F416073

General Info

Members Datasets Scaffolds Average Seq Length
344 215 294 256

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0065619|Ga0466972_0065619_308_1150
Length 280
Sequence MTAQKHAIGIDIGGTGIKGALVDLETGELLSDRIKLSTPEGGKPDGIVEVTKEIVDQLAAQAPDVPVGVCFPAIVSHGVTMSAANVSKKWIGLHAEELFEKALGRDIHFVNDADAAGYAETRFGAAKDKDGLVIMTTLGTGIGSALIYDGVLIPNAELGHLEIDGHDAESRAAYSAKERDDLSWEKWAKRLQKYYSAVEFLFTPDLFIVGGGVSKNYESFLPLLDLKTPIVPAVHRNNAGILGAAALAVRGERRDRGARGRTAEVGTPSEGEAEKEQASA

Samples

Sample ID Description Type Environment
1 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
2 2643221553 Microbacterium sp. Root553 Isolate Unclassified
3 2643221572 Leifsonia sp. Root60 Isolate Unclassified
4 2643221616 Leifsonia sp. Root227 Isolate Unclassified
5 2643221630 Microbacterium sp. Root322 Isolate Unclassified
6 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
7 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
8 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
9 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
10 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
11 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
12 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
13 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
14 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
15 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
16 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
17 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
18 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
19 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
20 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
21 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
22 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
23 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
24 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
25 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
26 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
27 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
28 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
29 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
30 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
31 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
32 2919395869 Microbacterium resistens 2980 Isolate Unclassified
33 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
34 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
35 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
36 2928153084 Leifsonia sp. 563 Isolate Unclassified
37 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
38 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
39 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
40 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
41 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
42 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
43 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
44 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
45 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
46 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
47 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
48 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
49 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
50 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
51 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
52 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
53 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
54 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
55 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
56 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
57 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
58 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
59 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
60 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
61 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
62 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
63 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
64 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
67 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
130 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
131 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
132 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
143 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
165 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
199 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
203 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
204 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
205 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
206 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
207 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
208 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
214 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
215 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.72
Metatranscriptomes 1.74
Isolates 14.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 13.95
Nodule 0
Rhizoplane 6.1
Rhizosphere 61.63
Stem 0
Stem Tuber 0.29
