F416238

General Info

Members Datasets Scaffolds Average Seq Length
345 184 691 357

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100000017|Ga0068869_10000001738
Length 400
Sequence MSGRRAEGNWFVRTAYNRNWSKEVYSFDLASRETLFPPAAGDPRMISIRIQNLTKRFGPTVALRNLDLTINPGELFFLLGPSGCGKTTLLRSLAGFYIPEEGSIHFGDEDVTSLAPHNRNTGMMFQSYALWPHMTLAENVAFGLEERKVPKAEIKRRVAEALGSVHMGAYAERKPNQLSGGQQQRVALARALVIRPRCLLLDEPLSNLDAKLRLEMRAEIRRVCKEFNLTTVYVTHDQKEALSISDRMAILDGGKILQVGSPKEVYRRPTCKTVAHFIGETDFIEGRVLGTEQGHIAIETAIGRFLGVAGDPAFSPTAGAMVTLSIRPECWKLGREPKAHNAVRGRIGESVYLGEVAQYAFVAGAVTLKIYELNPRFVGATSDGDLVASVEPDDVVVLGA

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
85 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
86 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
87 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
88 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
89 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
92 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
93 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
137 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
180 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
184 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.16
Nodule 0
Rhizoplane 0.87
Rhizosphere 89.86
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100000017 3300005334 Bacteria 69630
2 JGI24033J26618_1000134 3300002155 Bacteria 9766
3 rootH1_10049462 3300003316 Bacteria 3729
4 rootH1_10049462 3300003323 Bacteria 1783
5 rootL2_10142820 3300003322 Bacteria 3823
6 Ga0070658_10020358 3300005327 Bacteria 5316
7 Ga0070670_100049119 3300005331 Bacteria 3629
8 Ga0068868_100026617 3300005338 Bacteria 4410
9 Ga0068868_100030588 3300005338 Bacteria 4129
10 Ga0070661_100003563 3300005344 Bacteria 10720
11 Ga0070671_100001886 3300005355 Bacteria 16027
12 Ga0070671_100099191 3300005355 Bacteria 2443
13 Ga0070667_100002554 3300005367 Bacteria 15824
14 Ga0070667_100044150 3300005367 Bacteria 3742
15 Ga0070667_100147114 3300005367 Bacteria 2067
16 Ga0070667_100183351 3300005367 Bacteria 1852
17 Ga0070713_100028637 3300005436 Bacteria 4400
18 Ga0070713_100046774 3300005436 Bacteria 3552
19 Ga0070713_100109064 3300005436 Bacteria 2411
20 Ga0070678_100061195 3300005456 Bacteria 2774
21 Ga0068867_100000462 3300005459 Bacteria 26980
22 Ga0068867_100064044 3300005459 Bacteria 2733
23 Ga0070706_100152112 3300005467 Bacteria 2160
24 Ga0070698_100024386 3300005471 Bacteria 6313
25 Ga0070679_100020275 3300005530 Bacteria 6480
26 Ga0070684_100067125 3300005535 Bacteria 3149
27 Ga0068853_100058465 3300005539 Bacteria 3328
28 Ga0070665_100000324 3300005548 Bacteria 73458
29 Ga0070665_100004412 3300005548 Bacteria 14780
30 Ga0070665_100016615 3300005548 Bacteria 7375
31 Ga0070665_100033520 3300005548 Bacteria 5167
32 Ga0070665_100076733 3300005548 Bacteria 3348
33 Ga0068855_100218655 3300005563 Bacteria 2137
34 Ga0070664_100425392 3300005564 Bacteria 1217
35 Ga0068857_100168743 3300005577 Bacteria 1988
36 Ga0068856_100000326 3300005614 Bacteria 52440
37 Ga0068856_100029595 3300005614 Bacteria 5350
38 Ga0068856_100337279 3300005614 Bacteria 1526
39 Ga0068852_100158969 3300005616 Bacteria 2108
40 Ga0068859_100001446 3300005617 Bacteria 24083
41 Ga0068859_100130133 3300005617 Bacteria 2588
42 Ga0068861_100007767 3300005719 Bacteria 7370
43 Ga0068863_100026904 3300005841 Bacteria 5485
44 Ga0068863_100188228 3300005841 Bacteria 1983
