F416042

General Info

Members Datasets Scaffolds Average Seq Length
344 216 688 134

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0024474|Ga0373927_0024474_2835_3287
Length 150
Sequence MLLANDNQRAILEKPMKASLAQGVTATSKLTVDRERTIDFMGEKARVYATPMLVRDVEIACRELLLPHLDPGEDSVGTRIELDHLAATLMGMPVELKVTVAEVKGRAIALDVEGRDGIDSICRGRHHRFIVDVKTTEARLAAKAAKAGLA

Samples

Sample ID Description Type Environment
1 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
114 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
115 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
116 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
117 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
120 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
124 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
132 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
133 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
134 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
135 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
136 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
137 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
138 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
139 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
140 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
141 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
142 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
143 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.03
Rhizosphere 97.97
Stem 0
Stem Tuber 0
Unclassified 2.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373927_0024474 3300035695 Bacteria 3949
2 JGI24739J22299_10160018 3300001989 Bacteria 665
3 Ga0065707_10390226 3300005295 Bacteria 865
4 Ga0070676_10014409 3300005328 Bacteria 4344
5 Ga0070666_10142083 3300005335 Bacteria 1672
6 Ga0070680_100030184 3300005336 Bacteria 4355
7 Ga0070682_100562431 3300005337 Bacteria 894
8 Ga0070660_100005764 3300005339 Bacteria 8580
9 Ga0070691_10342136 3300005341 Bacteria 828
10 Ga0070661_100000852 3300005344 Bacteria 21878
11 Ga0070661_100080571 3300005344 Bacteria 2403
12 Ga0070661_100838359 3300005344 Bacteria 756
13 Ga0070669_100160175 3300005353 Bacteria 1748
14 Ga0070675_100536519 3300005354 Bacteria 1057
15 Ga0070671_100000608 3300005355 Bacteria 25561
16 Ga0070673_100038843 3300005364 Bacteria 3639
17 Ga0070659_100016021 3300005366 Bacteria 5623
18 Ga0070659_100246851 3300005366 Bacteria 1479
19 Ga0070667_100075667 3300005367 Bacteria 2874
20 Ga0070705_100263799 3300005440 Bacteria 1216
21 Ga0070694_100075254 3300005444 Bacteria 2335
22 Ga0070663_101277602 3300005455 Bacteria 647
23 Ga0070662_100003302 3300005457 Bacteria 10050
24 Ga0070681_10277486 3300005458 Bacteria 1587
25 Ga0070706_101129939 3300005467 Bacteria 721
26 Ga0070707_100201370 3300005468 Bacteria 1941
27 Ga0070698_101762277 3300005471 Bacteria 572
28 Ga0070679_100038839 3300005530 Bacteria 4733
29 Ga0070672_101585447 3300005543 Bacteria 587
30 Ga0070695_100862431 3300005545 Bacteria 729
31 Ga0070704_100599308 3300005549 Bacteria 968
32 Ga0068855_100000806 3300005563 Bacteria 38723
33 Ga0070664_100001746 3300005564 Bacteria 17401
34 Ga0070664_100232819 3300005564 Bacteria 1651
35 Ga0068857_100167568 3300005577 Bacteria 1996
36 Ga0068854_100050120 3300005578 Bacteria 2986
37 Ga0068854_100374103 3300005578 Bacteria 1172
38 Ga0068856_100000299 3300005614 Bacteria 54390
39 Ga0070702_100978324 3300005615 Bacteria 668
