F416014

General Info

Members Datasets Scaffolds Average Seq Length
344 195 688 256

Family's Representative Sequence

Representative Sequence 3300031235|Ga0265330_10129218|Ga0265330_101292182
Length 266
Sequence MTSWADAIYLVLDSASLFVAIVVGANIGSFLNVCIYRLPLKKSIVWPSSRCPHCNRRLRWFENVPIAGYLWLRGRCRTCRGPISIQYPIVETLTAVMFGLAFWYYGPTLLLLSRLLFGCALIVLFSIDLEHHLLPNSITLPGIVVGFAFSLVTGLGWFDSLVGIVLGGGVLFATAEAYYRVRHEEGLGMGDVKMLAMVGAFLGWKLALLTLMLASISGSIIGLLFIVTKRGDMKYALPFGTFLAIGAAAAASIGPGLVSWYLGLLQ

Samples

Sample ID Description Type Environment
1 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
132 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
133 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
134 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
135 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
136 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
145 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
146 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 0
Rhizoplane 2.62
Rhizosphere 96.51
Stem 0
Stem Tuber 0
Unclassified 22.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265330_10129218 3300031235 Bacteria 1076
2 Ga0065712_10125027 3300005290 Bacteria 1619
3 Ga0065715_10013667 3300005293 Bacteria 2061
4 Ga0065715_10335904 3300005293 Archaea 975
5 Ga0065707_10007386 3300005295 Unclassified 3200
6 Ga0070658_10082696 3300005327 Bacteria 2639
7 Ga0070658_10323460 3300005327 Bacteria 1317
8 Ga0070683_100283546 3300005329 Bacteria 1576
9 Ga0070690_100002010 3300005330 Bacteria 10839
10 Ga0070670_100480062 3300005331 Bacteria 1104
11 Ga0068869_100342964 3300005334 Bacteria 1216
12 Ga0070666_10007785 3300005335 Bacteria 6617
13 Ga0070660_100045271 3300005339 Unclassified 3367
14 Ga0070661_100454577 3300005344 Bacteria 1019
15 Ga0070669_100014168 3300005353 Bacteria 5674
16 Ga0070669_100036950 3300005353 Bacteria 3541
17 Ga0070675_100062330 3300005354 Unclassified 3081
18 Ga0070675_100164209 3300005354 Bacteria 1912
19 Ga0070671_100020488 3300005355 Bacteria 5394
20 Ga0070674_100003403 3300005356 Bacteria 8918
21 Ga0070674_100025052 3300005356 Bacteria 3878
22 Ga0070673_100655656 3300005364 Bacteria 961
23 Ga0070688_100188265 3300005365 Bacteria 1436
24 Ga0070659_100145162 3300005366 Bacteria 1933
25 Ga0070713_100383312 3300005436 Unclassified 1310
26 Ga0070700_100045209 3300005441 Unclassified 2716
27 Ga0070694_100005891 3300005444 Bacteria 7436
28 Ga0070694_100059127 3300005444 Bacteria 2609
29 Ga0070708_100011057 3300005445 Bacteria 7333
30 Ga0070708_100272552 3300005445 Unclassified 1592
31 Ga0070678_100116355 3300005456 Bacteria 2101
32 Ga0070662_100112147 3300005457 Bacteria 2079
33 Ga0070662_100232465 3300005457 Bacteria 1475
34 Ga0070681_10002820 3300005458 Bacteria 16042
35 Ga0070681_10163281 3300005458 Unclassified 2151
36 Ga0070681_10199803 3300005458 Bacteria 1918
37 Ga0070707_100068810 3300005468 Bacteria 3408
38 Ga0070707_100194040 3300005468 Bacteria 1980