Unclassified 17.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007780 3300001979 Bacteria 4328
2 JGI24739J22299_10085496 3300001989 Bacteria 964
3 JGI24735J21928_10011568 3300002067 Bacteria 2795
4 JGI25154J39366_1002526 3300002738 Bacteria 4643
5 JGI25164J39214_1000419 3300002772 Bacteria 24049
6 JGI25165J46597_1000004 3300003214 Bacteria 667510
7 Ga0006562J51391_1082179 3300003578 Bacteria 6341
8 Ga0006562J51391_1082180 3300003578 Bacteria 6190
9 Ga0055539_1000008 3300003752 Bacteria 537665
10 Ga0055533_1000001 3300003756 Bacteria 1863437
11 Ga0055525_1000382 3300003759 Bacteria 28846
12 Ga0055527_1000001 3300003760 Bacteria 850044
13 Ga0055529_1000019 3300003763 Bacteria 332786
14 Ga0055541_1007164 3300003841 Bacteria 1848
15 Ga0070658_10006288 3300005327 Bacteria 9621
16 Ga0070683_100017038 3300005329 Bacteria 6413
17 Ga0070683_100430342 3300005329 Bacteria 1259
18 Ga0070682_100104861 3300005337 Bacteria 1873
19 Ga0070660_100019196 3300005339 Bacteria 5004
20 Ga0070659_100188036 3300005366 Bacteria 1697
21 Ga0070714_100210950 3300005435 Bacteria 1780
22 Ga0070710_10213504 3300005437 Bacteria 1224
23 Ga0070672_100266968 3300005543 Bacteria 1444
24 Ga0070665_100345172 3300005548 Bacteria 1494
25 Ga0068856_100562968 3300005614 Bacteria 1161
26 Ga0068864_100166748 3300005618 Bacteria 2006
27 Ga0068863_100036707 3300005841 Bacteria 4668
28 Ga0075364_10090084 3300006051 Bacteria 2034
29 Ga0075364_10266577 3300006051 Bacteria 1164
30 Ga0075369_10024306 3300006186 Bacteria 2510
31 Ga0068865_100319615 3300006881 Bacteria 1248
32 Ga0105245_10096546 3300009098 Bacteria 2728
33 Ga0105243_10241810 3300009148 Bacteria 1607
34 Ga0105241_10000405 3300009174 Bacteria 32597
35 Ga0105237_10048838 3300009545 Bacteria 4254
36 Ga0105239_10261478 3300010375 Bacteria 1945
37 Ga0105246_10212889 3300011119 Bacteria 1510
38 Ga0105246_10217953 3300011119 Bacteria 1494
39 Ga0157369_10036268 3300013105 Bacteria 5404
40 Ga0157374_10077419 3300013296 Bacteria 3147
41 Ga0163162_10539261 3300013306 Bacteria 1295
42 Ga0157372_10140862 3300013307 Bacteria 2778
43 Ga0157372_10213052 3300013307 Bacteria 2239
44 Ga0157372_10227504 3300013307 Bacteria 2162
45 Ga0157372_10337898 3300013307 Bacteria 1754
46 Ga0157375_10109426 3300013308 Bacteria 2859
47 Ga0157375_10140098 3300013308 Bacteria 2545
48 Ga0157375_10205438 3300013308 Bacteria 2126
49 Ga0157375_10732802 3300013308 Bacteria 1141
50 Ga0163163_10235575 3300014325 Bacteria 1880
51 Ga0157376_10252969 3300014969 Bacteria 1646
52 Ga0157376_10544931 3300014969 Bacteria 1147
53 Ga0206354_10857518 3300020081 Bacteria 2047
54 Ga0206353_10495403 3300020082 Bacteria 1488
55 Ga0206353_12037789 3300020082 Bacteria 10973
56 Ga0209566_100149 3300025225 Bacteria 81626
57 Ga0209674_100001 3300025226 Bacteria 4013750
58 Ga0209672_100006 3300025228 Bacteria 1004497
59 Ga0209147_101703 3300025229 Bacteria 7142
60 Ga0209563_100001 3300025230 Bacteria 4013775
61 Ga0209563_100769 3300025230 Bacteria 9733
62 Ga0207427_100010 3300025231 Bacteria 648610
63 Ga0209437_100216 3300025233 Bacteria 106353
64 Ga0209258_101795 3300025242 Bacteria 6573
65 Ga0209646_1000167 3300025246 Bacteria 87036
66 Ga0209677_100001 3300025253 Bacteria 4013787
67 Ga0209677_100608 3300025253 Bacteria 19222
68 Ga0209148_1000015 3300025254 Bacteria 850103
69 Ga0209233_1000001 3300025261 Bacteria 2992747
70 Ga0209455_1000013 3300025272 Bacteria 850103
71 Ga0209455_1002099 3300025272 Bacteria 7959
72 Ga0207688_10280648 3300025901 Bacteria 1015
73 Ga0207654_10000001 3300025911 Bacteria 1816198
74 Ga0207671_10037050 3300025914 Bacteria 3616
75 Ga0207694_10000656 3300025924 Bacteria 31213
76 Ga0207664_10330690 3300025929 Bacteria 1346
77 Ga0207690_10117915 3300025932 Bacteria 1923
78 Ga0207686_10457265 3300025934 Bacteria 983
79 Ga0207691_10069928 3300025940 Bacteria 3170
80 Ga0207711_10001556 3300025941 Bacteria 21223
81 Ga0207661_10296893 3300025944 Bacteria 1448
82 Ga0207712_10083602 3300025961 Bacteria 2330
83 Ga0207702_10328871 3300026078 Bacteria 1457
84 Ga0207641_10100687 3300026088 Bacteria 2545
85 Ga0207676_10012231 3300026095 Bacteria 6143
86 Ga0207674_10008386 3300026116 Bacteria 11951
87 Ga0268266_10596978 3300028379 Bacteria 1060
88 Ga0307408_100368857 3300031548 Bacteria 1224
89 Ga0307514_10011711 3300031649 Bacteria 7297
90 Ga0307406_10001126 3300031901 Bacteria 14930
91 Ga0307406_10007935 3300031901 Bacteria 5911
92 Ga0307409_100325340 3300031995 Bacteria 1441
93 Ga0307414_10132502 3300032004 Bacteria 1937
94 Ga0307414_10265309 3300032004 Bacteria 1435
95 Ga0307414_10331533 3300032004 Bacteria 1299
96 Ga0307414_10556622 3300032004 Bacteria 1023
97 Ga0395899_0008106 3300037312 Bacteria 8092
98 Ga0395899_0013300 3300037312 Bacteria 6296
99 Ga0395900_0000774 3300037418 Bacteria 42584
100 Ga0395900_0121789 3300037418 Bacteria 2676
101 Ga0395900_0325460 3300037418 Bacteria 1516
102 Ga0395898_0000015 3300037466 Bacteria 439819
103 Ga0395898_0135367 3300037466 Bacteria 2359
104 Ga0395898_0299682 3300037466 Bacteria 1534
105 Ga0395898_0645475 3300037466 Bacteria 1001
106 Ga0395901_0254229 3300038443 Bacteria 1830
107 Ga0395901_0267878 3300038443 Bacteria 1777
108 Ga0451793_0574673 3300041452 Bacteria 1396