40 Ga0068852_100071435 3300005616 Bacteria 3048
41 Ga0068852_100541039 3300005616 Bacteria 1164
42 Ga0068859_102179351 3300005617 Bacteria 612
43 Ga0068864_100814677 3300005618 Bacteria 918
44 Ga0068862_100234760 3300005844 Bacteria 1665
45 Ga0068862_100463432 3300005844 Bacteria 1197
46 Ga0097621_100283327 3300006237 Bacteria 1459
47 Ga0075428_100057172 3300006844 Bacteria 4271
48 Ga0075428_100728221 3300006844 Bacteria 1056
49 Ga0075428_101624279 3300006844 Bacteria 675
50 Ga0075430_100119249 3300006846 Bacteria 2199
51 Ga0075430_100132599 3300006846 Bacteria 2076
52 Ga0075430_100713784 3300006846 Bacteria 826
53 Ga0075431_100320007 3300006847 Bacteria 1564
54 Ga0075431_100496907 3300006847 Bacteria 1211
55 Ga0075431_101322044 3300006847 Bacteria 681
56 Ga0075429_100023173 3300006880 Bacteria 5385
57 Ga0075429_100068250 3300006880 Bacteria 3094
58 Ga0075429_100261407 3300006880 Bacteria 1515
59 Ga0075429_100434577 3300006880 Bacteria 1150
60 Ga0075429_100645834 3300006880 Bacteria 927
61 Ga0075429_101013136 3300006880 Bacteria 726
62 Ga0075429_101212849 3300006880 Bacteria 658
63 Ga0068865_100763684 3300006881 Bacteria 831
64 Ga0097620_101984044 3300006931 Bacteria 643
65 Ga0097620_102179318 3300006931 Bacteria 612
66 Ga0111539_10246220 3300009094 Bacteria 2081
67 Ga0114129_10663240 3300009147 Bacteria 1345
68 Ga0114129_11517330 3300009147 Bacteria 823
69 Ga0105237_12056338 3300009545 Bacteria 580
70 Ga0105239_12343417 3300010375 Bacteria 621
71 Ga0157373_10032263 3300013100 Bacteria 3771
72 Ga0157373_10705149 3300013100 Bacteria 740
73 Ga0157371_10000210 3300013102 Bacteria 84791
74 Ga0157371_11063859 3300013102 Bacteria 619
75 Ga0157370_10114698 3300013104 Bacteria 2517
76 Ga0157370_10812668 3300013104 Bacteria 850
77 Ga0157369_10203369 3300013105 Bacteria 2078
78 Ga0157372_10001225 3300013307 Bacteria 27767
79 Ga0157372_10087133 3300013307 Bacteria 3542
80 Ga0157372_10657479 3300013307 Bacteria 1220
81 Ga0182008_10085585 3300014497 Bacteria 1553
82 Ga0182008_10151348 3300014497 Bacteria 1164
83 Ga0157377_10233203 3300014745 Bacteria 1185
84 Ga0207692_10059120 3300025898 Bacteria 1978
85 Ga0207688_10796417 3300025901 Bacteria 599
86 Ga0207680_10036768 3300025903 Bacteria 2822
87 Ga0207645_10019608 3300025907 Bacteria 4432
88 Ga0207684_10539511 3300025910 Bacteria 998
89 Ga0207654_10528897 3300025911 Bacteria 835
90 Ga0207707_10629179 3300025912 Bacteria 906
91 Ga0207671_11292104 3300025914 Bacteria 568
92 Ga0207660_10075617 3300025917 Bacteria 2461
93 Ga0207660_10105194 3300025917 Bacteria 2115
94 Ga0207657_10000682 3300025919 Bacteria 36172
95 Ga0207649_10006587 3300025920 Bacteria 6309
96 Ga0207649_10059890 3300025920 Bacteria 2391
97 Ga0207652_10183057 3300025921 Bacteria 1883
98 Ga0207652_10704703 3300025921 Bacteria 901
99 Ga0207646_10195777 3300025922 Bacteria 1825
100 Ga0207681_10189784 3300025923 Bacteria 1571
101 Ga0207659_10669932 3300025926 Bacteria 887
102 Ga0207644_10007148 3300025931 Bacteria 7273
103 Ga0207690_10005517 3300025932 Bacteria 7466
104 Ga0207706_10000114 3300025933 Bacteria 86582
105 Ga0207691_10922117 3300025940 Bacteria 731
106 Ga0207679_10002030 3300025945 Bacteria 12558
107 Ga0207679_10070460 3300025945 Bacteria 2635
108 Ga0207667_10001902 3300025949 Bacteria 26208
109 Ga0207651_10041286 3300025960 Bacteria 3061
110 Ga0207640_10323348 3300025981 Bacteria 1229
111 Ga0207640_10467071 3300025981 Bacteria 1044
112 Ga0207658_10036609 3300025986 Bacteria 3520