39 Ga0070698_100104102 3300005471 Unclassified 2808
40 Ga0070698_100260820 3300005471 Bacteria 1665
41 Ga0070699_100004012 3300005518 Bacteria 13013
42 Ga0070699_100109513 3300005518 Unclassified 2424
43 Ga0070679_100247116 3300005530 Bacteria 1741
44 Ga0070679_100423902 3300005530 Unclassified 1276
45 Ga0070684_100237675 3300005535 Bacteria 1664
46 Ga0070697_100263782 3300005536 Bacteria 1475
47 Ga0070672_100505251 3300005543 Bacteria 1046
48 Ga0070686_100001418 3300005544 Bacteria 13534
49 Ga0070686_100087016 3300005544 Bacteria 2082
50 Ga0070686_100144450 3300005544 Bacteria 1660
51 Ga0070695_100025499 3300005545 Bacteria 3651
52 Ga0070696_100076151 3300005546 Unclassified 2368
53 Ga0070696_100359100 3300005546 Bacteria 1130
54 Ga0070696_100597993 3300005546 Bacteria 889
55 Ga0070665_100118310 3300005548 Bacteria 2652
56 Ga0070704_100249841 3300005549 Bacteria 1456
57 Ga0068855_100153295 3300005563 Bacteria 2619
58 Ga0068855_100159195 3300005563 Unclassified 2564
59 Ga0070664_100044170 3300005564 Bacteria 3763
60 Ga0070664_100264748 3300005564 Bacteria 1547
61 Ga0068857_100053832 3300005577 Unclassified 3570
62 Ga0068854_100014410 3300005578 Bacteria 5212
63 Ga0068856_100072210 3300005614 Bacteria 3417
64 Ga0068859_100128358 3300005617 Bacteria 2606
65 Ga0068859_100208939 3300005617 Unclassified 2038
66 Ga0068859_100268452 3300005617 Unclassified 1798
67 Ga0068864_100038242 3300005618 Unclassified 4097
68 Ga0068864_100103493 3300005618 Unclassified 2528
69 Ga0068866_10009319 3300005718 Bacteria 4164
70 Ga0068861_100008906 3300005719 Bacteria 6919
71 Ga0068861_100089094 3300005719 Bacteria 2432
72 Ga0068861_100090573 3300005719 Bacteria 2413
73 Ga0068861_100181764 3300005719 Unclassified 1751
74 Ga0068861_100377930 3300005719 Unclassified 1251
75 Ga0068863_100021919 3300005841 Bacteria 6096
76 Ga0068863_100282723 3300005841 Bacteria 1608
77 Ga0068858_100084818 3300005842 Bacteria 2946
78 Ga0068858_100443370 3300005842 Unclassified 1250
79 Ga0068860_100529518 3300005843 Bacteria 1179
80 Ga0068862_100018900 3300005844 Bacteria 5742
81 Ga0068862_100029263 3300005844 Unclassified 4640
82 Ga0068862_100063498 3300005844 Unclassified 3177
83 Ga0068862_100288592 3300005844 Bacteria 1506
84 Ga0081455_10118019 3300005937 Bacteria 2096
85 Ga0081539_10000215 3300005985 Bacteria 135054
86 Ga0075368_10016223 3300006042 Bacteria 2775
87 Ga0075367_10049206 3300006178 Bacteria 2484
88 Ga0097621_100281241 3300006237 Bacteria 1464
89 Ga0068871_100145591 3300006358 Bacteria 2017
90 Ga0075428_100001308 3300006844 Bacteria 26398
91 Ga0075428_100008514 3300006844 Bacteria 11380
92 Ga0075428_100068984 3300006844 Unclassified 3867
93 Ga0075430_100009170 3300006846 Bacteria 8362
94 Ga0075430_100009252 3300006846 Bacteria 8329
95 Ga0075430_100019049 3300006846 Bacteria 5839
96 Ga0075431_100020798 3300006847 Bacteria 6706
97 Ga0075431_100029272 3300006847 Bacteria 5667
98 Ga0075433_10051046 3300006852 Bacteria 3601
99 Ga0075433_10108851 3300006852 Bacteria 2458