45 Ga0068858_100000923 3300005842 Bacteria 30501
46 Ga0068858_100030303 3300005842 Bacteria 5023
47 Ga0068860_100003837 3300005843 Bacteria 15454
48 Ga0068860_100083126 3300005843 Bacteria 3045
49 Ga0068862_100011075 3300005844 Bacteria 7450
50 Ga0068862_100253481 3300005844 Bacteria 1605
51 Ga0081539_10004551 3300005985 Bacteria 15185
52 Ga0070717_10000243 3300006028 Bacteria 37415
53 Ga0097621_100001508 3300006237 Bacteria 15947
54 Ga0097621_100028881 3300006237 Bacteria 4376
55 Ga0068871_100005827 3300006358 Bacteria 8659
56 Ga0075431_100030134 3300006847 Bacteria 5587
57 Ga0075429_100206554 3300006880 Bacteria 1721
58 Ga0097620_100001446 3300006931 Bacteria 24083
59 Ga0097620_100130134 3300006931 Bacteria 2588
60 Ga0105250_10070041 3300009092 Bacteria 1416
61 Ga0105240_10046435 3300009093 Bacteria 5503
62 Ga0105240_10066916 3300009093 Bacteria 4455
63 Ga0105240_10387375 3300009093 Bacteria 1577
64 Ga0111539_10000750 3300009094 Bacteria 42148
65 Ga0111539_10083155 3300009094 Bacteria 3765
66 Ga0111539_10285140 3300009094 Bacteria 1922
67 Ga0105247_10001598 3300009101 Bacteria 16036
68 Ga0105241_10023761 3300009174 Bacteria 4548
69 Ga0105248_10022827 3300009177 Bacteria 6947
70 Ga0105248_10308571 3300009177 Bacteria 1782
71 Ga0105237_10035839 3300009545 Bacteria 5019
72 Ga0105237_10042401 3300009545 Bacteria 4588
73 Ga0105237_10123747 3300009545 Bacteria 2581
74 Ga0105237_10133242 3300009545 Bacteria 2480
75 Ga0105237_10238996 3300009545 Bacteria 1817
76 Ga0105238_10056189 3300009551 Bacteria 3949
77 Ga0105249_10045264 3300009553 Bacteria 4002
78 Ga0105249_10108362 3300009553 Bacteria 2622
79 Ga0105239_10135792 3300010375 Bacteria 2738
80 Ga0157369_10208145 3300013105 Bacteria 2051
81 Ga0157369_10295142 3300013105 Bacteria 1687
82 Ga0157374_10542714 3300013296 Bacteria 1170
83 Ga0157378_10006585 3300013297 Bacteria 10147
84 Ga0157378_10133961 3300013297 Bacteria 2296
85 Ga0163162_10210334 3300013306 Bacteria 2075
86 Ga0157372_10096864 3300013307 Bacteria 3363
87 Ga0157372_10226271 3300013307 Bacteria 2168
88 Ga0157375_10190803 3300013308 Bacteria 2204
89 Ga0163163_10009513 3300014325 Bacteria 8680
90 Ga0163163_10011889 3300014325 Bacteria 7917
91 Ga0157380_10022716 3300014326 Bacteria 4728
92 Ga0213876_10001205 3300021384 Bacteria 16300
93 Ga0213876_10007486 3300021384 Bacteria 5938
94 Ga0207710_10000727 3300025900 Bacteria 18232
95 Ga0207705_10029504 3300025909 Bacteria 3910
96 Ga0207684_10099017 3300025910 Bacteria 2490
97 Ga0207695_10000022 3300025913 Bacteria 659090
98 Ga0207695_10000112 3300025913 Bacteria 248037
99 Ga0207695_10161304 3300025913 Bacteria 2173
100 Ga0207671_10003083 3300025914 Bacteria 17008
101 Ga0207671_10071531 3300025914 Bacteria 2587
102 Ga0207671_10090331 3300025914 Bacteria 2306
103 Ga0207671_10174166 3300025914 Bacteria 1672
104 Ga0207649_10000291 3300025920 Bacteria 38912
105 Ga0207652_10007960 3300025921 Bacteria 8507
106 Ga0207659_10038913 3300025926 Bacteria 3311
107 Ga0207700_10018043 3300025928 Bacteria 4730
108 Ga0207700_10034059 3300025928 Bacteria 3652
109 Ga0207700_10044884 3300025928 Bacteria 3257
110 Ga0207664_10056546 3300025929 Bacteria 3116
111 Ga0207665_10199226 3300025939 Bacteria 1458
112 Ga0207691_10151818 3300025940 Bacteria 2036
113 Ga0207711_10304564 3300025941 Bacteria 1470
114 Ga0207689_10000045 3300025942 Bacteria 92506
115 Ga0207658_10055706 3300025986 Bacteria 2931