113 Ga0207639_10008071 3300026041 Bacteria 7198
114 Ga0207678_10033054 3300026067 Bacteria 4508
115 Ga0207702_10002438 3300026078 Bacteria 17627
116 Ga0207674_10084609 3300026116 Bacteria 3170
117 Ga0207674_10918484 3300026116 Bacteria 844
118 Ga0207698_10720164 3300026142 Bacteria 994
119 Ga0209969_1002728 3300027360 Bacteria 2445
120 Ga0209969_1047640 3300027360 Bacteria 671
121 Ga0209967_1001011 3300027364 Bacteria 3593
122 Ga0209981_1009087 3300027378 Bacteria 1356
123 Ga0209981_1028797 3300027378 Bacteria 811
124 Ga0209981_1079154 3300027378 Unclassified 511
125 Ga0209996_1004258 3300027395 Bacteria 1818
126 Ga0210000_1028220 3300027462 Bacteria 874
127 Ga0209995_1042575 3300027471 Bacteria 767
128 Ga0209968_1007404 3300027526 Bacteria 1661
129 Ga0209968_1111334 3300027526 Unclassified 502
130 Ga0209999_1004403 3300027543 Bacteria 2533
131 Ga0209983_1027028 3300027665 Bacteria 1215
132 Ga0209971_1062609 3300027682 Bacteria 901
133 Ga0209971_1106980 3300027682 Bacteria 686
134 Ga0209966_1048899 3300027695 Bacteria 896
135 Ga0209998_10008706 3300027717 Bacteria 2103
136 Ga0209974_10003649 3300027876 Bacteria 5526
137 Ga0268265_10145608 3300028380 Bacteria 1990
138 Ga0265330_10073802 3300031235 Bacteria 1474
139 Ga0265332_10001451 3300031238 Bacteria 13275
140 Ga0265325_10033291 3300031241 Bacteria 2748
141 Ga0265340_10213709 3300031247 Bacteria 865
142 Ga0265331_10099862 3300031250 Bacteria 1336
143 Ga0265327_10027532 3300031251 Bacteria 3269
144 Ga0307408_100974824 3300031548 Bacteria 780
145 Ga0265314_10057651 3300031711 Bacteria 2665
146 Ga0265342_10178253 3300031712 Bacteria 1165
147 Ga0307410_11282556 3300031852 Bacteria 640
148 Ga0307407_10573119 3300031903 Bacteria 837
149 Ga0307412_10874358 3300031911 Bacteria 786
150 Ga0307412_11095233 3300031911 Bacteria 709
151 Ga0307411_10074550 3300032005 Bacteria 2313
152 Ga0307411_10491162 3300032005 Bacteria 1036
153 Ga0373959_0140219 3300034820 Bacteria 605
154 Ga0373934_0072851 3300035086 Bacteria 1375
155 Ga0373941_0006011 3300035115 Bacteria 2898
156 Ga0373945_0024436 3300035116 Bacteria 2094
157 Ga0373953_0051146 3300035117 Bacteria 1670
158 Ga0373956_0250973 3300035119 Bacteria 841
159 Ga0373956_0534131 3300035119 Bacteria 560
160 Ga0373957_0063754 3300035120 Bacteria 1432
161 Ga0373960_0004303 3300035121 Bacteria 3254
162 Ga0373960_0130874 3300035121 Bacteria 841
163 Ga0373946_0292875 3300035171 Bacteria 803
164 Ga0373955_0540535 3300035172 Bacteria 713
165 Ga0373955_0730405 3300035172 Bacteria 608
166 Ga0373961_0046131 3300035241 Bacteria 1276
167 Ga0373924_0006644 3300035410 Bacteria 4150
168 Ga0373931_0007017 3300035691 Bacteria 5301
169 Ga0373935_0003281 3300035692 Bacteria 9357
170 Ga0373927_0009584 3300035695 Bacteria 6496
171 Ga0373927_0014735 3300035695 Bacteria 5169
172 Ga0373927_0016028 3300035695 Bacteria 4947
173 Ga0373933_0125249 3300035724 Bacteria 1612
174 Ga0373933_0145779 3300035724 Bacteria 1497
175 Ga0373947_0131956 3300035725 Bacteria 1595
176 Ga0373947_0169543 3300035725 Bacteria 1416
177 Ga0373937_0013678 3300036401 Bacteria 7150
178 Ga0373937_0128118 3300036401 Bacteria 2369
179 Ga0373937_1291802 3300036401 Bacteria 678
180 Ga0373937_1452314 3300036401 Bacteria 633
181 Ga0373925_0019857 3300037068 Bacteria 4888
182 Ga0439436_0178441 3300041404 Bacteria 604
183 Ga0439439_0191757 3300041406 Bacteria 592
184 Ga0439441_003070 3300042001 Bacteria 2420
185 Ga0439443_004411 3300042003 Bacteria 1830