100 Ga0075433_10190334 3300006852 Bacteria 1825
101 Ga0075434_100001728 3300006871 Bacteria 18751
102 Ga0075434_100008158 3300006871 Bacteria 9714
103 Ga0075434_100221697 3300006871 Bacteria 1911
104 Ga0075434_100457787 3300006871 Bacteria 1297
105 Ga0075429_100085355 3300006880 Unclassified 2752
106 Ga0075436_100000389 3300006914 Bacteria 28152
107 Ga0075436_100023521 3300006914 Bacteria 4232
108 Ga0075436_100096358 3300006914 Unclassified 2058
109 Ga0097620_100128360 3300006931 Bacteria 2606
110 Ga0097620_100208945 3300006931 Unclassified 2038
111 Ga0097620_100268476 3300006931 Unclassified 1798
112 Ga0075435_100000502 3300007076 Bacteria 23850
113 Ga0075435_100013707 3300007076 Bacteria 6040
114 Ga0105240_10005359 3300009093 Bacteria 19137
115 Ga0105240_10065595 3300009093 Bacteria 4506
116 Ga0111539_10003862 3300009094 Bacteria 19725
117 Ga0111539_10008469 3300009094 Bacteria 13075
118 Ga0111539_10053693 3300009094 Bacteria 4797
119 Ga0111539_10115102 3300009094 Bacteria 3154
120 Ga0111539_10580030 3300009094 Bacteria 1306
121 Ga0105245_10071836 3300009098 Bacteria 3143
122 Ga0114129_10002888 3300009147 Bacteria 24050
123 Ga0114129_10004539 3300009147 Bacteria 19600
124 Ga0114129_10006925 3300009147 Bacteria 16126
125 Ga0114129_10017889 3300009147 Bacteria 10089
126 Ga0114129_10039935 3300009147 Bacteria 6620
127 Ga0114129_10040776 3300009147 Bacteria 6544
128 Ga0114129_10045558 3300009147 Bacteria 6165
129 Ga0114129_10063004 3300009147 Bacteria 5180
130 Ga0114129_10112236 3300009147 Bacteria 3759
131 Ga0114129_10566204 3300009147 Unclassified 1476
132 Ga0114129_10664043 3300009147 Unclassified 1344
133 Ga0105243_10100308 3300009148 Unclassified 2402
134 Ga0105243_10318418 3300009148 Bacteria 1416
135 Ga0105241_10204483 3300009174 Unclassified 1651
136 Ga0105242_10207338 3300009176 Bacteria 1744
137 Ga0105242_10310126 3300009176 Bacteria 1443
138 Ga0105248_10031407 3300009177 Bacteria 5937
139 Ga0105248_10063657 3300009177 Bacteria 4140
140 Ga0105248_10169034 3300009177 Archaea 2464
141 Ga0105248_10318810 3300009177 Bacteria 1751
142 Ga0105248_10388655 3300009177 Bacteria 1571
143 Ga0105248_10646165 3300009177 Unclassified 1194
144 Ga0105238_10921384 3300009551 Bacteria 893
145 Ga0105249_10000685 3300009553 Bacteria 30822
146 Ga0105249_10233917 3300009553 Bacteria 1813
147 Ga0105249_10234839 3300009553 Unclassified 1810
148 Ga0105239_11000573 3300010375 Bacteria 961
149 Ga0105246_10038015 3300011119 Bacteria 3233
150 Ga0105246_10289723 3300011119 Bacteria 1317
151 Ga0163162_10069376 3300013306 Bacteria 3576
152 Ga0163162_10378292 3300013306 Bacteria 1549
153 Ga0157375_10048994 3300013308 Bacteria 4137
154 Ga0163163_10193825 3300014325 Bacteria 2080
155 Ga0163163_10258371 3300014325 Bacteria 1793
156 Ga0163163_10804133 3300014325 Unclassified 1004
157 Ga0157380_10121915 3300014326 Bacteria 2210
158 Ga0157380_10371236 3300014326 Bacteria 1346
159 Ga0157379_10008461 3300014968 Bacteria 8948
