F416066

General Info

Members Datasets Scaffolds Average Seq Length
344 182 688 147

Family's Representative Sequence

Representative Sequence 3300042005|Ga0439448_0011619|Ga0439448_0011619_311_823
Length 170
Sequence MRAVPPHDRQGREPAMATTKKPAKRTAATGKTEGFSDEERGAMKERAKELRAEAXXEKDKAAGEQAVLEKIAEMPEPDRAMAKRLHAIIKESAPVLSPKTWYGMPAYAKEGKVVCFFTPASKFKERYATLGFNGDANLDDGSMWPTAYALTKLTAADEKRIGALVKKAVS

Samples

Sample ID Description Type Environment
1 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
109 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
110 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
111 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
112 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
113 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
114 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
115 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
116 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
117 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
118 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
119 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
120 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
180 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 13.37
Rhizosphere 86.05
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439448_0011619 3300042005 Bacteria 2626
2 JGI24751J29686_10006791 3300002459 Bacteria 2332
3 JGI25406J46586_10027030 3300003203 Bacteria 2205
4 JGI25407J50210_10028261 3300003373 Bacteria 1455
5 JGI25407J50210_10065729 3300003373 Bacteria 908
6 Ga0070683_100006619 3300005329 Bacteria 9729
7 Ga0070683_101952933 3300005329 Bacteria 564
8 Ga0068869_102051449 3300005334 Bacteria 514
9 Ga0070680_100012593 3300005336 Bacteria 6576
10 Ga0070660_100386343 3300005339 Bacteria 1156
11 Ga0070661_100143288 3300005344 Bacteria 1802
12 Ga0070671_100673062 3300005355 Bacteria 897
13 Ga0070659_100778743 3300005366 Bacteria 831
14 Ga0070714_100237506 3300005435 Bacteria 1681
15 Ga0070713_100116367 3300005436 Bacteria 2338
16 Ga0070705_100273407 3300005440 Bacteria 1197
17 Ga0070708_100003373 3300005445 Bacteria 12514
18 Ga0070678_100023148 3300005456 Bacteria 4134
19 Ga0070678_100078789 3300005456 Bacteria 2490
20 Ga0070662_100148443 3300005457 Bacteria 1823
21 Ga0070681_10003244 3300005458 Bacteria 15165
22 Ga0070685_10250082 3300005466 Bacteria 1174
23 Ga0070706_100000347 3300005467 Bacteria 55956
24 Ga0070707_100001550 3300005468 Bacteria 22336
25 Ga0070707_100825909 3300005468 Bacteria 891
26 Ga0070699_100605854 3300005518 Bacteria 999
27 Ga0070679_100089522 3300005530 Bacteria 3065
28 Ga0070684_100000331 3300005535 Bacteria 32759
29 Ga0070697_100064912 3300005536 Bacteria 2982
30 Ga0070686_100530649 3300005544 Bacteria 918
31 Ga0070696_100102290 3300005546 Bacteria 2054
32 Ga0070696_100134431 3300005546 Bacteria 1802
33 Ga0070693_100003493 3300005547 Bacteria 7333
34 Ga0070665_100542557 3300005548 Bacteria 1175
35 Ga0070704_100563451 3300005549 Bacteria 997
36 Ga0070704_101511833 3300005549 Bacteria 618
37 Ga0070664_100131453 3300005564 Bacteria 2199
38 Ga0068856_100050772 3300005614 Bacteria 4089
39 Ga0068856_100292492 3300005614 Bacteria 1646
40 Ga0070702_101345062 3300005615 Bacteria 582
41 Ga0068858_100676205 3300005842 Bacteria 1004
42 Ga0068860_101519441 3300005843 Bacteria 691