109 Ga0451843_1231806 3300041509 Bacteria 1826
110 Ga0466969_0095112 3300044656 Bacteria 1408
111 Ga0466972_0026252 3300044658 Bacteria 2886
112 Ga0466972_0065619 3300044658 Bacteria 1736
113 Ga0466972_0082988 3300044658 Bacteria 1525
114 Ga0466972_0083276 3300044658 Bacteria 1522
115 Ga0466965_0026603 3300044683 Bacteria 2804
116 Ga0466965_0059998 3300044683 Bacteria 1899
117 Ga0466961_0033587 3300044693 Bacteria 3295
118 Ga0466961_0110010 3300044693 Bacteria 1734
119 Ga0466961_0199441 3300044693 Bacteria 1238
120 Ga0466963_0081805 3300044694 Bacteria 2188
121 Ga0466963_0417556 3300044694 Bacteria 946
122 Ga0466964_0015595 3300044706 Bacteria 2893
123 Ga0466970_0002717 3300044765 Bacteria 8546
124 Ga0466970_0021971 3300044765 Bacteria 3329
125 Ga0466970_0033166 3300044765 Bacteria 2729
126 Ga0466970_0069549 3300044765 Bacteria 1892
127 Ga0466957_0149353 3300044842 Bacteria 1510
128 Ga0466960_0019751 3300044901 Bacteria 2974
129 Ga0466960_0058671 3300044901 Bacteria 1880
130 Ga0466960_0103813 3300044901 Bacteria 1468
131 Ga0466959_0021514 3300045049 Bacteria 4757
132 Ga0466967_0030222 3300045976 Bacteria 4544
133 Ga0466967_0053840 3300045976 Bacteria 3538
134 Ga0466967_0160511 3300045976 Bacteria 2109
135 Ga0466967_0421909 3300045976 Bacteria 1300
136 Ga0466967_0910857 3300045976 Bacteria 874
137 Ga0495627_000742 3300046453 Bacteria 24523
138 Ga0495641_0078801 3300046461 Bacteria 1476
139 Ga0495651_0167331 3300046462 Bacteria 1569
140 Ga0495653_0352019 3300046463 Bacteria 947
141 Ga0495635_0299344 3300046663 Bacteria 1079
142 Ga0495672_0019524 3300047320 Bacteria 4468
143 Ga0496100_0108236 3300048903 Bacteria 1927
144 Ga0496100_0253449 3300048903 Bacteria 1302
145 Ga0496101_0013198 3300048904 Bacteria 5531
146 Ga0496102_0580010 3300048905 Bacteria 1044
147 Ga0496103_0013353 3300048906 Bacteria 4868
148 Ga0496104_0212877 3300048907 Bacteria 1844
149 Ga0496105_0016792 3300048908 Bacteria 5851
150 Ga0496105_0020412 3300048908 Bacteria 5354
151 Ga0496107_0138934 3300048910 Bacteria 1796
152 Ga0496108_0473638 3300048911 Bacteria 1094
153 Ga0496110_0324409 3300048913 Bacteria 1403
154 Ga0496111_0218802 3300048914 Bacteria 1415
155 Ga0496111_0249462 3300048914 Bacteria 1318
156 Ga0496113_0584700 3300048916 Bacteria 894
157 Ga0496114_0008364 3300048917 Bacteria 8195
158 Ga0496114_0059421 3300048917 Bacteria 3194
159 Ga0496114_0180247 3300048917 Bacteria 1845
160 Ga0496114_0190740 3300048917 Bacteria 1793
161 Ga0496115_0028007 3300048918 Bacteria 4412
162 Ga0496115_0075698 3300048918 Bacteria 2735
163 Ga0496116_0065779 3300048919 Bacteria 2324
164 Ga0496117_0001055 3300048920 Bacteria 42040
165 Ga0496117_0005962 3300048920 Bacteria 12562
166 Ga0496117_0010512 3300048920 Bacteria 8418
167 Ga0496117_0027939 3300048920 Bacteria 4377
168 Ga0496117_0169597 3300048920 Bacteria 1268
169 Ga0496118_0001119 3300048921 Bacteria 41534
170 Ga0496118_0018929 3300048921 Bacteria 6174
171 Ga0496118_0023435 3300048921 Bacteria 5361
172 Ga0496118_0024892 3300048921 Bacteria 5152
173 Ga0496118_0076709 3300048921 Bacteria 2375
174 Ga0496119_0003767 3300048922 Bacteria 15520
175 Ga0496119_0005179 3300048922 Bacteria 12603
176 Ga0496120_0000738 3300048923 Bacteria 47796
177 Ga0496120_0014553 3300048923 Bacteria 5237
178 Ga0496120_0174715 3300048923 Bacteria 1060
179 Ga0496122_0000200 3300048925 Bacteria 133548
180 Ga0496122_0012333 3300048925 Bacteria 8529
181 Ga0496122_0015362 3300048925 Bacteria 7324
182 Ga0496122_0036350 3300048925 Bacteria 3984
183 Ga0496122_0216527 3300048925 Bacteria 1103
184 Ga0496123_0000076 3300048926 Bacteria 194050
185 Ga0496123_0001004 3300048926 Bacteria 43196
186 Ga0496123_0052510 3300048926 Bacteria 2704
187 Ga0496123_0219223 3300048926 Bacteria 961
188 Ga0496124_0000453 3300048927 Bacteria 71849
189 Ga0496124_0002982 3300048927 Bacteria 21181
190 Ga0496124_0152006 3300048927 Bacteria 1814
191 Ga0496125_0000894 3300048928 Bacteria 47247
192 Ga0496125_0139642 3300048928 Bacteria 1687
193 Ga0496125_0160753 3300048928 Bacteria 1526
194 Ga0496125_0218079 3300048928 Bacteria 1232
195 Ga0496126_0004104 3300048929 Bacteria 17619
196 Ga0496126_0004369 3300048929 Bacteria 16943
197 Ga0496126_0062888 3300048929 Bacteria 3328
198 Ga0501031_0003885 3300049568 Bacteria 9617
199 Ga0501032_0009019 3300049569 Bacteria 7249
200 Ga0501033_0004704 3300049570 Bacteria 10925
201 Ga0501033_0015118 3300049570 Bacteria 5856
202 Ga0501033_0166776 3300049570 Bacteria 1583
203 Ga0501034_0001738 3300049571 Bacteria 27983
204 Ga0501034_0015230 3300049571 Bacteria 7903
205 Ga0501034_0033529 3300049571 Bacteria 5208
206 Ga0501034_0039409 3300049571 Bacteria 4786
207 Ga0501034_0062654 3300049571 Bacteria 3734
208 Ga0501034_0121334 3300049571 Bacteria 2600
209 Ga0501034_0207330 3300049571 Bacteria 1916
210 Ga0501036_0011736 3300049572 Bacteria 7259
211 Ga0501036_0018656 3300049572 Bacteria 5816
212 Ga0501037_0000536 3300049573 Bacteria 30298
213 Ga0501037_0006594 3300049573 Bacteria 8488
214 Ga0501038_0001138 3300049574 Bacteria 24120
215 Ga0501038_0043489 3300049574 Bacteria 3905
216 Ga0501038_0087844 3300049574 Bacteria 2610
217 Ga0501039_0011213 3300049575 Bacteria 6831
218 Ga0501039_0133503 3300049575 Bacteria 1948
219 Ga0501043_0001612 3300049579 Bacteria 19645