160 Ga0157379_10348220 3300014968 Bacteria 1356
161 Ga0157379_10509361 3300014968 Bacteria 1116
162 Ga0207697_10003446 3300025315 Bacteria 7818
163 Ga0207697_10071256 3300025315 Bacteria 1456
164 Ga0207656_10069239 3300025321 Bacteria 1565
165 Ga0207642_10092633 3300025899 Bacteria 1497
166 Ga0207688_10006844 3300025901 Bacteria 6202
167 Ga0207680_10280232 3300025903 Bacteria 1158
168 Ga0207643_10074909 3300025908 Bacteria 1953
169 Ga0207705_10051151 3300025909 Bacteria 2974
170 Ga0207654_10137672 3300025911 Unclassified 1553
171 Ga0207707_10133025 3300025912 Bacteria 2175
172 Ga0207707_10229856 3300025912 Bacteria 1614
173 Ga0207707_10332003 3300025912 Unclassified 1312
174 Ga0207695_10252189 3300025913 Bacteria 1664
175 Ga0207662_10006771 3300025918 Bacteria 6200
176 Ga0207657_10005894 3300025919 Bacteria 12758
177 Ga0207657_10409280 3300025919 Bacteria 1066
178 Ga0207652_10346599 3300025921 Unclassified 1341
179 Ga0207646_10172486 3300025922 Bacteria 1953
180 Ga0207681_10015414 3300025923 Unclassified 4765
181 Ga0207681_10029731 3300025923 Unclassified 3554
182 Ga0207681_10563876 3300025923 Bacteria 938
183 Ga0207659_10363335 3300025926 Unclassified 1204
184 Ga0207659_10426747 3300025926 Unclassified 1113
185 Ga0207687_10159151 3300025927 Bacteria 1731
186 Ga0207664_10140757 3300025929 Unclassified 2040
187 Ga0207690_10148219 3300025932 Bacteria 1737
188 Ga0207690_10212773 3300025932 Bacteria 1475
189 Ga0207706_10094823 3300025933 Bacteria 2625
190 Ga0207706_10234708 3300025933 Unclassified 1604
191 Ga0207706_10503317 3300025933 Bacteria 1046
192 Ga0207670_10221570 3300025936 Bacteria 1448
193 Ga0207670_10231674 3300025936 Unclassified 1419
194 Ga0207669_10019994 3300025937 Bacteria 3500
195 Ga0207669_10231946 3300025937 Bacteria 1362
196 Ga0207691_10102441 3300025940 Unclassified 2553
197 Ga0207691_10285114 3300025940 Unclassified 1421
198 Ga0207691_10537803 3300025940 Bacteria 991
199 Ga0207711_10037947 3300025941 Bacteria 4096
200 Ga0207711_10079328 3300025941 Archaea 2865
201 Ga0207711_10085923 3300025941 Bacteria 2757
202 Ga0207711_10146301 3300025941 Unclassified 2129
203 Ga0207711_10246423 3300025941 Bacteria 1639
204 Ga0207689_10450357 3300025942 Unclassified 1076
205 Ga0207679_10193864 3300025945 Bacteria 1692
206 Ga0207667_10176031 3300025949 Unclassified 2198
207 Ga0207667_10179188 3300025949 Bacteria 2177
208 Ga0207651_10060669 3300025960 Unclassified 2627
209 Ga0207651_10584098 3300025960 Bacteria 975
210 Ga0207712_10029901 3300025961 Unclassified 3659
211 Ga0207712_10192585 3300025961 Bacteria 1610
212 Ga0207668_10245524 3300025972 Unclassified 1451
213 Ga0207658_10227124 3300025986 Bacteria 1574
214 Ga0207703_10068250 3300026035 Unclassified 2929
215 Ga0207708_10048460 3300026075 Bacteria 3234
216 Ga0207641_10012330 3300026088 Bacteria 7012
217 Ga0207641_10167081 3300026088 Bacteria 2005
218 Ga0207648_10130741 3300026089 Bacteria 2210
219 Ga0207676_10049425 3300026095 Unclassified 3272