43 Ga0081455_10006161 3300005937 Bacteria 12937
44 Ga0081455_10020276 3300005937 Bacteria 6266
45 Ga0081455_10040670 3300005937 Bacteria 4097
46 Ga0081455_10760688 3300005937 Bacteria 611
47 Ga0081538_10000886 3300005981 Bacteria 32387
48 Ga0081538_10002562 3300005981 Bacteria 17661
49 Ga0081538_10003456 3300005981 Bacteria 14920
50 Ga0081538_10009725 3300005981 Bacteria 7975
51 Ga0081538_10011132 3300005981 Bacteria 7312
52 Ga0081538_10019455 3300005981 Bacteria 5046
53 Ga0081538_10020118 3300005981 Bacteria 4930
54 Ga0081538_10040973 3300005981 Bacteria 2946
55 Ga0081538_10056945 3300005981 Bacteria 2284
56 Ga0081538_10077750 3300005981 Bacteria 1785
57 Ga0081538_10086203 3300005981 Bacteria 1645
58 Ga0081538_10144094 3300005981 Bacteria 1092
59 Ga0081538_10183521 3300005981 Bacteria 891
60 Ga0081538_10239561 3300005981 Bacteria 701
61 Ga0081538_10343667 3300005981 Bacteria 541
62 Ga0081539_10000135 3300005985 Bacteria 172789
63 Ga0081539_10004336 3300005985 Bacteria 15819
64 Ga0081539_10048966 3300005985 Bacteria 2401
65 Ga0075364_10026499 3300006051 Bacteria 3698
66 Ga0070712_100009826 3300006175 Bacteria 6030
67 Ga0070712_100049101 3300006175 Bacteria 2929
68 Ga0075428_100577829 3300006844 Bacteria 1201
69 Ga0075430_100017206 3300006846 Bacteria 6157
70 Ga0075430_100034839 3300006846 Bacteria 4274
71 Ga0075430_100610801 3300006846 Bacteria 900
72 Ga0075431_100027560 3300006847 Bacteria 5831
73 Ga0075433_10500368 3300006852 Bacteria 1070
74 Ga0075433_10813737 3300006852 Bacteria 816
75 Ga0068865_100104422 3300006881 Bacteria 2080
76 Ga0075436_100284116 3300006914 Bacteria 1183
77 Ga0075436_100416355 3300006914 Bacteria 975
78 Ga0075435_100015654 3300007076 Bacteria 5706
79 Ga0105245_10000499 3300009098 Bacteria 35958
80 Ga0105245_10034231 3300009098 Bacteria 4505
81 Ga0114129_10022123 3300009147 Bacteria 9023
82 Ga0114129_10199713 3300009147 Bacteria 2709
83 Ga0105243_10319409 3300009148 Bacteria 1414
84 Ga0105243_10489664 3300009148 Bacteria 1162
85 Ga0105241_11705326 3300009174 Bacteria 612
86 Ga0105242_10180407 3300009176 Bacteria 1862
87 Ga0105242_11742190 3300009176 Bacteria 660
88 Ga0105242_12190626 3300009176 Unclassified 598
89 Ga0105239_11288900 3300010375 Bacteria 843
90 Ga0105246_10051466 3300011119 Bacteria 2828
91 Ga0105246_10642088 3300011119 Bacteria 923
92 Ga0157373_10591731 3300013100 Bacteria 807
93 Ga0157371_10472758 3300013102 Bacteria 923
94 Ga0157374_10016335 3300013296 Bacteria 6521
95 Ga0157374_11897004 3300013296 Bacteria 622
96 Ga0157378_10451840 3300013297 Bacteria 1275
97 Ga0157375_11094793 3300013308 Bacteria 932
98 Ga0157375_11336251 3300013308 Bacteria 843
99 Ga0157379_11415364 3300014968 Bacteria 674
100 Ga0157376_10364981 3300014969 Bacteria 1386
101 Ga0206352_10581544 3300020078 Bacteria 522
102 Ga0207642_10107545 3300025899 Bacteria 1413
103 Ga0207688_10123608 3300025901 Bacteria 1512
104 Ga0207699_10253183 3300025906 Bacteria 1214
105 Ga0207705_10252737 3300025909 Bacteria 1344
106 Ga0207684_10000021 3300025910 Bacteria 340887
107 Ga0207707_10034731 3300025912 Bacteria 4411
108 Ga0207693_10029180 3300025915 Bacteria 4360
109 Ga0207663_10049346 3300025916 Bacteria 2610
110 Ga0207660_10003034 3300025917 Bacteria 10987
111 Ga0207657_10326775 3300025919 Bacteria 1212
112 Ga0207649_10082562 3300025920 Bacteria 2084
113 Ga0207652_10660529 3300025921 Bacteria 934