116 Ga0207677_10014870 3300026023 Bacteria 4559
117 Ga0207677_10037100 3300026023 Bacteria 3183
118 Ga0207703_10002339 3300026035 Bacteria 16532
119 Ga0207703_10006629 3300026035 Bacteria 9237
120 Ga0207678_10057973 3300026067 Bacteria 3333
121 Ga0207702_10020727 3300026078 Bacteria 5436
122 Ga0207702_10200978 3300026078 Bacteria 1847
123 Ga0207641_10012327 3300026088 Bacteria 7013
124 Ga0207641_10032236 3300026088 Bacteria 4350
125 Ga0207641_10102841 3300026088 Bacteria 2520
126 Ga0207641_10166276 3300026088 Bacteria 2009
127 Ga0207641_10408677 3300026088 Bacteria 1305
128 Ga0207648_10002579 3300026089 Bacteria 19408
129 Ga0207674_10001845 3300026116 Bacteria 27004
130 Ga0207675_100031126 3300026118 Bacteria 4969
131 Ga0207683_10059897 3300026121 Bacteria 3345
132 Ga0268266_10000569 3300028379 Bacteria 50961
133 Ga0268266_10001113 3300028379 Bacteria 33626
134 Ga0268266_10006411 3300028379 Bacteria 10779
135 Ga0268266_10020805 3300028379 Bacteria 5595
136 Ga0268266_10031548 3300028379 Bacteria 4501
137 Ga0268265_10012386 3300028380 Bacteria 5780
138 Ga0268264_10000415 3300028381 Bacteria 60291
139 Ga0265337_1004799 3300028556 Bacteria 5533
140 Ga0265319_1000043 3300028563 Bacteria 109696
141 Ga0265319_1003661 3300028563 Bacteria 7929
142 Ga0265319_1007614 3300028563 Bacteria 4841
143 Ga0265319_1015662 3300028563 Bacteria 2932
144 Ga0265319_1027994 3300028563 Bacteria 1992
145 Ga0265334_10001381 3300028573 Bacteria 11709
146 Ga0265334_10007766 3300028573 Bacteria 4593
147 Ga0265334_10008433 3300028573 Bacteria 4380
148 Ga0265318_10000690 3300028577 Bacteria 22719
149 Ga0265318_10001300 3300028577 Bacteria 15021
150 Ga0265318_10001623 3300028577 Bacteria 12986
151 Ga0265318_10001908 3300028577 Bacteria 11684
152 Ga0265318_10003174 3300028577 Bacteria 8392
153 Ga0265318_10008570 3300028577 Bacteria 4542
154 Ga0265322_10016911 3300028654 Bacteria 2104
155 Ga0265322_10019251 3300028654 Bacteria 1959
156 Ga0265336_10033658 3300028666 Bacteria 1586
157 Ga0265336_10037110 3300028666 Bacteria 1499
158 Ga0265338_10000329 3300028800 Bacteria 86337
159 Ga0265338_10002172 3300028800 Bacteria 30147
160 Ga0265338_10077494 3300028800 Bacteria 2809
161 Ga0265324_10004195 3300029957 Bacteria 6596
162 Ga0265324_10005568 3300029957 Bacteria 5415
163 Ga0307511_10004557 3300030521 Bacteria 14132
164 Ga0307511_10053468 3300030521 Bacteria 3200
165 Ga0265328_10053923 3300031239 Bacteria 1475
166 Ga0265328_10055870 3300031239 Bacteria 1449
167 Ga0265320_10000080 3300031240 Bacteria 82925
168 Ga0265320_10000254 3300031240 Bacteria 43938
169 Ga0265320_10003550 3300031240 Bacteria 10434
170 Ga0265320_10004162 3300031240 Bacteria 9505
171 Ga0265320_10006669 3300031240 Bacteria 7254
172 Ga0265320_10007778 3300031240 Bacteria 6622
173 Ga0265320_10008047 3300031240 Bacteria 6489
174 Ga0265320_10014078 3300031240 Bacteria 4573
175 Ga0265320_10018248 3300031240 Bacteria 3870
176 Ga0265320_10031876 3300031240 Bacteria 2704
177 Ga0265320_10042512 3300031240 Bacteria 2253
178 Ga0265320_10053399 3300031240 Bacteria 1953
179 Ga0265320_10091697 3300031240 Bacteria 1407
180 Ga0265325_10013562 3300031241 Bacteria 4634
181 Ga0265331_10002392 3300031250 Bacteria 12731
182 Ga0265327_10000057 3300031251 Bacteria 242754
183 Ga0265327_10001538 3300031251 Bacteria 28469
184 Ga0265327_10004625 3300031251 Bacteria 12088
185 Ga0265327_10016496 3300031251 Bacteria 4686