220 Ga0207676_10127055 3300026095 Unclassified 2161
221 Ga0207674_10060249 3300026116 Bacteria 3839
222 Ga0207675_100035804 3300026118 Unclassified 4630
223 Ga0207675_100126490 3300026118 Bacteria 2421
224 Ga0207683_10118690 3300026121 Bacteria 2373
225 Ga0207683_10611101 3300026121 Bacteria 1009
226 Ga0207428_10009679 3300027907 Bacteria 8635
227 Ga0207428_10013205 3300027907 Bacteria 7229
228 Ga0207428_10059929 3300027907 Bacteria 3015
229 Ga0207428_10107351 3300027907 Unclassified 2151
230 Ga0268266_10672476 3300028379 Bacteria 997
231 Ga0268265_10047840 3300028380 Unclassified 3207
232 Ga0268265_10104989 3300028380 Unclassified 2291
233 Ga0307408_100070768 3300031548 Bacteria 2577
234 Ga0316576_10226841 3300031727 Bacteria 1405
235 Ga0307416_100008835 3300032002 Bacteria 6537
236 Ga0307414_10414755 3300032004 Bacteria 1173
237 Ga0307411_10167591 3300032005 Unclassified 1653
238 Ga0307411_10215369 3300032005 Unclassified 1486
239 Ga0373950_0001835 3300034818 Unclassified 2843
240 Ga0373958_0004798 3300034819 Bacteria 2019
241 Ga0373959_0007796 3300034820 Unclassified 1807
242 Ga0373938_0001687 3300034957 Unclassified 3536
243 Ga0373928_0002608 3300035084 Unclassified 3492
244 Ga0373951_0000106 3300035091 Bacteria 32539
245 Ga0373939_0007141 3300035114 Unclassified 2708
246 Ga0373955_0022498 3300035172 Bacteria 3199
247 Ga0373942_0000867 3300035207 Bacteria 8282
248 Ga0373961_0002021 3300035241 Bacteria 5430
249 Ga0373962_0000938 3300035242 Bacteria 6713
250 Ga0373931_0065700 3300035691 Unclassified 1966
251 Ga0373931_0089688 3300035691 Bacteria 1711
252 Ga0373937_0242236 3300036401 Bacteria 1699
253 Ga0450917_002801 3300042120 Unclassified 1253
254 Ga0439435_0002973 3300042436 Unclassified 3453
255 Ga0439464_0024595 3300042439 Bacteria 1666
256 Ga0451577_0334694 3300042876 Unclassified 1373
257 Ga0453684_0640917 3300044712 Unclassified 1160
258 Ga0451576_0014484 3300045051 Bacteria 8773
259 Ga0451576_0194578 3300045051 Bacteria 2118
260 Ga0466967_0568314 3300045976 Bacteria 1117
261 Ga0495587_0248845 3300046536 Bacteria 999
262 Ga0495645_0005414 3300046543 Bacteria 8756
263 Ga0495659_0048993 3300046664 Bacteria 1533
264 Ga0495674_0059450 3300047319 Bacteria 3338
265 Ga0495680_0283889 3300047322 Bacteria 1166
266 Ga0496102_0156199 3300048905 Bacteria 2144
267 Ga0496106_0064242 3300048909 Bacteria 2792
268 Ga0496106_0216178 3300048909 Bacteria 1528
269 Ga0496107_0144467 3300048910 Bacteria 1759
270 Ga0496108_0115499 3300048911 Bacteria 2299
271 Ga0496108_0318053 3300048911 Bacteria 1357
272 Ga0496109_0618388 3300048912 Unclassified 1020
273 Ga0496110_0213213 3300048913 Bacteria 1756
274 Ga0496112_0282364 3300048915 Bacteria 1607
275 Ga0501034_0099620 3300049571 Bacteria 2900
276 Ga0501039_0060805 3300049575 Unclassified 2925
277 Ga0501040_0025584 3300049576 Unclassified 3969
278 Ga0501042_0021125 3300049578 Bacteria 4533
279 Ga0501047_0099853 3300049581 Bacteria 2781