186 Ga0439443_034914 3300042003 Unclassified 841
187 Ga0439451_014875 3300042009 Bacteria 1570
188 Ga0450914_041690 3300042118 Bacteria 584
189 Ga0450890_082188 3300042127 Bacteria 526
190 Ga0439446_0057186 3300042156 Bacteria 1173
191 Ga0439434_0036303 3300042435 Bacteria 1507
192 Ga0439435_0000520 3300042436 Bacteria 6161
193 Ga0439435_0001446 3300042436 Bacteria 4391
194 Ga0439435_0016069 3300042436 Bacteria 1871
195 Ga0439444_0002667 3300042437 Bacteria 2461
196 Ga0439444_0002669 3300042437 Bacteria 2460
197 Ga0439464_0077551 3300042439 Bacteria 989
198 Ga0439460_0161255 3300042461 Bacteria 752
199 Ga0451577_0435888 3300042876 Bacteria 1190
200 Ga0453683_0020814 3300044673 Bacteria 4190
201 Ga0453684_0117294 3300044712 Bacteria 3222
202 Ga0453684_0176709 3300044712 Bacteria 2510
203 Ga0451576_0008529 3300045051 Bacteria 12017
204 Ga0451576_0690759 3300045051 Bacteria 1072
205 Ga0495629_0308672 3300046459 Bacteria 1082
206 Ga0495629_1021077 3300046459 Unclassified 537
207 Ga0495651_0336335 3300046462 Bacteria 1002
208 Ga0495653_0153698 3300046463 Bacteria 1605
209 Ga0495580_0039875 3300046472 Bacteria 3359
210 Ga0495580_0111342 3300046472 Bacteria 1901
211 Ga0495582_0007957 3300046473 Bacteria 5858
212 Ga0495582_0141293 3300046473 Bacteria 1364
213 Ga0495639_0053005 3300046475 Bacteria 1847
214 Ga0495639_0341811 3300046475 Bacteria 750
215 Ga0495662_0017192 3300046476 Bacteria 3502
216 Ga0495594_0049641 3300046499 Bacteria 2307
217 Ga0495630_0018393 3300046517 Bacteria 5135
218 Ga0495666_0228883 3300046526 Bacteria 850
219 Ga0495665_0159864 3300046531 Bacteria 1174
220 Ga0495621_0069542 3300046539 Bacteria 1294
221 Ga0495621_0176261 3300046539 Bacteria 851
222 Ga0495635_0184510 3300046663 Bacteria 1417
223 Ga0495635_0868940 3300046663 Unclassified 578
224 Ga0495588_0173442 3300046674 Bacteria 1140
225 Ga0495657_0269781 3300046675 Bacteria 1021
226 Ga0495647_0044395 3300046681 Bacteria 1704
227 Ga0495647_0069661 3300046681 Bacteria 1405
228 Ga0495658_0004232 3300046683 Bacteria 7061
229 Ga0495658_0106288 3300046683 Bacteria 1682
230 Ga0495600_0043412 3300046809 Bacteria 2932
231 Ga0495581_0025498 3300047315 Bacteria 3428
232 Ga0495684_0005197 3300047471 Bacteria 10143
233 Ga0495684_0829613 3300047471 Bacteria 602
234 Ga0495614_0010865 3300048089 Bacteria 4010
235 Ga0496100_0049814 3300048903 Bacteria 2711
236 Ga0496101_0034232 3300048904 Bacteria 3587
237 Ga0496102_0002226 3300048905 Bacteria 16629
238 Ga0496103_0168855 3300048906 Bacteria 1404
239 Ga0496106_0000517 3300048909 Bacteria 27412
240 Ga0496107_0007777 3300048910 Bacteria 7406
241 Ga0496110_0687855 3300048913 Bacteria 924
242 Ga0501032_0009006 3300049569 Bacteria 7256
243 Ga0501033_0037541 3300049570 Bacteria 3626
244 Ga0501033_0582684 3300049570 Bacteria 768
245 Ga0501033_0734264 3300049570 Bacteria 670
246 Ga0501034_0753666 3300049571 Bacteria 869
247 Ga0501036_0019124 3300049572 Bacteria 5746
248 Ga0501037_0077848 3300049573 Bacteria 2406
249 Ga0501037_0324643 3300049573 Bacteria 1065
250 Ga0501038_0008039 3300049574 Bacteria 9712
251 Ga0501038_0459533 3300049574 Bacteria 978
252 Ga0501038_0743975 3300049574 Bacteria 732
253 Ga0501039_0008804 3300049575 Bacteria 7690
254 Ga0501039_0016472 3300049575 Bacteria 5662
255 Ga0501039_0025530 3300049575 Bacteria 4540
256 Ga0501039_0080700 3300049575 Bacteria 2532
257 Ga0501040_0000523 3300049576 Bacteria 23063
258 Ga0501040_0020821 3300049576 Bacteria 4373
259 Ga0501040_0135136 3300049576 Bacteria 1736