114 Ga0207646_10000067 3300025922 Bacteria 146410
115 Ga0207646_10681386 3300025922 Bacteria 920
116 Ga0207687_10010045 3300025927 Bacteria 6193
117 Ga0207687_10055834 3300025927 Bacteria 2768
118 Ga0207644_10552298 3300025931 Bacteria 953
119 Ga0207690_10604698 3300025932 Bacteria 895
120 Ga0207686_10196197 3300025934 Bacteria 1443
121 Ga0207686_10863153 3300025934 Bacteria 729
122 Ga0207709_10432559 3300025935 Bacteria 1013
123 Ga0207689_10188906 3300025942 Bacteria 1699
124 Ga0207661_10000980 3300025944 Bacteria 18849
125 Ga0207678_10216807 3300026067 Bacteria 1638
126 Ga0207708_10356604 3300026075 Bacteria 1201
127 Ga0207702_10051853 3300026078 Bacteria 3469
128 Ga0207702_10081736 3300026078 Bacteria 2807
129 Ga0207675_100004306 3300026118 Bacteria 13755
130 Ga0207683_10008021 3300026121 Bacteria 9030
131 Ga0207683_10138653 3300026121 Bacteria 2190
132 Ga0209974_10228469 3300027876 Bacteria 695
133 Ga0268266_10450346 3300028379 Bacteria 1224
134 Ga0268264_11753707 3300028381 Bacteria 631
135 Ga0307408_100008146 3300031548 Bacteria 6923
136 Ga0307405_10007714 3300031731 Bacteria 5409
137 Ga0307405_10271337 3300031731 Bacteria 1272
138 Ga0307405_10331746 3300031731 Bacteria 1166
139 Ga0307413_10142752 3300031824 Bacteria 1657
140 Ga0307413_10353098 3300031824 Bacteria 1135
141 Ga0307410_10014926 3300031852 Bacteria 4591
142 Ga0307410_10235332 3300031852 Bacteria 1416
143 Ga0307410_10619680 3300031852 Bacteria 904
144 Ga0307406_10001615 3300031901 Bacteria 12398
145 Ga0307406_10017935 3300031901 Bacteria 4129
146 Ga0307407_10001766 3300031903 Bacteria 8071
147 Ga0307407_10016190 3300031903 Bacteria 3707
148 Ga0307407_10184208 3300031903 Bacteria 1386
149 Ga0307407_11109457 3300031903 Bacteria 615
150 Ga0307412_10065261 3300031911 Bacteria 2463
151 Ga0307412_10166088 3300031911 Bacteria 1646
152 Ga0307412_10512102 3300031911 Bacteria 1001
153 Ga0307409_100003410 3300031995 Bacteria 8631
154 Ga0307409_100053998 3300031995 Bacteria 3091
155 Ga0307409_100230164 3300031995 Bacteria 1679
156 Ga0307409_100540092 3300031995 Bacteria 1142
157 Ga0307416_100000506 3300032002 Bacteria 19880
158 Ga0307416_100000815 3300032002 Bacteria 16363
159 Ga0307416_100006694 3300032002 Bacteria 7236
160 Ga0307416_101493608 3300032002 Bacteria 781
161 Ga0307416_101920685 3300032002 Bacteria 695
162 Ga0307414_10467779 3300032004 Bacteria 1109
163 Ga0307411_10333314 3300032005 Bacteria 1230
164 Ga0307415_100000831 3300032126 Bacteria 14149
165 Ga0307415_100000953 3300032126 Bacteria 13325
166 Ga0307415_100056280 3300032126 Bacteria 2695
167 Ga0373960_0305035 3300035121 Bacteria 593
168 Ga0395900_0033379 3300037418 Bacteria 5297
169 Ga0395900_0060712 3300037418 Bacteria 3890
170 Ga0395900_0254147 3300037418 Bacteria 1757
171 Ga0395898_0040807 3300037466 Bacteria 4587
172 Ga0395898_0196386 3300037466 Bacteria 1927
173 Ga0395905_0093134 3300037471 Bacteria 2826
174 Ga0395905_0179271 3300037471 Bacteria 1989
175 Ga0395905_0389352 3300037471 Bacteria 1288
176 Ga0395905_0412842 3300037471 Bacteria 1245
177 Ga0395901_0011190 3300038443 Bacteria 9094
178 Ga0395901_0018433 3300038443 Bacteria 7125
179 Ga0439448_0000120 3300042005 Bacteria 14663
180 Ga0439448_0012289 3300042005 Bacteria 2560
181 Ga0439448_0055176 3300042005 Bacteria 1306
182 Ga0439450_001329 3300042008 Bacteria 3592