220 Ga0501043_0156021 3300049579 Bacteria 1785
221 Ga0501046_0003207 3300049580 Bacteria 15050
222 Ga0501046_0004162 3300049580 Bacteria 13172
223 Ga0501046_0011527 3300049580 Bacteria 7558
224 Ga0501047_0004897 3300049581 Bacteria 12575
225 Ga0501047_0240478 3300049581 Bacteria 1661
226 Ga0501048_0002639 3300049582 Bacteria 13702
227 Ga0501048_0085341 3300049582 Bacteria 2227
228 Ga0501067_0000214 3300049583 Bacteria 32127
229 Ga0501067_0002645 3300049583 Bacteria 9921
230 Ga0501068_0007788 3300049584 Bacteria 5933
231 Ga0501068_0284265 3300049584 Bacteria 1057
232 Ga0501069_0010881 3300049585 Bacteria 4821
233 Ga0501069_0050755 3300049585 Bacteria 2307
234 Ga0501069_0134551 3300049585 Bacteria 1416
235 Ga0501070_0000167 3300049586 Bacteria 60680
236 Ga0501070_0005522 3300049586 Bacteria 10783
237 Ga0501070_0010576 3300049586 Bacteria 7799
238 Ga0501070_0031964 3300049586 Bacteria 4408
239 Ga0501070_0034745 3300049586 Bacteria 4214
240 Ga0501070_0087754 3300049586 Bacteria 2574
241 Ga0501070_0346552 3300049586 Bacteria 1206
242 Ga0501071_0000056 3300049587 Bacteria 38160
243 Ga0501071_0005919 3300049587 Bacteria 7912
244 Ga0501071_0230474 3300049587 Bacteria 1395
245 Ga0501072_0021620 3300049588 Bacteria 4989
246 Ga0501072_0427060 3300049588 Bacteria 1050
247 Ga0501073_0000962 3300049589 Bacteria 20736
248 Ga0501073_0005807 3300049589 Bacteria 9220
249 Ga0501073_0182361 3300049589 Bacteria 1453
250 Ga0501073_0207372 3300049589 Bacteria 1354
251 Ga0501074_0000209 3300049590 Bacteria 32209
252 Ga0501074_0029965 3300049590 Bacteria 3943
253 Ga0501074_0096507 3300049590 Bacteria 2116
254 Ga0501079_0214777 3300049741 Bacteria 1502
255 Ga0501080_0002035 3300049742 Bacteria 17484
256 Ga0501080_0034277 3300049742 Bacteria 4738
257 Ga0501080_0063686 3300049742 Bacteria 3431
258 Ga0501083_0033886 3300049744 Bacteria 3494
259 Ga0501035_0008660 3300049822 Bacteria 9471
260 Ga0501035_0020426 3300049822 Bacteria 6082
261 Ga0501035_0288874 3300049822 Bacteria 1384
262 Ga0501044_0001773 3300049823 Bacteria 25248
263 Ga0501044_0242566 3300049823 Bacteria 1745
264 Ga0501045_0018452 3300049824 Bacteria 4963
265 nmdc:mga00v17_242686_c1 3300050491 Bacteria 1168
266 nmdc:mga00v17_54345_c1 3300050491 Bacteria 2443
267 nmdc:mga0sz30_179036_c1 3300050516 Bacteria 940
268 Ga0500635_0000028 3300053080 Bacteria 104398
269 Ga0500635_0001319 3300053080 Bacteria 5936
270 Ga0495595_0190420 3300053084 Bacteria 1019
271 Ga0495619_0023288 3300053085 Bacteria 3969
272 Ga0500643_000813 3300053087 Bacteria 20131
273 Ga0500650_0005785 3300053098 Bacteria 4652
274 Ga0500556_0000001 3300053104 Bacteria 1135060
275 Ga0500559_0000263 3300053136 Bacteria 41139
276 Ga0500559_0002832 3300053136 Bacteria 8761
277 Ga0500559_0079498 3300053136 Bacteria 1488
278 Ga0500568_0000006 3300053139 Bacteria 522235
279 Ga0500568_0000529 3300053139 Bacteria 28228
280 Ga0500573_0000013 3300053140 Bacteria 196637
281 Ga0500573_0003293 3300053140 Bacteria 8333
282 Ga0500573_0006030 3300053140 Bacteria 6527
283 Ga0500573_0018147 3300053140 Bacteria 4010
284 Ga0500573_0021178 3300053140 Bacteria 3724
285 Ga0500573_0027687 3300053140 Bacteria 3261
286 Ga0500573_0171925 3300053140 Bacteria 1171
287 Ga0500577_0002918 3300053142 Bacteria 4400
288 Ga0500577_0120014 3300053142 Bacteria 1094
289 Ga0501084_0007616 3300054114 Bacteria 8927
290 Ga0587084_003309 3300059477 Bacteria 1761
291 Ga0501082_0014977 3300060353 Bacteria 6682
292 Ga0501082_0158224 3300060353 Bacteria 1968
293 Ga0466962_0012934 3300061719 Bacteria 4014
294 Ga0466962_0051074 3300061719 Bacteria 1977

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0910857 Ga0466967_0910857_235_852 202
2 3300048914 Ga0496111_0249462 Ga0496111_0249462_316_933 202
3 3300048917 Ga0496114_0190740 Ga0496114_0190740_788_1492 218
4 3300013307 Ga0157372_10337898 Ga0157372_103378981 229
5 3300037466 Ga0395898_0135367 Ga0395898_0135367_706_1539 229
6 3300025230 Ga0209563_100769 Ga0209563_1007693 238
7 3300044658 Ga0466972_0082988 Ga0466972_0082988_197_1033 239
8 3300049586 Ga0501070_0346552 Ga0501070_0346552_272_1033 239
9 iso_pu_bacteria 2643221635 2644199168 242
10 3300005614 Ga0068856_100562968 Ga0068856_1005629681 243
11 3300020081 Ga0206354_10857518 Ga0206354_108575183 243
12 3300020082 Ga0206353_12037789 Ga0206353_120377898 243
13 3300025253 Ga0209677_100608 Ga0209677_1006088 243
14 3300026078 Ga0207702_10328871 Ga0207702_103288714 243
15 3300037312 Ga0395899_0013300 Ga0395899_0013300_957_1790 243
16 3300037418 Ga0395900_0325460 Ga0395900_0325460_533_1366 243
17 3300044658 Ga0466972_0083276 Ga0466972_0083276_539_1366 243
18 3300045049 Ga0466959_0021514 Ga0466959_0021514_893_1720 243
19 iso_pu_bacteria 2751185788 2753301843 243
20 iso_pu_bacteria 2852643534 2852645615 243
21 iso_pu_bacteria 2857733635 2857735797 243
22 iso_pu_bacteria 2870622029 2870623674 243
23 iso_pu_bacteria 2904430863 2904433027 243
24 iso_pu_bacteria 2904501621 2904502839 243
25 iso_pu_bacteria 2908674828 2908677935 243
26 iso_pu_bacteria 2909074476 2909075040 243
27 iso_pu_bacteria 2919039151 2919040458 243
28 iso_pu_bacteria 2919042368 2919045956 243
29 iso_pu_bacteria 2919395869 2919396587 243
30 iso_pu_bacteria 2928104781 2928108476 243