260 Ga0501041_0001045 3300049577 Bacteria 15147
261 Ga0501041_0029478 3300049577 Bacteria 3310
262 Ga0501041_0031186 3300049577 Bacteria 3219
263 Ga0501041_0309056 3300049577 Bacteria 996
264 Ga0501042_0001618 3300049578 Bacteria 13399
265 Ga0501043_0116352 3300049579 Bacteria 2098
266 Ga0501046_0001974 3300049580 Bacteria 19485
267 Ga0501046_0035670 3300049580 Bacteria 4007
268 Ga0501046_0446191 3300049580 Bacteria 931
269 Ga0501046_1049716 3300049580 Bacteria 564
270 Ga0501047_0649503 3300049581 Bacteria 874
271 Ga0501048_0043808 3300049582 Bacteria 3202
272 Ga0501048_0046192 3300049582 Bacteria 3109
273 Ga0501048_0058964 3300049582 Bacteria 2720
274 Ga0501048_0533688 3300049582 Bacteria 842
275 Ga0501067_0114300 3300049583 Bacteria 1501
276 Ga0501068_0028403 3300049584 Bacteria 3308
277 Ga0501068_0521042 3300049584 Bacteria 772
278 Ga0501070_0731040 3300049586 Bacteria 781
279 Ga0501071_0042323 3300049587 Bacteria 3263
280 Ga0501071_0285745 3300049587 Bacteria 1249
281 Ga0501071_0422915 3300049587 Bacteria 1018
282 Ga0501071_1018357 3300049587 Bacteria 640
283 Ga0501071_1272163 3300049587 Bacteria 568
284 Ga0501072_0000905 3300049588 Bacteria 21770
285 Ga0501072_0003777 3300049588 Bacteria 11437
286 Ga0501072_0371003 3300049588 Bacteria 1136
287 Ga0501073_0496831 3300049589 Bacteria 844
288 Ga0501074_0010988 3300049590 Bacteria 6572
289 Ga0501074_0317862 3300049590 Bacteria 1106
290 Ga0501075_0001963 3300049591 Bacteria 13565
291 Ga0501075_0005930 3300049591 Bacteria 8358
292 Ga0501075_0121565 3300049591 Bacteria 1987
293 Ga0501075_0188077 3300049591 Bacteria 1575
294 Ga0501076_0000158 3300049592 Bacteria 39218
295 Ga0501076_0018455 3300049592 Bacteria 5318
296 Ga0501077_0001403 3300049593 Bacteria 14493
297 Ga0501077_0379812 3300049593 Bacteria 902
298 Ga0501077_0750661 3300049593 Bacteria 627
299 Ga0501079_0000215 3300049741 Bacteria 34021
300 Ga0501079_0044903 3300049741 Bacteria 3410
301 Ga0501079_0127428 3300049741 Bacteria 1980
302 Ga0501080_0002024 3300049742 Bacteria 17523
303 Ga0501080_0013195 3300049742 Bacteria 7590
304 Ga0501080_0390055 3300049742 Bacteria 1254
305 Ga0501080_0506265 3300049742 Bacteria 1079
306 Ga0501080_1777660 3300049742 Bacteria 518
307 Ga0501081_0000103 3300049743 Bacteria 35665
308 Ga0501081_0004338 3300049743 Bacteria 9097
309 Ga0501081_0065912 3300049743 Bacteria 2518
310 Ga0501083_0484295 3300049744 Bacteria 805
311 Ga0501280_086821 3300049776 Unclassified 584
312 Ga0501035_0034703 3300049822 Bacteria 4582
313 Ga0501035_0173755 3300049822 Bacteria 1860
314 Ga0501035_0763472 3300049822 Bacteria 775
315 Ga0501044_1288913 3300049823 Unclassified 597
316 Ga0501044_1537937 3300049823 Unclassified 530
317 Ga0501045_0001445 3300049824 Bacteria 15787
318 Ga0501045_0073731 3300049824 Bacteria 2514
319 Ga0501045_0207950 3300049824 Bacteria 1458
320 nmdc:mga05p37_529867_c1 3300050507 Bacteria 1345
321 nmdc:mga05p37_720957_c1 3300050507 Bacteria 1104
322 nmdc:mga09592_2691_c1 3300050508 Bacteria 14375
323 nmdc:mga09592_279862_c1 3300050508 Bacteria 1447
324 nmdc:mga09592_36775_c1 3300050508 Bacteria 4103
325 nmdc:mga09592_608635_c1 3300050508 Bacteria 936
326 nmdc:mga09592_770173_c1 3300050508 Bacteria 816
327 nmdc:mga0qj67_162355_c1 3300050509 Bacteria 1814
328 nmdc:mga0qj67_198427_c1 3300050509 Bacteria 1631
329 nmdc:mga0qj67_255538_c1 3300050509 Bacteria 1422
330 nmdc:mga0qj67_822396_c1 3300050509 Bacteria 735
331 nmdc:mga06r32_259972_c1 3300050510 Bacteria 1724