186 Ga0265327_10104808 3300031251 Bacteria 1359
187 Ga0265316_10000887 3300031344 Bacteria 32794
188 Ga0265316_10008033 3300031344 Bacteria 9847
189 Ga0265316_10016788 3300031344 Bacteria 6338
190 Ga0265316_10036921 3300031344 Bacteria 3950
191 Ga0265316_10043693 3300031344 Bacteria 3569
192 Ga0307509_10000017 3300031507 Bacteria 265012
193 Ga0307408_100000017 3300031548 Bacteria 355890
194 Ga0265313_10000228 3300031595 Bacteria 60668
195 Ga0265313_10001658 3300031595 Bacteria 20635
196 Ga0265313_10002369 3300031595 Bacteria 16406
197 Ga0265313_10006935 3300031595 Bacteria 7869
198 Ga0307508_10000574 3300031616 Bacteria 43711
199 Ga0265314_10003092 3300031711 Bacteria 16386
200 Ga0265314_10007701 3300031711 Bacteria 9312
201 Ga0265314_10008049 3300031711 Bacteria 9081
202 Ga0265314_10156226 3300031711 Bacteria 1393
203 Ga0265342_10004316 3300031712 Bacteria 11255
204 Ga0265342_10022491 3300031712 Bacteria 4007
205 Ga0307410_10000096 3300031852 Bacteria 30297
206 Ga0307407_10005136 3300031903 Bacteria 5645
207 Ga0307407_10013149 3300031903 Bacteria 4004
208 Ga0307407_10138060 3300031903 Bacteria 1569
209 Ga0307412_10013823 3300031911 Bacteria 4744
210 Ga0307409_100000090 3300031995 Bacteria 32438
211 Ga0307409_100055453 3300031995 Bacteria 3060
212 Ga0307416_100000034 3300032002 Bacteria 155632
213 Ga0307510_10000002 3300033180 Bacteria 801565
214 Ga0307510_10078991 3300033180 Bacteria 3213
215 Ga0373936_0003446 3300035113 Bacteria 5934
216 Ga0373935_0058430 3300035692 Bacteria 2464
217 Ga0373933_0057205 3300035724 Bacteria 2343
218 Ga0373937_0078540 3300036401 Bacteria 3050
219 Ga0395899_0000349 3300037312 Bacteria 56957
220 Ga0395900_0029083 3300037418 Bacteria 5668
221 Ga0395898_0000026 3300037466 Bacteria 374440
222 Ga0395905_0000015 3300037471 Bacteria 393880
223 Ga0395905_0346056 3300037471 Bacteria 1378
224 Ga0436365_0053797 3300039437 Bacteria 3064
225 Ga0436365_0090629 3300039437 Bacteria 57501
226 Ga0436365_1472410 3300039437 Bacteria 8036
227 Ga0436360_0341118 3300039438 Bacteria 4313
228 Ga0436361_0531393 3300039447 Bacteria 1819
229 Ga0436363_0183565 3300039450 Bacteria 15940
230 Ga0451577_0000012 3300042876 Bacteria 575467
231 Ga0451577_0000805 3300042876 Bacteria 47205
232 Ga0451577_0065628 3300042876 Bacteria 3237
233 Ga0451577_0254115 3300042876 Bacteria 1591
234 Ga0453683_0080560 3300044673 Bacteria 2040
235 Ga0453683_0129066 3300044673 Bacteria 1592
236 Ga0453683_0149209 3300044673 Bacteria 1477
237 Ga0466961_0135451 3300044693 Bacteria 1543
238 Ga0453684_0000639 3300044712 Bacteria 126427
239 Ga0453684_0007933 3300044712 Bacteria 19257
240 Ga0453684_0014077 3300044712 Bacteria 12864
241 Ga0453684_0161873 3300044712 Bacteria 2646
242 Ga0453684_0269075 3300044712 Bacteria 1948
243 Ga0453684_0331350 3300044712 Bacteria 1721
244 Ga0453684_0471355 3300044712 Bacteria 1394
245 Ga0466971_0002003 3300044719 Bacteria 8631
246 Ga0466957_0014092 3300044842 Bacteria 4650
247 Ga0466959_0239770 3300045049 Bacteria 1253
248 Ga0451576_0000141 3300045051 Bacteria 183004
249 Ga0451576_0000856 3300045051 Bacteria 58909
250 Ga0451576_0000892 3300045051 Bacteria 56717
251 Ga0451576_0011481 3300045051 Bacteria 10057
252 Ga0451576_0289153 3300045051 Bacteria 1713
253 Ga0466967_0020391 3300045976 Bacteria 5357
254 Ga0466967_0044044 3300045976 Bacteria 3868
255 Ga0495606_0085448 3300046507 Bacteria 1952