31 iso_pu_bacteria 2928500415 2928501711 243
32 iso_pu_bacteria 2939657138 2939658118 243
33 iso_pu_bacteria 2984551494 2984553995 243
34 3300003752 Ga0055539_1000008 Ga0055539_100000835 244
35 3300003756 Ga0055533_1000001 Ga0055533_10000011035 244
36 3300003759 Ga0055525_1000382 Ga0055525_100038216 244
37 3300003841 Ga0055541_1007164 Ga0055541_10071642 244
38 3300025225 Ga0209566_100149 Ga0209566_10014928 244
39 3300025226 Ga0209674_100001 Ga0209674_1000011035 244
40 3300025230 Ga0209563_100001 Ga0209563_1000011035 244
41 3300025253 Ga0209677_100001 Ga0209677_1000011035 244
42 iso_pu_bacteria 2643221553 2643785870 244
43 iso_pu_bacteria 2643221724 2644680272 244
44 iso_pu_bacteria 2721755702 2723642176 244
45 iso_pu_bacteria 2728369380 2730229724 244
46 iso_pu_bacteria 2747842429 2747951708 244
47 iso_pu_bacteria 2852646457 2852647368 244
48 iso_pu_bacteria 2852663356 2852665347 244
49 iso_pu_bacteria 2857723135 2857723895 244
50 iso_pu_bacteria 2935409751 2935411546 244
51 iso_pu_bacteria 2939660829 2939661201 244
52 iso_pu_bacteria 2945968032 2945971844 244
53 iso_pu_bacteria 2946033335 2946033712 244
54 iso_pu_bacteria 2966924647 2966924962 244
55 iso_pu_bacteria 8004182704 8004185080 244
56 iso_pu_bacteria 8046352972 8046356275 244
57 3300005329 Ga0070683_100017038 Ga0070683_1000170383 245
58 3300005329 Ga0070683_100430342 Ga0070683_1004303422 245
59 3300005337 Ga0070682_100104861 Ga0070682_1001048612 245
60 3300005548 Ga0070665_100345172 Ga0070665_1003451722 245
61 3300006881 Ga0068865_100319615 Ga0068865_1003196152 245
62 3300009098 Ga0105245_10096546 Ga0105245_100965463 245
63 3300009148 Ga0105243_10241810 Ga0105243_102418103 245
64 3300011119 Ga0105246_10217953 Ga0105246_102179533 245
65 3300013308 Ga0157375_10109426 Ga0157375_101094263 245
66 3300013308 Ga0157375_10140098 Ga0157375_101400982 245
67 3300013308 Ga0157375_10732802 Ga0157375_107328021 245
68 3300014325 Ga0163163_10235575 Ga0163163_102355753 245
69 3300014969 Ga0157376_10252969 Ga0157376_102529692 245
70 3300025901 Ga0207688_10280648 Ga0207688_102806481 245
71 3300025934 Ga0207686_10457265 Ga0207686_104572651 245
72 3300025944 Ga0207661_10296893 Ga0207661_102968932 245
73 3300025961 Ga0207712_10083602 Ga0207712_100836022 245
74 3300028379 Ga0268266_10596978 Ga0268266_105969782 245
75 3300037466 Ga0395898_0645475 Ga0395898_0645475_140_901 245
76 3300044694 Ga0466963_0081805 Ga0466963_0081805_1148_1909 245
77 3300044694 Ga0466963_0417556 Ga0466963_0417556_68_829 245
78 3300044706 Ga0466964_0015595 Ga0466964_0015595_570_1331 245
79 3300045976 Ga0466967_0030222 Ga0466967_0030222_1098_1853 245
80 3300045976 Ga0466967_0053840 Ga0466967_0053840_282_1043 245
81 3300045976 Ga0466967_0160511 Ga0466967_0160511_786_1547 245
82 3300045976 Ga0466967_0421909 Ga0466967_0421909_466_1227 245
83 3300046461 Ga0495641_0078801 Ga0495641_0078801_362_1126 245
84 3300046462 Ga0495651_0167331 Ga0495651_0167331_206_970 245
85 3300046463 Ga0495653_0352019 Ga0495653_0352019_16_780 245
86 3300046663 Ga0495635_0299344 Ga0495635_0299344_271_1035 245
87 3300047320 Ga0495672_0019524 Ga0495672_0019524_2480_3220 245
88 3300048905 Ga0496102_0580010 Ga0496102_0580010_188_949 245
89 3300048911 Ga0496108_0473638 Ga0496108_0473638_200_964 245
90 3300048913 Ga0496110_0324409 Ga0496110_0324409_624_1388 245
91 3300048914 Ga0496111_0218802 Ga0496111_0218802_434_1198 245
92 3300048917 Ga0496114_0059421 Ga0496114_0059421_1992_2756 245
93 3300048917 Ga0496114_0180247 Ga0496114_0180247_373_1134 245
94 3300049571 Ga0501034_0207330 Ga0501034_0207330_537_1298 245
95 3300049583 Ga0501067_0000214 Ga0501067_0000214_8471_9232 245
96 3300049583 Ga0501067_0002645 Ga0501067_0002645_2596_3357 245
97 3300049584 Ga0501068_0007788 Ga0501068_0007788_63_824 245
98 3300049584 Ga0501068_0284265 Ga0501068_0284265_240_1001 245
99 3300049585 Ga0501069_0050755 Ga0501069_0050755_149_910 245
100 3300049586 Ga0501070_0005522 Ga0501070_0005522_8909_9670 245
101 3300049586 Ga0501070_0010576 Ga0501070_0010576_6436_7191 245
102 3300049586 Ga0501070_0087754 Ga0501070_0087754_419_1180 245
103 3300049587 Ga0501071_0005919 Ga0501071_0005919_355_1116 245
104 3300049587 Ga0501071_0230474 Ga0501071_0230474_417_1178 245
105 3300049588 Ga0501072_0021620 Ga0501072_0021620_986_1747 245
106 3300049588 Ga0501072_0427060 Ga0501072_0427060_250_1011 245
107 3300049589 Ga0501073_0000962 Ga0501073_0000962_10940_11701 245
108 3300049589 Ga0501073_0005807 Ga0501073_0005807_2751_3512 245
109 3300049590 Ga0501074_0000209 Ga0501074_0000209_22780_23541 245
110 3300049590 Ga0501074_0029965 Ga0501074_0029965_2751_3512 245
111 3300049590 Ga0501074_0096507 Ga0501074_0096507_757_1512 245
112 3300049741 Ga0501079_0214777 Ga0501079_0214777_436_1197 245
113 3300049742 Ga0501080_0002035 Ga0501080_0002035_14395_15156 245
114 3300049742 Ga0501080_0034277 Ga0501080_0034277_1297_2058 245
115 3300049742 Ga0501080_0063686 Ga0501080_0063686_623_1378 245
116 3300049744 Ga0501083_0033886 Ga0501083_0033886_2387_3148 245
117 3300053084 Ga0495595_0190420 Ga0495595_0190420_198_962 245
118 3300053085 Ga0495619_0023288 Ga0495619_0023288_1415_2179 245
119 3300053140 Ga0500573_0171925 Ga0500573_0171925_277_1014 245
120 3300054114 Ga0501084_0007616 Ga0501084_0007616_5234_5995 245