183 Ga0439454_013880 3300042011 Bacteria 1111
184 Ga0439456_085984 3300042013 Bacteria 704
185 Ga0439463_000593 3300042016 Bacteria 10072
186 Ga0439463_002321 3300042016 Bacteria 4854
187 Ga0439463_064184 3300042016 Bacteria 939
188 Ga0450914_008614 3300042118 Bacteria 948
189 Ga0450905_017851 3300042142 Bacteria 1031
190 Ga0439444_0002468 3300042437 Bacteria 2528
191 Ga0439464_0002185 3300042439 Bacteria 4785
192 Ga0439464_0008849 3300042439 Bacteria 2639
193 Ga0439464_0024426 3300042439 Bacteria 1671
194 Ga0439460_0003533 3300042461 Bacteria 3779
195 Ga0439460_0013338 3300042461 Bacteria 2148
196 Ga0439460_0086147 3300042461 Bacteria 992
197 Ga0450916_003024 3300042530 Bacteria 1824
198 Ga0439440_0000055 3300042993 Bacteria 14143
199 Ga0495584_0273150 3300046491 Bacteria 859
200 Ga0495585_0270735 3300046492 Bacteria 842
201 Ga0495594_0125197 3300046499 Bacteria 1454
202 Ga0495667_0099927 3300046559 Bacteria 1878
203 Ga0495635_0598836 3300046663 Bacteria 720
204 Ga0495588_0474300 3300046674 Bacteria 656
205 Ga0495623_0108992 3300046679 Bacteria 1680
206 Ga0495589_0136336 3300046794 Bacteria 1177
207 Ga0495675_0021672 3300047444 Bacteria 4094
208 Ga0495602_0322639 3300048088 Bacteria 1123
209 Ga0496100_0027643 3300048903 Bacteria 3490
210 Ga0496100_0758253 3300048903 Bacteria 759
211 Ga0496101_0013673 3300048904 Bacteria 5444
212 Ga0496101_0060307 3300048904 Bacteria 2752
213 Ga0496101_0068204 3300048904 Bacteria 2600
214 Ga0496102_0001352 3300048905 Bacteria 21953
215 Ga0496102_0512869 3300048905 Bacteria 1121
216 Ga0496102_0631639 3300048905 Bacteria 994
217 Ga0496103_0014383 3300048906 Bacteria 4700
218 Ga0496103_0077918 3300048906 Bacteria 2081
219 Ga0496103_0356518 3300048906 Bacteria 940
220 Ga0496103_0485833 3300048906 Bacteria 791
221 Ga0496104_0026107 3300048907 Bacteria 5389
222 Ga0496104_0033894 3300048907 Bacteria 4759
223 Ga0496104_0113326 3300048907 Bacteria 2600
224 Ga0496104_0265080 3300048907 Bacteria 1630
225 Ga0496105_0011866 3300048908 Bacteria 6900
226 Ga0496105_0039392 3300048908 Bacteria 3895
227 Ga0496105_0463338 3300048908 Bacteria 999
228 Ga0496105_1002762 3300048908 Bacteria 624
229 Ga0496106_0233917 3300048909 Bacteria 1467
230 Ga0496106_0283990 3300048909 Bacteria 1326
231 Ga0496106_0432448 3300048909 Bacteria 1057
232 Ga0496107_0043955 3300048910 Bacteria 3210
233 Ga0496107_0136403 3300048910 Bacteria 1813
234 Ga0496108_0072330 3300048911 Bacteria 2910
235 Ga0496108_0148839 3300048911 Bacteria 2020
236 Ga0496108_0166264 3300048911 Bacteria 1907
237 Ga0496109_0013993 3300048912 Bacteria 6974
238 Ga0496109_0018838 3300048912 Bacteria 6073
239 Ga0496110_0003300 3300048913 Bacteria 12318
240 Ga0496110_0051030 3300048913 Bacteria 3634
241 Ga0496110_0069093 3300048913 Bacteria 3127
242 Ga0496111_0002028 3300048914 Bacteria 12057
243 Ga0496111_0057795 3300048914 Bacteria 2808
244 Ga0496112_0469906 3300048915 Bacteria 1195
245 Ga0496112_0572357 3300048915 Bacteria 1062
246 Ga0496113_0108561 3300048916 Bacteria 2157
247 Ga0496114_0003219 3300048917 Bacteria 12522
248 Ga0496114_0008993 3300048917 Bacteria 7917
249 Ga0496114_0046394 3300048917 Bacteria 3610
250 Ga0496114_0130964 3300048917 Bacteria 2166
251 Ga0496115_0012198 3300048918 Bacteria 6461
252 Ga0496115_0128234 3300048918 Bacteria 2090
253 Ga0496115_0533253 3300048918 Bacteria 940
254 Ga0496115_0552850 3300048918 Bacteria 920