256 Ga0495608_0027499 3300046511 Bacteria 3870
257 Ga0495652_0085077 3300046529 Bacteria 2600
258 Ga0495667_0087120 3300046559 Bacteria 2025
259 Ga0495656_0130573 3300046615 Bacteria 1195
260 Ga0495611_0138228 3300046648 Bacteria 1137
261 Ga0495625_0280927 3300046660 Bacteria 1071
262 Ga0495635_0070771 3300046663 Bacteria 2391
263 Ga0495613_0003649 3300046689 Bacteria 11533
264 Ga0495600_0252032 3300046809 Bacteria 1122
265 Ga0495680_0066398 3300047322 Bacteria 2761
266 Ga0495684_0020278 3300047471 Bacteria 5122
267 Ga0495684_0166763 3300047471 Bacteria 1640
268 Ga0496102_0020114 3300048905 Bacteria 5892
269 Ga0496102_0251321 3300048905 Bacteria 1667
270 Ga0496106_0240360 3300048909 Bacteria 1447
271 Ga0496116_0013122 3300048919 Bacteria 6710
272 Ga0496117_0000135 3300048920 Bacteria 160708
273 Ga0496118_0000098 3300048921 Bacteria 160610
274 Ga0496119_0013493 3300048922 Bacteria 6502
275 Ga0496120_0000543 3300048923 Bacteria 57596
276 Ga0496121_0001196 3300048924 Bacteria 45454
277 Ga0496121_0159613 3300048924 Unclassified 1650
278 Ga0496124_0020984 3300048927 Bacteria 6024
279 Ga0496125_0000653 3300048928 Bacteria 57890
280 Ga0496125_0010007 3300048928 Bacteria 9636
281 Ga0496125_0017254 3300048928 Bacteria 6895
282 Ga0496126_0005971 3300048929 Bacteria 13694
283 Ga0496126_0050343 3300048929 Bacteria 3797
284 Ga0501031_0000288 3300049568 Bacteria 28555
285 Ga0501032_0000315 3300049569 Bacteria 40606
286 Ga0501032_0000841 3300049569 Bacteria 24925
287 Ga0501032_0055684 3300049569 Bacteria 2660
288 Ga0501032_0096619 3300049569 Bacteria 1958
289 Ga0501033_0000074 3300049570 Bacteria 94345
290 Ga0501033_0000604 3300049570 Bacteria 33304
291 Ga0501033_0000614 3300049570 Bacteria 32999
292 Ga0501036_0014929 3300049572 Bacteria 6480
293 Ga0501036_0024011 3300049572 Bacteria 5138
294 Ga0501037_0000145 3300049573 Bacteria 66010
295 Ga0501037_0024881 3300049573 Bacteria 4426
296 Ga0501037_0157314 3300049573 Bacteria 1621
297 Ga0501038_0002746 3300049574 Bacteria 16404
298 Ga0501038_0033870 3300049574 Bacteria 4495
299 Ga0501039_0010801 3300049575 Bacteria 6955
300 Ga0501039_0024337 3300049575 Bacteria 4650
301 Ga0501042_0011710 3300049578 Bacteria 5926
302 Ga0501043_0002411 3300049579 Bacteria 15826
303 Ga0501043_0016831 3300049579 Bacteria 5730
304 Ga0501043_0065028 3300049579 Bacteria 2864
305 Ga0501043_0112991 3300049579 Bacteria 2133
306 Ga0501046_0009564 3300049580 Bacteria 8364
307 Ga0501046_0018308 3300049580 Bacteria 5831
308 Ga0501046_0038855 3300049580 Bacteria 3817
309 Ga0501047_0005079 3300049581 Bacteria 12352
310 Ga0501047_0009940 3300049581 Bacteria 8997
311 Ga0501047_0025779 3300049581 Bacteria 5653
312 Ga0501047_0056708 3300049581 Bacteria 3789
313 Ga0501048_0074002 3300049582 Bacteria 2403
314 Ga0501067_0177783 3300049583 Bacteria 1185
315 Ga0501070_0007074 3300049586 Bacteria 9544
316 Ga0501070_0041076 3300049586 Bacteria 3854
317 Ga0501073_0010179 3300049589 Bacteria 6908
318 Ga0501073_0205684 3300049589 Bacteria 1361
319 Ga0501077_0016875 3300049593 Bacteria 4605
320 Ga0501243_003282 3300049675 Bacteria 2390
321 Ga0501080_0005276 3300049742 Bacteria 11508
322 Ga0501080_0011823 3300049742 Bacteria 7999
323 Ga0501080_0016846 3300049742 Bacteria 6749
324 Ga0501080_0037288 3300049742 Bacteria 4539
325 Ga0501080_0113342 3300049742 Bacteria 2514
326 Ga0501083_0008860 3300049744 Bacteria 7105
327 Ga0501083_0028938 3300049744 Bacteria 3815