332 nmdc:mga06r32_388228_c1 3300050510 Bacteria 1379
333 nmdc:mga08y16_315283_c1 3300050511 Bacteria 1610
334 Ga0495619_0065434 3300053085 Bacteria 2425
335 Ga0495619_0524966 3300053085 Bacteria 813
336 Ga0501084_0031006 3300054114 Bacteria 4471
337 Ga0501084_0074638 3300054114 Bacteria 2840
338 Ga0501082_0012690 3300060353 Bacteria 7241
339 Ga0501082_0415639 3300060353 Bacteria 1174
340 Ga0501082_1331993 3300060353 Bacteria 627
341 Ga0530510_0000070 3300061734 Bacteria 51724
342 Ga0530510_0000325 3300061734 Bacteria 30731
343 Ga0530510_0410773 3300061734 Bacteria 1021
344 Ga0530510_0414530 3300061734 Bacteria 1016
345 Ga0373927_0024474
346 JGI24739J22299_10160018
347 Ga0065707_10390226
348 Ga0070676_10014409
349 Ga0070666_10142083
350 Ga0070680_100030184
351 Ga0070682_100562431
352 Ga0070660_100005764
353 Ga0070691_10342136
354 Ga0070661_100000852
355 Ga0070661_100080571
356 Ga0070661_100838359
357 Ga0070669_100160175
358 Ga0070675_100536519
359 Ga0070671_100000608
360 Ga0070673_100038843
361 Ga0070659_100016021
362 Ga0070659_100246851
363 Ga0070667_100075667
364 Ga0070705_100263799
365 Ga0070694_100075254
366 Ga0070663_101277602
367 Ga0070662_100003302
368 Ga0070681_10277486
369 Ga0070706_101129939
370 Ga0070707_100201370
371 Ga0070698_101762277
372 Ga0070679_100038839
373 Ga0070672_101585447
374 Ga0070695_100862431
375 Ga0070704_100599308
376 Ga0068855_100000806
377 Ga0070664_100001746
378 Ga0070664_100232819
379 Ga0068857_100167568
380 Ga0068854_100050120
381 Ga0068854_100374103
382 Ga0068856_100000299
383 Ga0070702_100978324
384 Ga0068852_100071435
385 Ga0068852_100541039
386 Ga0068859_102179351
387 Ga0068864_100814677
388 Ga0068862_100234760
389 Ga0068862_100463432
390 Ga0097621_100283327
391 Ga0075428_100057172
392 Ga0075428_100728221
393 Ga0075428_101624279
394 Ga0075430_100119249
395 Ga0075430_100132599
396 Ga0075430_100713784
397 Ga0075431_100320007
398 Ga0075431_100496907
399 Ga0075431_101322044
400 Ga0075429_100023173
401 Ga0075429_100068250
402 Ga0075429_100261407
403 Ga0075429_100434577
404 Ga0075429_100645834
405 Ga0075429_101013136
406 Ga0075429_101212849
407 Ga0068865_100763684
408 Ga0097620_101984044
409 Ga0097620_102179318
410 Ga0111539_10246220
411 Ga0114129_10663240
412 Ga0114129_11517330
413 Ga0105237_12056338
414 Ga0105239_12343417
415 Ga0157373_10032263
416 Ga0157373_10705149
417 Ga0157371_10000210
418 Ga0157371_11063859
419 Ga0157370_10114698
420 Ga0157370_10812668
421 Ga0157369_10203369
422 Ga0157372_10001225
423 Ga0157372_10087133
424 Ga0157372_10657479
425 Ga0182008_10085585
426 Ga0182008_10151348
427 Ga0157377_10233203
428 Ga0207692_10059120
429 Ga0207688_10796417
430 Ga0207680_10036768
431 Ga0207645_10019608
432 Ga0207684_10539511
433 Ga0207654_10528897
434 Ga0207707_10629179
435 Ga0207671_11292104
436 Ga0207660_10075617
437 Ga0207660_10105194
438 Ga0207657_10000682
439 Ga0207649_10006587
440 Ga0207649_10059890
441 Ga0207652_10183057
442 Ga0207652_10704703
443 Ga0207646_10195777
444 Ga0207681_10189784
445 Ga0207659_10669932
446 Ga0207644_10007148
447 Ga0207690_10005517
448 Ga0207706_10000114
449 Ga0207691_10922117
450 Ga0207679_10002030
451 Ga0207679_10070460
452 Ga0207667_10001902
453 Ga0207651_10041286
454 Ga0207640_10323348
455 Ga0207640_10467071
456 Ga0207658_10036609
457 Ga0207639_10008071
458 Ga0207678_10033054
459 Ga0207702_10002438
460 Ga0207674_10084609
461 Ga0207674_10918484
462 Ga0207698_10720164
463 Ga0209969_1002728
464 Ga0209969_1047640