280 Ga0501047_0216571 3300049581 Bacteria 1772
281 Ga0501048_0007476 3300049582 Bacteria 8279
282 Ga0501048_0082228 3300049582 Bacteria 2272
283 Ga0501067_0296238 3300049583 Bacteria 901
284 Ga0501071_0008311 3300049587 Bacteria 6855
285 Ga0501071_0295812 3300049587 Bacteria 1227
286 Ga0501072_0014922 3300049588 Bacteria 5954
287 Ga0501072_0152727 3300049588 Bacteria 1841
288 Ga0501074_0073298 3300049590 Bacteria 2460
289 Ga0501075_0007929 3300049591 Bacteria 7377
290 Ga0501075_0108524 3300049591 Bacteria 2110
291 Ga0501076_0003966 3300049592 Bacteria 10452
292 Ga0501079_0183933 3300049741 Bacteria 1631
293 Ga0501080_0172679 3300049742 Bacteria 1993
294 Ga0501083_0027694 3300049744 Bacteria 3909
295 Ga0501045_0001669 3300049824 Bacteria 14921
296 nmdc:mga06z11_77817_c1 3300050494 Bacteria 1772
297 nmdc:mga05p37_127897_c1 3300050507 Bacteria 3119
298 nmdc:mga05p37_14159_c1 3300050507 Bacteria 9573
299 nmdc:mga05p37_15085_c1 3300050507 Bacteria 9278
300 nmdc:mga05p37_20670_c1 3300050507 Bacteria 7966
301 nmdc:mga05p37_300177_c1 3300050507 Bacteria 1909
302 nmdc:mga05p37_450393_c1 3300050507 Bacteria 1490
303 nmdc:mga05p37_46029_c1 3300050507 Bacteria 5365
304 nmdc:mga05p37_52514_c1 3300050507 Bacteria 5012
305 nmdc:mga05p37_53648_c1 3300050507 Bacteria 4958
306 nmdc:mga05p37_54721_c1 3300050507 Bacteria 4909
307 nmdc:mga09592_113982_c1 3300050508 Bacteria 2320
308 nmdc:mga09592_304530_c1 3300050508 Unclassified 1381
309 nmdc:mga09592_484523_c1 3300050508 Bacteria 1065
310 nmdc:mga09592_67294_c2 3300050508 Unclassified 2321
311 nmdc:mga0qj67_238501_c1 3300050509 Bacteria 1475
312 nmdc:mga0qj67_44169_c1 3300050509 Bacteria 3511
313 nmdc:mga06r32_63916_c1 3300050510 Bacteria 3549
314 nmdc:mga08y16_102698_c1 3300050511 Unclassified 2977
315 nmdc:mga08y16_1131_c1 3300050511 Bacteria 26255
316 nmdc:mga08y16_14171_c1 3300050511 Bacteria 8390
317 nmdc:mga08y16_20857_c1 3300050511 Bacteria 6918
318 nmdc:mga08y16_75997_c1 3300050511 Bacteria 3501
319 nmdc:mga08y16_92424_c1 3300050511 Bacteria 3153
320 nmdc:mga0n895_112341_c1 3300050512 Bacteria 2741
321 nmdc:mga0n895_247000_c1 3300050512 Bacteria 1811
322 nmdc:mga0n895_258567_c1 3300050512 Bacteria 1767
323 nmdc:mga0n895_47702_c1 3300050512 Bacteria 4189
324 nmdc:mga0n895_520100_c1 3300050512 Bacteria 1197
325 nmdc:mga0n895_978_c1 3300050512 Bacteria 20699
326 nmdc:mga0rr50_102273_c1 3300050513 Unclassified 2254
327 nmdc:mga0rr50_241934_c1 3300050513 Bacteria 1496
328 nmdc:mga0rr50_45_c1 3300050513 Bacteria 74544
329 nmdc:mga0rr50_521175_c1 3300050513 Bacteria 1011
330 nmdc:mga0rr50_5369_c1 3300050513 Bacteria 7637
331 nmdc:mga08x19_528_c1 3300050514 Bacteria 25443
332 nmdc:mga0a205_245062_c1 3300050515 Bacteria 1673
333 nmdc:mga0a205_397205_c1 3300050515 Bacteria 1243
334 nmdc:mga0a205_70520_c1 3300050515 Bacteria 3374
335 nmdc:mga0a205_72415_c1 3300050515 Bacteria 3329
336 nmdc:mga0a205_93508_c1 3300050515 Bacteria 2905
337 Ga0495619_0025156 3300053085 Bacteria 3821