121 3300060353 Ga0501082_0014977 Ga0501082_0014977_1320_2081 245
122 3300060353 Ga0501082_0158224 Ga0501082_0158224_339_1100 245
123 3300061719 Ga0466962_0051074 Ga0466962_0051074_140_895 245
124 iso_pu_bacteria 2643221572 2643875374 245
125 iso_pu_bacteria 2643221669 2644382429 245
126 iso_pu_bacteria 2895660088 2895661466 245
127 iso_pu_bacteria 2919443155 2919446064 245
128 iso_pu_bacteria 8004212874 8004214313 245
129 3300044656 Ga0466969_0095112 Ga0466969_0095112_528_1277 246
130 3300044765 Ga0466970_0021971 Ga0466970_0021971_93_842 246
131 3300048920 Ga0496117_0005962 Ga0496117_0005962_11078_11830 246
132 3300048921 Ga0496118_0001119 Ga0496118_0001119_40159_40911 246
133 3300048927 Ga0496124_0000453 Ga0496124_0000453_53833_54585 246
134 3300048927 Ga0496124_0152006 Ga0496124_0152006_381_1130 246
135 3300053140 Ga0500573_0000013 Ga0500573_0000013_101663_102412 246
136 iso_pu_bacteria 2643221616 2644097131 246
137 iso_pu_bacteria 2643221632 2644183383 246
138 iso_pu_bacteria 2844841374 2844842705 246
139 iso_pu_bacteria 2884763398 2884765674 246
140 iso_pu_bacteria 2919055335 2919058411 246
141 iso_pu_bacteria 2919523602 2919524794 246
142 iso_pu_bacteria 2928153084 2928156295 246
143 3300001989 JGI24739J22299_10085496 JGI24739J22299_100854961 247
144 3300002067 JGI24735J21928_10011568 JGI24735J21928_100115683 247
145 3300002772 JGI25164J39214_1000419 JGI25164J39214_10004198 247
146 3300003214 JGI25165J46597_1000004 JGI25165J46597_1000004471 247
147 3300003578 Ga0006562J51391_1082179 Ga0006562J51391_10821794 247
148 3300003578 Ga0006562J51391_1082180 Ga0006562J51391_10821803 247
149 3300003760 Ga0055527_1000001 Ga0055527_1000001516 247
150 3300003763 Ga0055529_1000019 Ga0055529_100001922 247
151 3300005327 Ga0070658_10006288 Ga0070658_100062884 247
152 3300005339 Ga0070660_100019196 Ga0070660_1000191964 247
153 3300005366 Ga0070659_100188036 Ga0070659_1001880362 247
154 3300005435 Ga0070714_100210950 Ga0070714_1002109502 247
155 3300005437 Ga0070710_10213504 Ga0070710_102135041 247
156 3300005543 Ga0070672_100266968 Ga0070672_1002669684 247
157 3300005618 Ga0068864_100166748 Ga0068864_1001667484 247
158 3300005841 Ga0068863_100036707 Ga0068863_1000367074 247
159 3300006186 Ga0075369_10024306 Ga0075369_100243062 247
160 3300009174 Ga0105241_10000405 Ga0105241_1000040514 247
161 3300009545 Ga0105237_10048838 Ga0105237_100488387 247
162 3300010375 Ga0105239_10261478 Ga0105239_102614784 247
163 3300011119 Ga0105246_10212889 Ga0105246_102128892 247
164 3300013105 Ga0157369_10036268 Ga0157369_100362682 247
165 3300013296 Ga0157374_10077419 Ga0157374_100774194 247
166 3300013306 Ga0163162_10539261 Ga0163162_105392612 247
167 3300013307 Ga0157372_10140862 Ga0157372_101408623 247
168 3300013307 Ga0157372_10213052 Ga0157372_102130522 247
169 3300013307 Ga0157372_10227504 Ga0157372_102275042 247
170 3300013308 Ga0157375_10205438 Ga0157375_102054382 247
171 3300014969 Ga0157376_10544931 Ga0157376_105449311 247
172 3300020082 Ga0206353_10495403 Ga0206353_104954031 247
173 3300025228 Ga0209672_100006 Ga0209672_100006461 247
174 3300025229 Ga0209147_101703 Ga0209147_1017034 247
175 3300025231 Ga0207427_100010 Ga0207427_100010110 247
176 3300025233 Ga0209437_100216 Ga0209437_10021695 247
177 3300025242 Ga0209258_101795 Ga0209258_1017955 247
178 3300025254 Ga0209148_1000015 Ga0209148_1000015305 247
179 3300025261 Ga0209233_1000001 Ga0209233_10000011839 247
180 3300025272 Ga0209455_1000013 Ga0209455_1000013305 247
181 3300025272 Ga0209455_1002099 Ga0209455_10020993 247
182 3300025911 Ga0207654_10000001 Ga0207654_100000011766 247
183 3300025914 Ga0207671_10037050 Ga0207671_100370504 247
184 3300025924 Ga0207694_10000656 Ga0207694_1000065618 247
185 3300025929 Ga0207664_10330690 Ga0207664_103306902 247
186 3300025932 Ga0207690_10117915 Ga0207690_101179152 247
187 3300025940 Ga0207691_10069928 Ga0207691_100699282 247
188 3300025941 Ga0207711_10001556 Ga0207711_1000155610 247
189 3300026088 Ga0207641_10100687 Ga0207641_101006871 247
190 3300026095 Ga0207676_10012231 Ga0207676_100122316 247
191 3300026116 Ga0207674_10008386 Ga0207674_100083864 247
192 3300031548 Ga0307408_100368857 Ga0307408_1003688572 247
193 3300031649 Ga0307514_10011711 Ga0307514_100117119 247
194 3300031995 Ga0307409_100325340 Ga0307409_1003253401 247
195 3300032004 Ga0307414_10556622 Ga0307414_105566221 247
196 3300037312 Ga0395899_0008106 Ga0395899_0008106_3178_3996 247
197 3300037418 Ga0395900_0000774 Ga0395900_0000774_7022_7840 247
198 3300037418 Ga0395900_0121789 Ga0395900_0121789_369_1148 247
199 3300037466 Ga0395898_0000015 Ga0395898_0000015_78172_78990 247
200 3300037466 Ga0395898_0299682 Ga0395898_0299682_652_1416 247
201 3300038443 Ga0395901_0254229 Ga0395901_0254229_669_1448 247
202 3300038443 Ga0395901_0267878 Ga0395901_0267878_143_907 247
203 3300041452 Ga0451793_0574673 Ga0451793_0574673_96_860 247
204 3300041509 Ga0451843_1231806 Ga0451843_1231806_74_847 247
205 3300044658 Ga0466972_0026252 Ga0466972_0026252_1609_2442 247
206 3300044658 Ga0466972_0065619 Ga0466972_0065619_308_1150 247
207 3300044683 Ga0466965_0026603 Ga0466965_0026603_1386_2219 247
208 3300044683 Ga0466965_0059998 Ga0466965_0059998_299_1141 247