255 Ga0501031_0008182 3300049568 Bacteria 6805
256 Ga0501033_0399446 3300049570 Bacteria 959
257 Ga0501033_0671721 3300049570 Bacteria 706
258 Ga0501036_0000787 3300049572 Bacteria 23494
259 Ga0501038_0117124 3300049574 Bacteria 2201
260 Ga0501039_0004745 3300049575 Bacteria 10293
261 Ga0501039_0078340 3300049575 Bacteria 2571
262 Ga0501039_0653688 3300049575 Bacteria 823
263 Ga0501040_0001366 3300049576 Bacteria 15412
264 Ga0501040_0107805 3300049576 Bacteria 1947
265 Ga0501040_0269464 3300049576 Bacteria 1216
266 Ga0501040_0437786 3300049576 Bacteria 941
267 Ga0501040_0736272 3300049576 Bacteria 713
268 Ga0501041_0007518 3300049577 Bacteria 6395
269 Ga0501041_0087868 3300049577 Bacteria 1919
270 Ga0501041_0338027 3300049577 Bacteria 951
271 Ga0501042_0000288 3300049578 Bacteria 24839
272 Ga0501042_0049816 3300049578 Bacteria 2989
273 Ga0501042_0543278 3300049578 Bacteria 844
274 Ga0501046_0002896 3300049580 Bacteria 15911
275 Ga0501046_0199757 3300049580 Bacteria 1488
276 Ga0501046_0768091 3300049580 Bacteria 676
277 Ga0501048_0015317 3300049582 Bacteria 5663
278 Ga0501048_0020770 3300049582 Bacteria 4812
279 Ga0501068_0222102 3300049584 Bacteria 1201
280 Ga0501068_0268855 3300049584 Bacteria 1088
281 Ga0501069_0927296 3300049585 Bacteria 530
282 Ga0501070_0033996 3300049586 Bacteria 4265
283 Ga0501070_0412380 3300049586 Bacteria 1091
284 Ga0501071_0000131 3300049587 Bacteria 30323
285 Ga0501071_0009590 3300049587 Bacteria 6457
286 Ga0501071_0087525 3300049587 Bacteria 2285
287 Ga0501071_0130398 3300049587 Bacteria 1867
288 Ga0501071_0309561 3300049587 Bacteria 1198
289 Ga0501072_0000411 3300049588 Bacteria 30561
290 Ga0501072_0067619 3300049588 Bacteria 2819
291 Ga0501072_0130260 3300049588 Bacteria 2005
292 Ga0501072_0213165 3300049588 Bacteria 1539
293 Ga0501072_0297431 3300049588 Bacteria 1283
294 Ga0501073_0221555 3300049589 Bacteria 1307
295 Ga0501074_0023005 3300049590 Bacteria 4532
296 Ga0501075_0045697 3300049591 Bacteria 3288
297 Ga0501075_0143872 3300049591 Bacteria 1817
298 Ga0501075_0239195 3300049591 Bacteria 1384
299 Ga0501075_0362455 3300049591 Bacteria 1105
300 Ga0501075_0778409 3300049591 Bacteria 728
301 Ga0501076_0014127 3300049592 Bacteria 6005
302 Ga0501076_0055960 3300049592 Bacteria 3129
303 Ga0501076_0338055 3300049592 Bacteria 1235
304 Ga0501076_0382121 3300049592 Bacteria 1157
305 Ga0501076_0837931 3300049592 Bacteria 758
306 Ga0501077_0023237 3300049593 Bacteria 3930
307 Ga0501077_0036749 3300049593 Bacteria 3121
308 Ga0501079_0001201 3300049741 Bacteria 18150
309 Ga0501079_0058609 3300049741 Bacteria 2971
310 Ga0501079_0143244 3300049741 Bacteria 1862
311 Ga0501079_0216600 3300049741 Bacteria 1496
312 Ga0501079_0228823 3300049741 Bacteria 1452
313 Ga0501079_0250660 3300049741 Bacteria 1384
314 Ga0501080_0041944 3300049742 Bacteria 4263
315 Ga0501080_0055078 3300049742 Bacteria 3704
316 Ga0501080_0157199 3300049742 Bacteria 2100
317 Ga0501081_0010837 3300049743 Bacteria 5955
318 Ga0501081_0039958 3300049743 Bacteria 3211
319 Ga0501081_0208603 3300049743 Bacteria 1418
320 Ga0501035_0139821 3300049822 Bacteria 2106
321 Ga0501035_0480880 3300049822 Bacteria 1024
322 Ga0501045_0013485 3300049824 Bacteria 5772
323 Ga0501045_0310700 3300049824 Bacteria 1173
324 Ga0501045_0422649 3300049824 Bacteria 991
325 nmdc:mga00v17_7176_c1 3300050491 Bacteria 5935
