100159363
425 Ga0070712_100000103
426 Ga0070712_100030440
427 Ga0070712_100155277
428 Ga0070712_100164523
429 Ga0097621_100173214
430 Ga0068871_100045595
431 Ga0075428_100206786
432 Ga0075433_10122475
433 Ga0075434_100004133
434 Ga0075434_100019018
435 Ga0075434_100023506
436 Ga0075434_100070937
437 Ga0075436_100000934
438 Ga0075436_100003119
439 Ga0075436_100008385
440 Ga0097620_100056869
441 Ga0097620_100157241
442 Ga0075435_100042463
443 Ga0075435_100061907
444 Ga0075435_100091015
445 Ga0075435_100157090
446 Ga0075435_100170331
447 Ga0099794_10001542
448 Ga0099794_10003170
449 Ga0099794_10004448
450 Ga0099794_10006057
451 Ga0099794_10006998
452 Ga0099794_10022261
453 Ga0099794_10026389
454 Ga0099794_10028818
455 Ga0099794_10040865
456 Ga0099794_10049291
457 Ga0099794_10072170
458 Ga0099794_10137334
459 Ga0099795_10015004
460 Ga0105240_10013818
461 Ga0105240_10105881
462 Ga0105247_10044629
463 Ga0114129_10131781
464 Ga0105237_10045467
465 Ga0099796_10012157
466 Ga0105239_10120561
467 Ga0157369_10073481
468 Ga0157369_10170287
469 Ga0157378_10009864
470 Ga0157378_10452430
471 Ga0163162_10009110
472 Ga0157375_10330063
473 Ga0157375_10358864
474 Ga0157376_10000017
475 Ga0157376_10000143
476 Ga0157376_10187009
477 Ga0224570_100557
478 Ga0228598_1000471
479 Ga0228598_1013041
480 Ga0228598_1032931
481 Ga0207653_10000535
482 Ga0207692_10005442
483 Ga0207692_10019219
484 Ga0207692_10141492
485 Ga0207685_10033249
486 Ga0207685_10053890
487 Ga0207699_10000703
488 Ga0207699_10008698
489 Ga0207699_10008912
490 Ga0207699_10059624
491 Ga0207699_10069937
492 Ga0207699_10107134
493 Ga0207699_10341624
494 Ga0207684_10002584
495 Ga0207684_10017928
496 Ga0207684_10238521
497 Ga0207707_10035423
498 Ga0207693_10000653
499 Ga0207693_10000901
500 Ga0207693_10025993
501 Ga0207693_10143882
502 Ga0207663_10026244
503 Ga0207663_10087805
504 Ga0207663_10114105
505 Ga0207663_10267206
506 Ga0207663_10296624
507 Ga0207660_10000731
508 Ga0207660_10070197
509 Ga0207652_10006946
510 Ga0207652_10041567
511 Ga0207646_10000086
512 Ga0207646_10032663
513 Ga0207646_10072547
514 Ga0207646_10077736
515 Ga0207646_10213572
516 Ga0207646_10280991
517 Ga0207700_10000137
518 Ga0207700_10000146
519 Ga0207700_10011204
520 Ga0207700_10137202
521 Ga0207700_10140029
522 Ga0207700_10389288
523 Ga0207664_10081067
524 Ga0207665_10000023
525 Ga0207665_10002298
526 Ga0207665_10003692
527 Ga0207665_10019503
528 Ga0207665_10031120
529 Ga0207665_10072998
530 Ga0207665_10073533
531 Ga0207665_10114805
532 Ga0207665_10170208
533 Ga0207665_10178786
534 Ga0207665_10254574
535 Ga0207711_10156950
536 Ga0207703_10134005
537 Ga0207703_10257901
538 Ga0207702_10063225
539 Ga0207641_10002610
540 Ga0207641_10032783
541 Ga0207641_10052214
542 Ga0209588_1004065
543 Ga0209588_1008111
544 Ga0209588_1009361
545 Ga0209588_1009605
546 Ga0209588_1027132
547 Ga0209588_1050491
548 Ga0265356_1000172
549 Ga0268266_10000444
550 Ga0268264_10058007
551 Ga0265338_10002715
552 Ga0265338_10025817
553 Ga0265338_10027961
554 Ga0265338_10228127
555 Ga0265338_10347604
556 Ga0265762_1001680
557 Ga0265765_1002485
558 Ga0265760_10032723
559 Ga0265330_10030798
560 Ga0265325_10023850
561 Ga0265340_10010790
562 Ga0265339_10015061
563 Ga0265331_10019310
564 Ga0265331_10022280
565 Ga0265316_10021878
566 Ga0265316_10095073
567 Ga0265316_10179929
568 Ga0307408_100093118
569 Ga0265313_10018104
570 Ga0265313_10063037
571 Ga0265313_10077961
572 Ga0307410_10003541
573 Ga0307406_10012989
574 Ga0307409_100015271
575 Ga0307409_100033831
576 Ga0307414_10288757
577 Ga0307411_10057110
578 Ga0307415_100018193
579 Ga0316212_1000375
580 Ga0373926_0022065
581 Ga0373926_0029707
582 Ga0373953_0005768
583 Ga0373954_0001367
584 Ga0373956_0002288
585 Ga0373956_0007073
586 Ga0373957_0015708
587 Ga0373943_0062424
588 Ga0373946_0005752
589 Ga0373955_0000607
590 Ga0373927_0003703
591 Ga0373933_0000748
592 Ga0373933_0002836
593 Ga0373947_0062551
594 Ga0373937_0000170
595 Ga0373937_0005465
596 Ga0373937_0008132
597 Ga0373937_0230728
598 Ga0373925_0106510
599 Ga0395900_0191552
600 Ga0395898_0123846
601 Ga0395898_0127867
602 Ga0395905_0127928
603 Ga0395901_0042257
604 Ga0436365_0408380
605 Ga0436363_0908516
606 Ga0451577_0025947
607 Ga0453683_0014294
608 Ga0466963_0000795
609 Ga0466963_0058279
610 Ga0453684_0002640
611 Ga0451576_0026217
612 Ga0495603_0038390
613 Ga0495603_0050736
614 Ga0495629_0000005
615 Ga0495629_0014400
616 Ga0495629_0039021
617 Ga0495641_0022657
618 Ga0495651_0011232
619 Ga0495651_0245160
620 Ga0495653_0215764
621 Ga0495580_0000773
622 Ga0495580_0032605
623 Ga0495580_0043190
624 Ga0495580_0046184
625 Ga0495580_0064459
626 Ga0495582_0007285
627 Ga0495582_0007326
628 Ga0495582_0050216
629 Ga0495639_0016710
630 Ga0495662_0136319
631 Ga0495664_0031654
632 Ga0495594_0093283
633 Ga0495628_0046090
634 Ga0495630_0023123
635 Ga0495666_0025303
636 Ga0495652_0020036
637 Ga0495652_0156546
638 Ga0495586_0044619
639 Ga0495587_0001244
640 Ga0495587_0002448
641 Ga0495587_0111587
642 Ga0495645_0061827
643 Ga0495622_0039565
644 Ga0495635_0030379
645 Ga0495623_0048383
646 Ga0495647_0007727
647 Ga0495658_0010869
648 Ga0495613_0017447
649 Ga0495624_0025223
650 Ga0495604_0000424
651 Ga0495604_0037598
652 Ga0495674_0063808
653 Ga0495676_0152151
654 Ga0495680_0039847
655 Ga0495675_0006645
656 Ga0495684_0029425
657 Ga0495602_0000456
658 Ga0495602_0004422
659 Ga0495614_0052874
660 Ga0496100_0102115
661 Ga0496102_0050225
662 Ga0496103_0066377
663 Ga0496106_0048769
664 Ga0496107_0038772
665 Ga0496107_0041224
666 Ga0496110_0348618
667 Ga0496114_0015423
668 Ga0496114_0497661
669 Ga0496115_0005417
670 Ga0496115_0038920
671 Ga0496115_0087239
672 nmdc:mga05p37_193953_c1
673 nmdc:mga06r32_330051_c1
674 nmdc:mga0n895_100992_c1
675 nmdc:mga0n895_20213_c1
676 nmdc:mga0n895_73746_c1
677 nmdc:mga0rr50_129494_c1
678 nmdc:mga0rr50_13496_c1
679 nmdc:mga0rr50_182036_c1
680 nmdc:mga0rr50_255252_c1
681 nmdc:mga0rr50_26657_c1
682 nmdc:mga0rr50_281242_c1
683 nmdc:mga0rr50_34426_c1
684 nmdc:mga0rr50_70829_c1
685 nmdc:mga08x19_123_c1
686 nmdc:mga08x19_32226_c1
687 nmdc:mga08x19_413_c1
688 nmdc:mga08x19_7590_c1
689 nmdc:mga0a205_109906_c1
690 Ga0495601_0011527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