465 Ga0209967_1001011
466 Ga0209981_1009087
467 Ga0209981_1028797
468 Ga0209981_1079154
469 Ga0209996_1004258
470 Ga0210000_1028220
471 Ga0209995_1042575
472 Ga0209968_1007404
473 Ga0209968_1111334
474 Ga0209999_1004403
475 Ga0209983_1027028
476 Ga0209971_1062609
477 Ga0209971_1106980
478 Ga0209966_1048899
479 Ga0209998_10008706
480 Ga0209974_10003649
481 Ga0268265_10145608
482 Ga0265330_10073802
483 Ga0265332_10001451
484 Ga0265325_10033291
485 Ga0265340_10213709
486 Ga0265331_10099862
487 Ga0265327_10027532
488 Ga0307408_100974824
489 Ga0265314_10057651
490 Ga0265342_10178253
491 Ga0307410_11282556
492 Ga0307407_10573119
493 Ga0307412_10874358
494 Ga0307412_11095233
495 Ga0307411_10074550
496 Ga0307411_10491162
497 Ga0373959_0140219
498 Ga0373934_0072851
499 Ga0373941_0006011
500 Ga0373945_0024436
501 Ga0373953_0051146
502 Ga0373956_0250973
503 Ga0373956_0534131
504 Ga0373957_0063754
505 Ga0373960_0004303
506 Ga0373960_0130874
507 Ga0373946_0292875
508 Ga0373955_0540535
509 Ga0373955_0730405
510 Ga0373961_0046131
511 Ga0373924_0006644
512 Ga0373931_0007017
513 Ga0373935_0003281
514 Ga0373927_0009584
515 Ga0373927_0014735
516 Ga0373927_0016028
517 Ga0373933_0125249
518 Ga0373933_0145779
519 Ga0373947_0131956
520 Ga0373947_0169543
521 Ga0373937_0013678
522 Ga0373937_0128118
523 Ga0373937_1291802
524 Ga0373937_1452314
525 Ga0373925_0019857
526 Ga0439436_0178441
527 Ga0439439_0191757
528 Ga0439441_003070
529 Ga0439443_004411
530 Ga0439443_034914
531 Ga0439451_014875
532 Ga0450914_041690
533 Ga0450890_082188
534 Ga0439446_0057186
535 Ga0439434_0036303
536 Ga0439435_0000520
537 Ga0439435_0001446
538 Ga0439435_0016069
539 Ga0439444_0002667
540 Ga0439444_0002669
541 Ga0439464_0077551
542 Ga0439460_0161255
543 Ga0451577_0435888
544 Ga0453683_0020814
545 Ga0453684_0117294
546 Ga0453684_0176709
547 Ga0451576_0008529
548 Ga0451576_0690759
549 Ga0495629_0308672
550 Ga0495629_1021077
551 Ga0495651_0336335
552 Ga0495653_0153698
553 Ga0495580_0039875
554 Ga0495580_0111342
555 Ga0495582_0007957
556 Ga0495582_0141293
557 Ga0495639_0053005
558 Ga0495639_0341811
559 Ga0495662_0017192
560 Ga0495594_0049641
561 Ga0495630_0018393
562 Ga0495666_0228883
563 Ga0495665_0159864
564 Ga0495621_0069542
565 Ga0495621_0176261
566 Ga0495635_0184510
567 Ga0495635_0868940
568 Ga0495588_0173442
569 Ga0495657_0269781
570 Ga0495647_0044395
571 Ga0495647_0069661
572 Ga0495658_0004232
573 Ga0495658_0106288
574 Ga0495600_0043412
575 Ga0495581_0025498
576 Ga0495684_0005197
577 Ga0495684_0829613
578 Ga0495614_0010865
579 Ga0496100_0049814
580 Ga0496101_0034232
581 Ga0496102_0002226
582 Ga0496103_0168855
583 Ga0496106_0000517
584 Ga0496107_0007777
585 Ga0496110_0687855
586 Ga0501032_0009006
587 Ga0501033_0037541
588 Ga0501033_0582684
589 Ga0501033_0734264
590 Ga0501034_0753666
591 Ga0501036_0019124
592 Ga0501037_0077848
593 Ga0501037_0324643
594 Ga0501038_0008039
595 Ga0501038_0459533
596 Ga0501038_0743975
597 Ga0501039_0008804
598 Ga0501039_0016472
599 Ga0501039_0025530
600 Ga0501039_0080700
601 Ga0501040_0000523
602 Ga0501040_0020821
603 Ga0501040_0135136
604 Ga0501041_0001045
605 Ga0501041_0029478
606 Ga0501041_0031186
607 Ga0501041_0309056
608 Ga0501042_0001618
609 Ga0501043_0116352
610 Ga0501046_0001974
611 Ga0501046_0035670
612 Ga0501046_0446191
613 Ga0501046_1049716
614 Ga0501047_0649503
615 Ga0501048_0043808
616 Ga0501048_0046192
617 Ga0501048_0058964
618 Ga0501048_0533688
619 Ga0501067_0114300
620 Ga0501068_0028403
621 Ga0501068_0521042