326 nmdc:mga05p37_23831_c1 3300050507 Bacteria 7432
327 nmdc:mga05p37_263516_c1 3300050507 Bacteria 2061
328 nmdc:mga0qj67_1345658_c1 3300050509 Bacteria 552
329 nmdc:mga0qj67_1345809_c1 3300050509 Bacteria 552
330 nmdc:mga06r32_265053_c1 3300050510 Bacteria 1705
331 nmdc:mga08y16_2180831_c1 3300050511 Bacteria 501
332 nmdc:mga0rr50_629309_c1 3300050513 Bacteria 915
333 nmdc:mga08x19_297247_c1 3300050514 Bacteria 1121
334 nmdc:mga0a205_1299793_c1 3300050515 Bacteria 575
335 Ga0501084_0000414 3300054114 Bacteria 33024
336 Ga0501084_0644309 3300054114 Bacteria 894
337 Ga0590074_002920 3300059423 Bacteria 2818
338 Ga0590077_021780 3300059426 Bacteria 1366
339 Ga0501082_0002123 3300060353 Bacteria 17455
340 Ga0501082_0141510 3300060353 Bacteria 2088
341 Ga0501082_0775521 3300060353 Bacteria 839
342 Ga0530510_0000576 3300061734 Bacteria 23667
343 Ga0530510_0114222 3300061734 Bacteria 1979
344 Ga0530510_0260755 3300061734 Bacteria 1292
345 Ga0439448_0011619
346 JGI24751J29686_10006791
347 JGI25406J46586_10027030
348 JGI25407J50210_10028261
349 JGI25407J50210_10065729
350 Ga0070683_100006619
351 Ga0070683_101952933
352 Ga0068869_102051449
353 Ga0070680_100012593
354 Ga0070660_100386343
355 Ga0070661_100143288
356 Ga0070671_100673062
357 Ga0070659_100778743
358 Ga0070714_100237506
359 Ga0070713_100116367
360 Ga0070705_100273407
361 Ga0070708_100003373
362 Ga0070678_100023148
363 Ga0070678_100078789
364 Ga0070662_100148443
365 Ga0070681_10003244
366 Ga0070685_10250082
367 Ga0070706_100000347
368 Ga0070707_100001550
369 Ga0070707_100825909
370 Ga0070699_100605854
371 Ga0070679_100089522
372 Ga0070684_100000331
373 Ga0070697_100064912
374 Ga0070686_100530649
375 Ga0070696_100102290
376 Ga0070696_100134431
377 Ga0070693_100003493
378 Ga0070665_100542557
379 Ga0070704_100563451
380 Ga0070704_101511833
381 Ga0070664_100131453
382 Ga0068856_100050772
383 Ga0068856_100292492
384 Ga0070702_101345062
385 Ga0068858_100676205
386 Ga0068860_101519441
387 Ga0081455_10006161
388 Ga0081455_10020276
389 Ga0081455_10040670
390 Ga0081455_10760688
391 Ga0081538_10000886
392 Ga0081538_10002562
393 Ga0081538_10003456
394 Ga0081538_10009725
395 Ga0081538_10011132
396 Ga0081538_10019455
397 Ga0081538_10020118
398 Ga0081538_10040973
399 Ga0081538_10056945
400 Ga0081538_10077750
401 Ga0081538_10086203
402 Ga0081538_10144094
403 Ga0081538_10183521
404 Ga0081538_10239561
405 Ga0081538_10343667
406 Ga0081539_10000135
407 Ga0081539_10004336
408 Ga0081539_10048966
409 Ga0075364_10026499
410 Ga0070712_100009826
411 Ga0070712_100049101
412 Ga0075428_100577829
413 Ga0075430_100017206
414 Ga0075430_100034839
415 Ga0075430_100610801
416 Ga0075431_100027560
417 Ga0075433_10500368
418 Ga0075433_10813737
419 Ga0068865_100104422
420 Ga0075436_100284116
421 Ga0075436_100416355
422 Ga0075435_100015654
423 Ga0105245_10000499
424 Ga0105245_10034231
425 Ga0114129_10022123
426 Ga0114129_10199713
427 Ga0105243_10319409
428 Ga0105243_10489664
429 Ga0105241_11705326
430 Ga0105242_10180407
431 Ga0105242_11742190
432 Ga0105242_12190626
433 Ga0105239_11288900
434 Ga0105246_10051466
435 Ga0105246_10642088
436 Ga0157373_10591731
437 Ga0157371_10472758
438 Ga0157374_10016335
439 Ga0157374_11897004
440 Ga0157378_10451840
441 Ga0157375_11094793
442 Ga0157375_11336251
443 Ga0157379_11415364
444 Ga0157376_10364981