338 Ga0501084_0018368 3300054114 Bacteria 5824
339 Ga0590071_029147 3300059421 Bacteria 1311
340 Ga0590074_003597 3300059423 Bacteria 2566
341 Ga0590075_000593 3300059424 Bacteria 9741
342 Ga0501082_0246230 3300060353 Bacteria 1556
343 Ga0501082_0555755 3300060353 Bacteria 1004
344 Ga0530510_0004325 3300061734 Bacteria 9830
345 Ga0265330_10129218
346 Ga0065712_10125027
347 Ga0065715_10013667
348 Ga0065715_10335904
349 Ga0065707_10007386
350 Ga0070658_10082696
351 Ga0070658_10323460
352 Ga0070683_100283546
353 Ga0070690_100002010
354 Ga0070670_100480062
355 Ga0068869_100342964
356 Ga0070666_10007785
357 Ga0070660_100045271
358 Ga0070661_100454577
359 Ga0070669_100014168
360 Ga0070669_100036950
361 Ga0070675_100062330
362 Ga0070675_100164209
363 Ga0070671_100020488
364 Ga0070674_100003403
365 Ga0070674_100025052
366 Ga0070673_100655656
367 Ga0070688_100188265
368 Ga0070659_100145162
369 Ga0070713_100383312
370 Ga0070700_100045209
371 Ga0070694_100005891
372 Ga0070694_100059127
373 Ga0070708_100011057
374 Ga0070708_100272552
375 Ga0070678_100116355
376 Ga0070662_100112147
377 Ga0070662_100232465
378 Ga0070681_10002820
379 Ga0070681_10163281
380 Ga0070681_10199803
381 Ga0070707_100068810
382 Ga0070707_100194040
383 Ga0070698_100104102
384 Ga0070698_100260820
385 Ga0070699_100004012
386 Ga0070699_100109513
387 Ga0070679_100247116
388 Ga0070679_100423902
389 Ga0070684_100237675
390 Ga0070697_100263782
391 Ga0070672_100505251
392 Ga0070686_100001418
393 Ga0070686_100087016
394 Ga0070686_100144450
395 Ga0070695_100025499
396 Ga0070696_100076151
397 Ga0070696_100359100
398 Ga0070696_100597993
399 Ga0070665_100118310
400 Ga0070704_100249841
401 Ga0068855_100153295
402 Ga0068855_100159195
403 Ga0070664_100044170
404 Ga0070664_100264748
405 Ga0068857_100053832
406 Ga0068854_100014410
407 Ga0068856_100072210
408 Ga0068859_100128358
409 Ga0068859_100208939
410 Ga0068859_100268452
411 Ga0068864_100038242
412 Ga0068864_100103493
413 Ga0068866_10009319
414 Ga0068861_100008906
415 Ga0068861_100089094
416 Ga0068861_100090573
417 Ga0068861_100181764
418 Ga0068861_100377930
419 Ga0068863_100021919
420 Ga0068863_100282723
421 Ga0068858_100084818
422 Ga0068858_100443370
423 Ga0068860_100529518
424 Ga0068862_100018900
425 Ga0068862_100029263
426 Ga0068862_100063498
427 Ga0068862_100288592
428 Ga0081455_10118019
429 Ga0081539_10000215
430 Ga0075368_10016223
431 Ga0075367_10049206
432 Ga0097621_100281241
433 Ga0068871_100145591
434 Ga0075428_100001308
435 Ga0075428_100008514
436 Ga0075428_100068984
437 Ga0075430_100009170
438 Ga0075430_100009252
439 Ga0075430_100019049
440 Ga0075431_100020798
441 Ga0075431_100029272
442 Ga0075433_10051046
443 Ga0075433_10108851
444 Ga0075433_10190334
445 Ga0075434_100001728
446 Ga0075434_100008158
447 Ga0075434_100221697
448 Ga0075434_100457787
449 Ga0075429_100085355
450 Ga0075436_100000389
451 Ga0075436_100023521
452 Ga0075436_100096358
453 Ga0097620_100128360
454 Ga0097620_100208945
455 Ga0097620_100268476