209 3300044693 Ga0466961_0033587 Ga0466961_0033587_1241_2074 247
210 3300044693 Ga0466961_0110010 Ga0466961_0110010_54_896 247
211 3300044693 Ga0466961_0199441 Ga0466961_0199441_216_1049 247
212 3300044765 Ga0466970_0033166 Ga0466970_0033166_1733_2566 247
213 3300044765 Ga0466970_0069549 Ga0466970_0069549_926_1768 247
214 3300044842 Ga0466957_0149353 Ga0466957_0149353_472_1314 247
215 3300044901 Ga0466960_0019751 Ga0466960_0019751_586_1419 247
216 3300044901 Ga0466960_0058671 Ga0466960_0058671_586_1428 247
217 3300044901 Ga0466960_0103813 Ga0466960_0103813_591_1400 247
218 3300048903 Ga0496100_0108236 Ga0496100_0108236_860_1621 247
219 3300048903 Ga0496100_0253449 Ga0496100_0253449_399_1214 247
220 3300048904 Ga0496101_0013198 Ga0496101_0013198_1279_2094 247
221 3300048906 Ga0496103_0013353 Ga0496103_0013353_3594_4409 247
222 3300048907 Ga0496104_0212877 Ga0496104_0212877_287_1102 247
223 3300048908 Ga0496105_0016792 Ga0496105_0016792_215_1030 247
224 3300048908 Ga0496105_0020412 Ga0496105_0020412_3293_4054 247
225 3300048910 Ga0496107_0138934 Ga0496107_0138934_828_1589 247
226 3300048916 Ga0496113_0584700 Ga0496113_0584700_48_881 247
227 3300048917 Ga0496114_0008364 Ga0496114_0008364_2348_3163 247
228 3300048918 Ga0496115_0028007 Ga0496115_0028007_2141_2902 247
229 3300048918 Ga0496115_0075698 Ga0496115_0075698_539_1300 247
230 3300048919 Ga0496116_0065779 Ga0496116_0065779_1311_2066 247
231 3300048920 Ga0496117_0010512 Ga0496117_0010512_6425_7258 247
232 3300048920 Ga0496117_0027939 Ga0496117_0027939_3088_3846 247
233 3300048920 Ga0496117_0169597 Ga0496117_0169597_57_812 247
234 3300048921 Ga0496118_0018929 Ga0496118_0018929_1591_2346 247
235 3300048921 Ga0496118_0024892 Ga0496118_0024892_2385_3143 247
236 3300048921 Ga0496118_0076709 Ga0496118_0076709_450_1223 247
237 3300048922 Ga0496119_0003767 Ga0496119_0003767_4152_4925 247
238 3300048922 Ga0496119_0005179 Ga0496119_0005179_8717_9475 247
239 3300048923 Ga0496120_0000738 Ga0496120_0000738_60_833 247
240 3300048923 Ga0496120_0014553 Ga0496120_0014553_2241_3026 247
241 3300048923 Ga0496120_0174715 Ga0496120_0174715_118_876 247
242 3300048925 Ga0496122_0000200 Ga0496122_0000200_110007_110765 247
243 3300048925 Ga0496122_0015362 Ga0496122_0015362_3158_3937 247
244 3300048925 Ga0496122_0036350 Ga0496122_0036350_615_1403 247
245 3300048926 Ga0496123_0000076 Ga0496123_0000076_83272_84030 247
246 3300048926 Ga0496123_0001004 Ga0496123_0001004_19355_20143 247
247 3300048926 Ga0496123_0052510 Ga0496123_0052510_806_1585 247
248 3300048927 Ga0496124_0002982 Ga0496124_0002982_8515_9273 247
249 3300048928 Ga0496125_0218079 Ga0496125_0218079_246_1019 247
250 3300048929 Ga0496126_0004104 Ga0496126_0004104_3172_3921 247
251 3300048929 Ga0496126_0062888 Ga0496126_0062888_810_1565 247
252 3300049568 Ga0501031_0003885 Ga0501031_0003885_3363_4142 247
253 3300049569 Ga0501032_0009019 Ga0501032_0009019_3266_4024 247
254 3300049570 Ga0501033_0004704 Ga0501033_0004704_922_1701 247
255 3300049570 Ga0501033_0015118 Ga0501033_0015118_4774_5532 247
256 3300049570 Ga0501033_0166776 Ga0501033_0166776_553_1332 247
257 3300049571 Ga0501034_0015230 Ga0501034_0015230_224_1003 247
258 3300049571 Ga0501034_0033529 Ga0501034_0033529_3732_4490 247
259 3300049571 Ga0501034_0039409 Ga0501034_0039409_2753_3523 247
260 3300049571 Ga0501034_0062654 Ga0501034_0062654_1157_1903 247
261 3300049571 Ga0501034_0121334 Ga0501034_0121334_1681_2460 247
262 3300049572 Ga0501036_0011736 Ga0501036_0011736_3588_4346 247
263 3300049572 Ga0501036_0018656 Ga0501036_0018656_113_892 247
264 3300049573 Ga0501037_0000536 Ga0501037_0000536_25589_26347 247
265 3300049573 Ga0501037_0006594 Ga0501037_0006594_5747_6526 247
266 3300049574 Ga0501038_0001138 Ga0501038_0001138_1912_2670 247
267 3300049574 Ga0501038_0043489 Ga0501038_0043489_1115_1858 247
268 3300049574 Ga0501038_0087844 Ga0501038_0087844_896_1675 247
269 3300049575 Ga0501039_0011213 Ga0501039_0011213_2239_2997 247
270 3300049575 Ga0501039_0133503 Ga0501039_0133503_350_1129 247
271 3300049579 Ga0501043_0001612 Ga0501043_0001612_5670_6449 247
272 3300049579 Ga0501043_0156021 Ga0501043_0156021_366_1145 247
273 3300049580 Ga0501046_0003207 Ga0501046_0003207_6475_7233 247
274 3300049580 Ga0501046_0004162 Ga0501046_0004162_3197_3976 247
275 3300049580 Ga0501046_0011527 Ga0501046_0011527_6593_7372 247
276 3300049581 Ga0501047_0004897 Ga0501047_0004897_10050_10808 247
277 3300049581 Ga0501047_0240478 Ga0501047_0240478_186_965 247
278 3300049582 Ga0501048_0002639 Ga0501048_0002639_11222_12001 247
279 3300049582 Ga0501048_0085341 Ga0501048_0085341_1237_1995 247
280 3300049585 Ga0501069_0010881 Ga0501069_0010881_2973_3752 247
281 3300049585 Ga0501069_0134551 Ga0501069_0134551_657_1403 247
282 3300049586 Ga0501070_0000167 Ga0501070_0000167_11058_11873 247
283 3300049586 Ga0501070_0031964 Ga0501070_0031964_3197_3955 247
284 3300049586 Ga0501070_0034745 Ga0501070_0034745_2506_3285 247
285 3300049587 Ga0501071_0000056 Ga0501071_0000056_36643_37389 247
286 3300049589 Ga0501073_0182361 Ga0501073_0182361_271_1029 247
287 3300049589 Ga0501073_0207372 Ga0501073_0207372_137_916 247
288 3300049822 Ga0501035_0008660 Ga0501035_0008660_255_1034 247
289 3300049822 Ga0501035_0020426 Ga0501035_0020426_3171_3986 247