328 Ga0501035_0000002 3300049822 Bacteria 585447
329 Ga0501035_0001155 3300049822 Bacteria 27552
330 Ga0501035_0011807 3300049822 Bacteria 8087
331 Ga0501035_0025695 3300049822 Bacteria 5398
332 Ga0501035_0043109 3300049822 Bacteria 4067
333 Ga0501044_0000491 3300049823 Bacteria 47931
334 Ga0501044_0001175 3300049823 Bacteria 31002
335 Ga0501044_0006934 3300049823 Bacteria 12471
336 Ga0501044_0089856 3300049823 Bacteria 3099
337 nmdc:mga06r32_376438_c1 3300050510 Bacteria 1403
338 Ga0500568_0027919 3300053139 Bacteria 2357
339 Ga0500616_0000496 3300053153 Bacteria 50570
340 Ga0500634_0005170 3300053161 Bacteria 6158
341 Ga0500645_003878 3300053730 Bacteria 5915
342 Ga0501084_0043382 3300054114 Bacteria 3763
343 Ga0501084_0267310 3300054114 Bacteria 1444
344 Ga0501082_0067410 3300060353 Bacteria 3082
345 Ga0466962_0000047 3300061719 Bacteria 50198
346 2788434396 2786546940 Bacteria 6396474
347 Ga0068869_100000017
348 JGI24033J26618_1000134
349 rootH1_10049462
350 rootL2_10142820
351 Ga0070658_10020358
352 Ga0070670_100049119
353 Ga0068868_100026617
354 Ga0068868_100030588
355 Ga0070661_100003563
356 Ga0070671_100001886
357 Ga0070671_100099191
358 Ga0070667_100002554
359 Ga0070667_100044150
360 Ga0070667_100147114
361 Ga0070667_100183351
362 Ga0070713_100028637
363 Ga0070713_100046774
364 Ga0070713_100109064
365 Ga0070678_100061195
366 Ga0068867_100000462
367 Ga0068867_100064044
368 Ga0070706_100152112
369 Ga0070698_100024386
370 Ga0070679_100020275
371 Ga0070684_100067125
372 Ga0068853_100058465
373 Ga0070665_100000324
374 Ga0070665_100004412
375 Ga0070665_100016615
376 Ga0070665_100033520
377 Ga0070665_100076733
378 Ga0068855_100218655
379 Ga0070664_100425392
380 Ga0068857_100168743
381 Ga0068856_100000326
382 Ga0068856_100029595
383 Ga0068856_100337279
384 Ga0068852_100158969
385 Ga0068859_100001446
386 Ga0068859_100130133
387 Ga0068861_100007767
388 Ga0068863_100026904
389 Ga0068863_100188228
390 Ga0068858_100000923
391 Ga0068858_100030303
392 Ga0068860_100003837
393 Ga0068860_100083126
394 Ga0068862_100011075
395 Ga0068862_100253481
396 Ga0081539_10004551
397 Ga0070717_10000243
398 Ga0097621_100001508
399 Ga0097621_100028881
400 Ga0068871_100005827
401 Ga0075431_100030134
402 Ga0075429_100206554
403 Ga0097620_100001446
404 Ga0097620_100130134
405 Ga0105250_10070041
406 Ga0105240_10046435
407 Ga0105240_10066916
408 Ga0105240_10387375
409 Ga0111539_10000750
410 Ga0111539_10083155
411 Ga0111539_10285140
412 Ga0105247_10001598
413 Ga0105241_10023761
414 Ga0105248_10022827
415 Ga0105248_10308571
416 Ga0105237_10035839
417 Ga0105237_10042401
418 Ga0105237_10123747
419 Ga0105237_10133242
420 Ga0105237_10238996
421 Ga0105238_10056189
422 Ga0105249_10045264
423 Ga0105249_10108362
424 Ga0105239_10135792
425 Ga0157369_10208145
426 Ga0157369_10295142
427 Ga0157374_10542714
428 Ga0157378_10006585
429 Ga0157378_10133961
430 Ga0163162_10210334
431 Ga0157372_10096864
432 Ga0157372_10226271
433 Ga0157375_10190803
434 Ga0163163_10009513
435 Ga0163163_10011889
436 Ga0157380_10022716
437 Ga0213876_10001205
438 Ga0213876_10007486
439 Ga0207710_10000727
440 Ga0207705_10029504
441 Ga0207684_10099017
442 Ga0207695_10000022
443 Ga0207695_10000112
444 Ga0207695_10161304
445 Ga0207671_10003083
446 Ga0207671_10071531
447 Ga0207671_10090331
448 Ga0207671_10174166
449 Ga0207649_10000291
450 Ga0207652_10007960
451 Ga0207659_10038913
452 Ga0207700_10018043