622 Ga0501070_0731040
623 Ga0501071_0042323
624 Ga0501071_0285745
625 Ga0501071_0422915
626 Ga0501071_1018357
627 Ga0501071_1272163
628 Ga0501072_0000905
629 Ga0501072_0003777
630 Ga0501072_0371003
631 Ga0501073_0496831
632 Ga0501074_0010988
633 Ga0501074_0317862
634 Ga0501075_0001963
635 Ga0501075_0005930
636 Ga0501075_0121565
637 Ga0501075_0188077
638 Ga0501076_0000158
639 Ga0501076_0018455
640 Ga0501077_0001403
641 Ga0501077_0379812
642 Ga0501077_0750661
643 Ga0501079_0000215
644 Ga0501079_0044903
645 Ga0501079_0127428
646 Ga0501080_0002024
647 Ga0501080_0013195
648 Ga0501080_0390055
649 Ga0501080_0506265
650 Ga0501080_1777660
651 Ga0501081_0000103
652 Ga0501081_0004338
653 Ga0501081_0065912
654 Ga0501083_0484295
655 Ga0501280_086821
656 Ga0501035_0034703
657 Ga0501035_0173755
658 Ga0501035_0763472
659 Ga0501044_1288913
660 Ga0501044_1537937
661 Ga0501045_0001445
662 Ga0501045_0073731
663 Ga0501045_0207950
664 nmdc:mga05p37_529867_c1
665 nmdc:mga05p37_720957_c1
666 nmdc:mga09592_2691_c1
667 nmdc:mga09592_279862_c1
668 nmdc:mga09592_36775_c1
669 nmdc:mga09592_608635_c1
670 nmdc:mga09592_770173_c1
671 nmdc:mga0qj67_162355_c1
672 nmdc:mga0qj67_198427_c1
673 nmdc:mga0qj67_255538_c1
674 nmdc:mga0qj67_822396_c1
675 nmdc:mga06r32_259972_c1
676 nmdc:mga06r32_388228_c1
677 nmdc:mga08y16_315283_c1
678 Ga0495619_0065434
679 Ga0495619_0524966
680 Ga0501084_0031006
681 Ga0501084_0074638
682 Ga0501082_0012690
683 Ga0501082_0415639
684 Ga0501082_1331993
685 Ga0530510_0000070
686 Ga0530510_0000325
687 Ga0530510_0410773
688 Ga0530510_0414530

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22636

FlK

Fluoroacetyl-CoA-specific thioesterase

32

134

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kvu-assembly1.cif.gz_A structural basis of the activity and substrate specificity of the fluoroacetyl-coa flk - t42s mutant in complex with acetyl-coa 0.9206 5 128
3kx8-assembly1.cif.gz_B structural basis of the activity and substrate specificity of the fluoroacetyl-coa thioesterase flk 0.9127 3 128
3gek-assembly1.cif.gz_B crystal structure of putative thioesterase yhda from lactococcus lactis. northeast structural genomics consortium target kr113 0.9119 10 117
2q78-assembly1.cif.gz_B crystal structure of a thioesterase-like protein (tm0581) from thermotoga maritima msb8 at 2.20 a resolution 0.9118 1 126
3gek-assembly2.cif.gz_A crystal structure of putative thioesterase yhda from lactococcus lactis. northeast structural genomics consortium target kr113 0.909 10 116
ID Description Score Start End Superfamily
af_Q2FXM2_325_429_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9146 14 116 3.10.129.10
af_Q54KW1_1_129_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9095 5 128 3.10.129.10
3p3iA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.905 2 128 3.10.129.10
3gekA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9021 10 116 3.10.129.10
2q78A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9005 7 126 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2E0H7E6-F1-model_v4 LysR family transcriptional regulator 0.9865 1 133
AF-A0A2V7K8Y6-F1-model_v4 LysR family transcriptional regulator 0.983 32 134
AF-A0A523DZN1-F1-model_v4 LysR family transcriptional regulator 0.9825 1 117
AF-A0A2S6TIU6-F1-model_v4 Fluoroacetyl-CoA thioesterase (EC 3.1.2.29) 0.9814 1 132 GO:0016787
AF-A0A4P7GLX4-F1-model_v4 Fluoroacetyl-CoA-specific thioesterase-like domain-containing protein 0.9809 4 128

Map