290 3300049822 Ga0501035_0288874 Ga0501035_0288874_415_1194 247
291 3300049823 Ga0501044_0001773 Ga0501044_0001773_1912_2670 247
292 3300049823 Ga0501044_0242566 Ga0501044_0242566_872_1651 247
293 3300049824 Ga0501045_0018452 Ga0501045_0018452_918_1697 247
294 3300050516 nmdc:mga0sz30_179036_c1 nmdc:mga0sz30_179036_c1_56_889 247
295 3300053080 Ga0500635_0000028 Ga0500635_0000028_8700_9461 247
296 3300053080 Ga0500635_0001319 Ga0500635_0001319_3614_4387 247
297 3300053087 Ga0500643_000813 Ga0500643_000813_7504_8274 247
298 3300053098 Ga0500650_0005785 Ga0500650_0005785_505_1269 247
299 3300053104 Ga0500556_0000001 Ga0500556_0000001_400776_401555 247
300 3300053136 Ga0500559_0000263 Ga0500559_0000263_2944_3738 247
301 3300053136 Ga0500559_0002832 Ga0500559_0002832_2525_3322 247
302 3300053136 Ga0500559_0079498 Ga0500559_0079498_638_1462 247
303 3300053139 Ga0500568_0000006 Ga0500568_0000006_306062_306841 247
304 3300053139 Ga0500568_0000529 Ga0500568_0000529_21357_22115 247
305 3300053140 Ga0500573_0003293 Ga0500573_0003293_6485_7264 247
306 3300053140 Ga0500573_0006030 Ga0500573_0006030_954_1742 247
307 3300053140 Ga0500573_0018147 Ga0500573_0018147_239_1042 247
308 3300053140 Ga0500573_0021178 Ga0500573_0021178_2664_3425 247
309 3300053140 Ga0500573_0027687 Ga0500573_0027687_1173_1958 247
310 3300053142 Ga0500577_0002918 Ga0500577_0002918_2838_3602 247
311 3300053142 Ga0500577_0120014 Ga0500577_0120014_50_835 247
312 3300059477 Ga0587084_003309 Ga0587084_003309_414_1157 247
313 3300061719 Ga0466962_0012934 Ga0466962_0012934_1078_1911 247
314 iso_pu_bacteria 2906799679 2906800730 247
315 3300001979 JGI24740J21852_10007780 JGI24740J21852_100077804 248
316 3300002738 JGI25154J39366_1002526 JGI25154J39366_10025261 248
317 3300006051 Ga0075364_10090084 Ga0075364_100900843 248
318 3300006051 Ga0075364_10266577 Ga0075364_102665772 248
319 3300025246 Ga0209646_1000167 Ga0209646_100016717 248
320 3300031901 Ga0307406_10001126 Ga0307406_100011268 248
321 3300031901 Ga0307406_10007935 Ga0307406_100079353 248
322 3300032004 Ga0307414_10132502 Ga0307414_101325021 248
323 3300032004 Ga0307414_10265309 Ga0307414_102653093 248
324 3300032004 Ga0307414_10331533 Ga0307414_103315332 248
325 3300044765 Ga0466970_0002717 Ga0466970_0002717_7116_7862 248
326 3300046453 Ga0495627_000742 Ga0495627_000742_19414_20160 248
327 3300048920 Ga0496117_0001055 Ga0496117_0001055_7011_7757 248
328 3300048921 Ga0496118_0023435 Ga0496118_0023435_632_1378 248
329 3300048925 Ga0496122_0012333 Ga0496122_0012333_6793_7539 248
330 3300048925 Ga0496122_0216527 Ga0496122_0216527_315_1061 248
331 3300048926 Ga0496123_0219223 Ga0496123_0219223_142_888 248
332 3300048928 Ga0496125_0000894 Ga0496125_0000894_32968_33714 248
333 3300048928 Ga0496125_0139642 Ga0496125_0139642_489_1235 248
334 3300048928 Ga0496125_0160753 Ga0496125_0160753_195_941 248
335 3300048929 Ga0496126_0004369 Ga0496126_0004369_14586_15332 248
336 3300049571 Ga0501034_0001738 Ga0501034_0001738_25250_25996 248
337 3300050491 nmdc:mga00v17_242686_c1 nmdc:mga00v17_242686_c1_181_927 248
338 3300050491 nmdc:mga00v17_54345_c1 nmdc:mga00v17_54345_c1_532_1278 248
339 iso_pu_bacteria 2643221542 2643733577 248
340 iso_pu_bacteria 2643221630 2644170152 248
341 iso_pu_bacteria 2862993130 2862996072 248
342 iso_pu_bacteria 2946041624 2946044298 248
343 iso_pu_bacteria 2946080515 2946080851 248
344 iso_pu_bacteria 2964326757 2964326801 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00480

ROK

ROK family

7

173

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1woq-assembly2.cif.gz_B crystal structure of inorganic polyphosphate/atp-glucomannokinase from arthrobacter sp. strain km at 1.8 a resolution 0.9661 1 247
1woq-assembly2.cif.gz_B crystal structure of inorganic polyphosphate/atp-glucomannokinase from arthrobacter sp. strain km at 1.8 a resolution 0.9584 1 247
5f7r-assembly1.cif.gz_A rok repressor lmo0178 from listeria monocytogenes bound to inducer 0.8586 3 246
5f7r-assembly1.cif.gz_A rok repressor lmo0178 from listeria monocytogenes bound to inducer 0.8426 3 246
3lm2-assembly1.cif.gz_B crystal structure of putative kinase. (17743352) from agrobacterium tumefaciens str. c58 (dupont) at 1.70 a resolution 0.8308 1 242
ID Description Score Start End Superfamily
1woqA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9816 110 242 3.30.420.40
af_P9WIN1_10_122_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9408 3 108 3.30.420.40
1woqB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9292 1 108 3.30.420.40
1woqA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9133 110 242 3.30.420.40
1woqB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8894 1 108 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A350WP05-F1-model_v4 Polyphosphate glucokinase 0.9913 107 242 GO:0016301
AF-A0A7V9ITG3-F1-model_v4 ROK family protein 0.99 104 248
AF-A0A3D2ND15-F1-model_v4 Polyphosphate glucokinase 0.9862 110 242 GO:0016301
AF-A0A3D2NEK8-F1-model_v4 Polyphosphate glucokinase 0.983 2 114 GO:0016301
AF-A0A1H5V0A6-F1-model_v4 Polyphosphate glucokinase 0.9819 5 247 GO:0016301

Feature Viewer

pLDDT pTM Quality
93.47 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map