453 Ga0207700_10034059
454 Ga0207700_10044884
455 Ga0207664_10056546
456 Ga0207665_10199226
457 Ga0207691_10151818
458 Ga0207711_10304564
459 Ga0207689_10000045
460 Ga0207658_10055706
461 Ga0207677_10014870
462 Ga0207677_10037100
463 Ga0207703_10002339
464 Ga0207703_10006629
465 Ga0207678_10057973
466 Ga0207702_10020727
467 Ga0207702_10200978
468 Ga0207641_10012327
469 Ga0207641_10032236
470 Ga0207641_10102841
471 Ga0207641_10166276
472 Ga0207641_10408677
473 Ga0207648_10002579
474 Ga0207674_10001845
475 Ga0207675_100031126
476 Ga0207683_10059897
477 Ga0268266_10000569
478 Ga0268266_10001113
479 Ga0268266_10006411
480 Ga0268266_10020805
481 Ga0268266_10031548
482 Ga0268265_10012386
483 Ga0268264_10000415
484 Ga0265337_1004799
485 Ga0265319_1000043
486 Ga0265319_1003661
487 Ga0265319_1007614
488 Ga0265319_1015662
489 Ga0265319_1027994
490 Ga0265334_10001381
491 Ga0265334_10007766
492 Ga0265334_10008433
493 Ga0265318_10000690
494 Ga0265318_10001300
495 Ga0265318_10001623
496 Ga0265318_10001908
497 Ga0265318_10003174
498 Ga0265318_10008570
499 Ga0265322_10016911
500 Ga0265322_10019251
501 Ga0265336_10033658
502 Ga0265336_10037110
503 Ga0265338_10000329
504 Ga0265338_10002172
505 Ga0265338_10077494
506 Ga0265324_10004195
507 Ga0265324_10005568
508 Ga0307511_10004557
509 Ga0307511_10053468
510 Ga0265328_10053923
511 Ga0265328_10055870
512 Ga0265320_10000080
513 Ga0265320_10000254
514 Ga0265320_10003550
515 Ga0265320_10004162
516 Ga0265320_10006669
517 Ga0265320_10007778
518 Ga0265320_10008047
519 Ga0265320_10014078
520 Ga0265320_10018248
521 Ga0265320_10031876
522 Ga0265320_10042512
523 Ga0265320_10053399
524 Ga0265320_10091697
525 Ga0265325_10013562
526 Ga0265331_10002392
527 Ga0265327_10000057
528 Ga0265327_10001538
529 Ga0265327_10004625
530 Ga0265327_10016496
531 Ga0265327_10104808
532 Ga0265316_10000887
533 Ga0265316_10008033
534 Ga0265316_10016788
535 Ga0265316_10036921
536 Ga0265316_10043693
537 Ga0307509_10000017
538 Ga0307408_100000017
539 Ga0265313_10000228
540 Ga0265313_10001658
541 Ga0265313_10002369
542 Ga0265313_10006935
543 Ga0307508_10000574
544 Ga0265314_10003092
545 Ga0265314_10007701
546 Ga0265314_10008049
547 Ga0265314_10156226
548 Ga0265342_10004316
549 Ga0265342_10022491
550 Ga0307410_10000096
551 Ga0307407_10005136
552 Ga0307407_10013149
553 Ga0307407_10138060
554 Ga0307412_10013823
555 Ga0307409_100000090
556 Ga0307409_100055453
557 Ga0307416_100000034
558 Ga0307510_10000002
559 Ga0307510_10078991
560 Ga0373936_0003446
561 Ga0373935_0058430
562 Ga0373933_0057205
563 Ga0373937_0078540
564 Ga0395899_0000349
565 Ga0395900_0029083
566 Ga0395898_0000026
567 Ga0395905_0000015
568 Ga0395905_0346056
569 Ga0436365_0053797
570 Ga0436365_0090629
571 Ga0436365_1472410
572 Ga0436360_0341118
573 Ga0436361_0531393
574 Ga0436363_0183565
575 Ga0451577_0000012
576 Ga0451577_0000805
577 Ga0451577_0065628
578 Ga0451577_0254115
579 Ga0453683_0080560
580 Ga0453683_0129066
581 Ga0453683_0149209
582 Ga0466961_0135451
583 Ga0453684_0000639
584 Ga0453684_0007933
585 Ga0453684_0014077
586 Ga0453684_0161873
587 Ga0453684_0269075
588 Ga0453684_0331350
589 Ga0453684_0471355
590 Ga0466971_0002003
591 Ga0466957_0014092
592 Ga0466959_0239770
593 Ga0451576_0000141
594 Ga0451576_0000856
595 Ga0451576_0000892
596 Ga0451576_0011481
597 Ga0451576_0289153
598 Ga0466967_0020391
599 Ga0466967_0044044
600 Ga0495606_0085448
601 Ga0495608_0027499