445 Ga0206352_10581544
446 Ga0207642_10107545
447 Ga0207688_10123608
448 Ga0207699_10253183
449 Ga0207705_10252737
450 Ga0207684_10000021
451 Ga0207707_10034731
452 Ga0207693_10029180
453 Ga0207663_10049346
454 Ga0207660_10003034
455 Ga0207657_10326775
456 Ga0207649_10082562
457 Ga0207652_10660529
458 Ga0207646_10000067
459 Ga0207646_10681386
460 Ga0207687_10010045
461 Ga0207687_10055834
462 Ga0207644_10552298
463 Ga0207690_10604698
464 Ga0207686_10196197
465 Ga0207686_10863153
466 Ga0207709_10432559
467 Ga0207689_10188906
468 Ga0207661_10000980
469 Ga0207678_10216807
470 Ga0207708_10356604
471 Ga0207702_10051853
472 Ga0207702_10081736
473 Ga0207675_100004306
474 Ga0207683_10008021
475 Ga0207683_10138653
476 Ga0209974_10228469
477 Ga0268266_10450346
478 Ga0268264_11753707
479 Ga0307408_100008146
480 Ga0307405_10007714
481 Ga0307405_10271337
482 Ga0307405_10331746
483 Ga0307413_10142752
484 Ga0307413_10353098
485 Ga0307410_10014926
486 Ga0307410_10235332
487 Ga0307410_10619680
488 Ga0307406_10001615
489 Ga0307406_10017935
490 Ga0307407_10001766
491 Ga0307407_10016190
492 Ga0307407_10184208
493 Ga0307407_11109457
494 Ga0307412_10065261
495 Ga0307412_10166088
496 Ga0307412_10512102
497 Ga0307409_100003410
498 Ga0307409_100053998
499 Ga0307409_100230164
500 Ga0307409_100540092
501 Ga0307416_100000506
502 Ga0307416_100000815
503 Ga0307416_100006694
504 Ga0307416_101493608
505 Ga0307416_101920685
506 Ga0307414_10467779
507 Ga0307411_10333314
508 Ga0307415_100000831
509 Ga0307415_100000953
510 Ga0307415_100056280
511 Ga0373960_0305035
512 Ga0395900_0033379
513 Ga0395900_0060712
514 Ga0395900_0254147
515 Ga0395898_0040807
516 Ga0395898_0196386
517 Ga0395905_0093134
518 Ga0395905_0179271
519 Ga0395905_0389352
520 Ga0395905_0412842
521 Ga0395901_0011190
522 Ga0395901_0018433
523 Ga0439448_0000120
524 Ga0439448_0012289
525 Ga0439448_0055176
526 Ga0439450_001329
527 Ga0439454_013880
528 Ga0439456_085984
529 Ga0439463_000593
530 Ga0439463_002321
531 Ga0439463_064184
532 Ga0450914_008614
533 Ga0450905_017851
534 Ga0439444_0002468
535 Ga0439464_0002185
536 Ga0439464_0008849
537 Ga0439464_0024426
538 Ga0439460_0003533
539 Ga0439460_0013338
540 Ga0439460_0086147
541 Ga0450916_003024
542 Ga0439440_0000055
543 Ga0495584_0273150
544 Ga0495585_0270735
545 Ga0495594_0125197
546 Ga0495667_0099927
547 Ga0495635_0598836
548 Ga0495588_0474300
549 Ga0495623_0108992
550 Ga0495589_0136336
551 Ga0495675_0021672
552 Ga0495602_0322639
553 Ga0496100_0027643
554 Ga0496100_0758253
555 Ga0496101_0013673
556 Ga0496101_0060307
557 Ga0496101_0068204
558 Ga0496102_0001352
559 Ga0496102_0512869
560 Ga0496102_0631639
561 Ga0496103_0014383
562 Ga0496103_0077918
563 Ga0496103_0356518
564 Ga0496103_0485833
565 Ga0496104_0026107
566 Ga0496104_0033894
567 Ga0496104_0113326
568 Ga0496104_0265080
569 Ga0496105_0011866
570 Ga0496105_0039392
571 Ga0496105_0463338
572 Ga0496105_1002762
573 Ga0496106_0233917
574 Ga0496106_0283990
575 Ga0496106_0432448
576 Ga0496107_0043955
577 Ga0496107_0136403
578 Ga0496108_0072330
579 Ga0496108_0148839
580 Ga0496108_0166264
581 Ga0496109_0013993
582 Ga0496109_0018838
583 Ga0496110_0003300
584 Ga0496110_0051030
585 Ga0496110_0069093
586 Ga0496111_0002028
587 Ga0496111_0057795
588 Ga0496112_0469906
589 Ga0496112_0572357
590 Ga0496113_0108561
591 Ga0496114_0003219
592 Ga0496114_0008993
593 Ga0496114_0046394