8

246

0.96

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

9

309

0.87

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

9

269

0.8

PF13460

NAD_binding_10

NAD(P)H-binding

12

173

0.8

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

8

294

0.75

PF07993

NAD_binding_4

Male sterility protein

37

226

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sb8-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4-epimerase complexed with udp-n-acetylgalactosamine 0.971 2 314
1sb8-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4-epimerase complexed with udp-n-acetylgalactosamine 0.965 2 314
4zrn-assembly1.cif.gz_B crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima 0.9641 3 312
3ru9-assembly1.cif.gz_A specific recognition of n-acetylated substrates and domain flexibility in wbgu: a udp-galnac 4-epimerase 0.9624 2 314
6wjb-assembly1.cif.gz_A udp-glcnac c4-epimerase from pseudomonas protegens in complex with nad and udp-glcnac 0.9618 3 307
ID Description Score Start End Superfamily
6dntA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9617 2 242 3.40.50.720
af_Q2G289_4_319_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9459 1 313 3.40.50.720
4zrnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9451 3 242 3.40.50.720
6dntA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9432 2 242 3.40.50.720
4zrmB02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9429 175 311 3.90.25.10
ID Description Score Start End GO Terms
AF-A0A1F8R7A1-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9916 73 308
AF-A0A7X7SLU6-F1-model_v4 UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase) 0.9909 4 178 GO:0016491
GO:0033499
AF-A0A7V2XJE6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9892 1 313
AF-A0A7C3TWQ2-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9858 3 171
AF-A0A7C2EL58-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9856 88 313 GO:0016491

Map