602 Ga0495652_0085077
603 Ga0495667_0087120
604 Ga0495656_0130573
605 Ga0495611_0138228
606 Ga0495625_0280927
607 Ga0495635_0070771
608 Ga0495613_0003649
609 Ga0495600_0252032
610 Ga0495680_0066398
611 Ga0495684_0020278
612 Ga0495684_0166763
613 Ga0496102_0020114
614 Ga0496102_0251321
615 Ga0496106_0240360
616 Ga0496116_0013122
617 Ga0496117_0000135
618 Ga0496118_0000098
619 Ga0496119_0013493
620 Ga0496120_0000543
621 Ga0496121_0001196
622 Ga0496121_0159613
623 Ga0496124_0020984
624 Ga0496125_0000653
625 Ga0496125_0010007
626 Ga0496125_0017254
627 Ga0496126_0005971
628 Ga0496126_0050343
629 Ga0501031_0000288
630 Ga0501032_0000315
631 Ga0501032_0000841
632 Ga0501032_0055684
633 Ga0501032_0096619
634 Ga0501033_0000074
635 Ga0501033_0000604
636 Ga0501033_0000614
637 Ga0501036_0014929
638 Ga0501036_0024011
639 Ga0501037_0000145
640 Ga0501037_0024881
641 Ga0501037_0157314
642 Ga0501038_0002746
643 Ga0501038_0033870
644 Ga0501039_0010801
645 Ga0501039_0024337
646 Ga0501042_0011710
647 Ga0501043_0002411
648 Ga0501043_0016831
649 Ga0501043_0065028
650 Ga0501043_0112991
651 Ga0501046_0009564
652 Ga0501046_0018308
653 Ga0501046_0038855
654 Ga0501047_0005079
655 Ga0501047_0009940
656 Ga0501047_0025779
657 Ga0501047_0056708
658 Ga0501048_0074002
659 Ga0501067_0177783
660 Ga0501070_0007074
661 Ga0501070_0041076
662 Ga0501073_0010179
663 Ga0501073_0205684
664 Ga0501077_0016875
665 Ga0501243_003282
666 Ga0501080_0005276
667 Ga0501080_0011823
668 Ga0501080_0016846
669 Ga0501080_0037288
670 Ga0501080_0113342
671 Ga0501083_0008860
672 Ga0501083_0028938
673 Ga0501035_0000002
674 Ga0501035_0001155
675 Ga0501035_0011807
676 Ga0501035_0025695
677 Ga0501035_0043109
678 Ga0501044_0000491
679 Ga0501044_0001175
680 Ga0501044_0006934
681 Ga0501044_0089856
682 nmdc:mga06r32_376438_c1
683 Ga0500568_0027919
684 Ga0500616_0000496
685 Ga0500634_0005170
686 Ga0500645_003878
687 Ga0501084_0043382
688 Ga0501084_0267310
689 Ga0501082_0067410
690 Ga0466962_0000047
691 2788434396

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

63

206

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9506 4 233
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9417 1 216
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9402 4 217
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9374 4 218
7ahe-assembly1.cif.gz_C opua inhibited inward facing 0.9344 3 234
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9757 1 217 3.40.50.300
1oxuA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9751 1 236 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.967 1 217 3.40.50.300
2awnC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9659 3 235 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9649 2 218 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3M1A2L0-F1-model_v4 ATP-binding cassette domain-containing protein 0.9897 1 208 GO:0005524
GO:0015423
GO:0016887
GO:0055052
GO:1990060
AF-A0A848WQ45-F1-model_v4 ABC transporter ATP-binding protein 0.9857 4 235 GO:0005524
GO:0016887
AF-A0A538EZX0-F1-model_v4 Spermidine/putrescine ABC transporter ATP-binding protein 0.9822 4 240 GO:0005524
GO:0005886
GO:0015594
GO:0016887
AF-A0A7J3BDG1-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9811 1 225 GO:0005524
GO:0016887
AF-A0A3M1A2L0-F1-model_v4 ATP-binding cassette domain-containing protein 0.9804 1 208 GO:0005524
GO:0015423
GO:0016887
GO:0055052
GO:1990060

Map