594 Ga0496114_0130964
595 Ga0496115_0012198
596 Ga0496115_0128234
597 Ga0496115_0533253
598 Ga0496115_0552850
599 Ga0501031_0008182
600 Ga0501033_0399446
601 Ga0501033_0671721
602 Ga0501036_0000787
603 Ga0501038_0117124
604 Ga0501039_0004745
605 Ga0501039_0078340
606 Ga0501039_0653688
607 Ga0501040_0001366
608 Ga0501040_0107805
609 Ga0501040_0269464
610 Ga0501040_0437786
611 Ga0501040_0736272
612 Ga0501041_0007518
613 Ga0501041_0087868
614 Ga0501041_0338027
615 Ga0501042_0000288
616 Ga0501042_0049816
617 Ga0501042_0543278
618 Ga0501046_0002896
619 Ga0501046_0199757
620 Ga0501046_0768091
621 Ga0501048_0015317
622 Ga0501048_0020770
623 Ga0501068_0222102
624 Ga0501068_0268855
625 Ga0501069_0927296
626 Ga0501070_0033996
627 Ga0501070_0412380
628 Ga0501071_0000131
629 Ga0501071_0009590
630 Ga0501071_0087525
631 Ga0501071_0130398
632 Ga0501071_0309561
633 Ga0501072_0000411
634 Ga0501072_0067619
635 Ga0501072_0130260
636 Ga0501072_0213165
637 Ga0501072_0297431
638 Ga0501073_0221555
639 Ga0501074_0023005
640 Ga0501075_0045697
641 Ga0501075_0143872
642 Ga0501075_0239195
643 Ga0501075_0362455
644 Ga0501075_0778409
645 Ga0501076_0014127
646 Ga0501076_0055960
647 Ga0501076_0338055
648 Ga0501076_0382121
649 Ga0501076_0837931
650 Ga0501077_0023237
651 Ga0501077_0036749
652 Ga0501079_0001201
653 Ga0501079_0058609
654 Ga0501079_0143244
655 Ga0501079_0216600
656 Ga0501079_0228823
657 Ga0501079_0250660
658 Ga0501080_0041944
659 Ga0501080_0055078
660 Ga0501080_0157199
661 Ga0501081_0010837
662 Ga0501081_0039958
663 Ga0501081_0208603
664 Ga0501035_0139821
665 Ga0501035_0480880
666 Ga0501045_0013485
667 Ga0501045_0310700
668 Ga0501045_0422649
669 nmdc:mga00v17_7176_c1
670 nmdc:mga05p37_23831_c1
671 nmdc:mga05p37_263516_c1
672 nmdc:mga0qj67_1345658_c1
673 nmdc:mga0qj67_1345809_c1
674 nmdc:mga06r32_265053_c1
675 nmdc:mga08y16_2180831_c1
676 nmdc:mga0rr50_629309_c1
677 nmdc:mga08x19_297247_c1
678 nmdc:mga0a205_1299793_c1
679 Ga0501084_0000414
680 Ga0501084_0644309
681 Ga0590074_002920
682 Ga0590077_021780
683 Ga0501082_0002123
684 Ga0501082_0141510
685 Ga0501082_0775521
686 Ga0530510_0000576
687 Ga0530510_0114222
688 Ga0530510_0260755

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6727 40 136
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.6207 56 143
2i8d-assembly1.cif.gz_B crystal structure of an uncharacterized conserved protein of cog5646 (zp_00384875.1) from lactobacillus casei atcc 334 at 1.69 a resolution 0.5529 41 139
7vfm-assembly1.cif.gz_A crystal structure of sdgb (udp and sd peptide-binding form) 0.543 60 108
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.5392 40 136
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7778 41 144 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7107 41 144 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6605 40 137 3.90.1150.200
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6392 53 142 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6223 57 142 3.90.1150.30
ID Description Score Start End GO Terms
AF-T1D9R0-F1-model_v4 Protein containing DUF1801 0.9751 34 97
AF-A0A843AR32-F1-model_v4 DUF1801 domain-containing protein 0.9718 34 93
AF-A0A7W1IU15-F1-model_v4 DUF1801 domain-containing protein 0.9712 40 144
AF-A0A2U2SA50-F1-model_v4 Uncharacterized protein 0.9699 22 141
AF-G8NAC1-F1-model_v4 deleted 0.9649 32 142

Map