456 Ga0075435_100000502
457 Ga0075435_100013707
458 Ga0105240_10005359
459 Ga0105240_10065595
460 Ga0111539_10003862
461 Ga0111539_10008469
462 Ga0111539_10053693
463 Ga0111539_10115102
464 Ga0111539_10580030
465 Ga0105245_10071836
466 Ga0114129_10002888
467 Ga0114129_10004539
468 Ga0114129_10006925
469 Ga0114129_10017889
470 Ga0114129_10039935
471 Ga0114129_10040776
472 Ga0114129_10045558
473 Ga0114129_10063004
474 Ga0114129_10112236
475 Ga0114129_10566204
476 Ga0114129_10664043
477 Ga0105243_10100308
478 Ga0105243_10318418
479 Ga0105241_10204483
480 Ga0105242_10207338
481 Ga0105242_10310126
482 Ga0105248_10031407
483 Ga0105248_10063657
484 Ga0105248_10169034
485 Ga0105248_10318810
486 Ga0105248_10388655
487 Ga0105248_10646165
488 Ga0105238_10921384
489 Ga0105249_10000685
490 Ga0105249_10233917
491 Ga0105249_10234839
492 Ga0105239_11000573
493 Ga0105246_10038015
494 Ga0105246_10289723
495 Ga0163162_10069376
496 Ga0163162_10378292
497 Ga0157375_10048994
498 Ga0163163_10193825
499 Ga0163163_10258371
500 Ga0163163_10804133
501 Ga0157380_10121915
502 Ga0157380_10371236
503 Ga0157379_10008461
504 Ga0157379_10348220
505 Ga0157379_10509361
506 Ga0207697_10003446
507 Ga0207697_10071256
508 Ga0207656_10069239
509 Ga0207642_10092633
510 Ga0207688_10006844
511 Ga0207680_10280232
512 Ga0207643_10074909
513 Ga0207705_10051151
514 Ga0207654_10137672
515 Ga0207707_10133025
516 Ga0207707_10229856
517 Ga0207707_10332003
518 Ga0207695_10252189
519 Ga0207662_10006771
520 Ga0207657_10005894
521 Ga0207657_10409280
522 Ga0207652_10346599
523 Ga0207646_10172486
524 Ga0207681_10015414
525 Ga0207681_10029731
526 Ga0207681_10563876
527 Ga0207659_10363335
528 Ga0207659_10426747
529 Ga0207687_10159151
530 Ga0207664_10140757
531 Ga0207690_10148219
532 Ga0207690_10212773
533 Ga0207706_10094823
534 Ga0207706_10234708
535 Ga0207706_10503317
536 Ga0207670_10221570
537 Ga0207670_10231674
538 Ga0207669_10019994
539 Ga0207669_10231946
540 Ga0207691_10102441
541 Ga0207691_10285114
542 Ga0207691_10537803
543 Ga0207711_10037947
544 Ga0207711_10079328
545 Ga0207711_10085923
546 Ga0207711_10146301
547 Ga0207711_10246423
548 Ga0207689_10450357
549 Ga0207679_10193864
550 Ga0207667_10176031
551 Ga0207667_10179188
552 Ga0207651_10060669
553 Ga0207651_10584098
554 Ga0207712_10029901
555 Ga0207712_10192585
556 Ga0207668_10245524
557 Ga0207658_10227124
558 Ga0207703_10068250
559 Ga0207708_10048460
560 Ga0207641_10012330
561 Ga0207641_10167081
562 Ga0207648_10130741
563 Ga0207676_10049425
564 Ga0207676_10127055
565 Ga0207674_10060249
566 Ga0207675_100035804
567 Ga0207675_100126490
568 Ga0207683_10118690
569 Ga0207683_10611101
570 Ga0207428_10009679
571 Ga0207428_10013205
572 Ga0207428_10059929
573 Ga0207428_10107351
574 Ga0268266_10672476
575 Ga0268265_10047840
576 Ga0268265_10104989
577 Ga0307408_100070768
578 Ga0316576_10226841
579 Ga0307416_100008835
580 Ga0307414_10414755
581 Ga0307411_10167591
582 Ga0307411_10215369
583 Ga0373950_0001835
584 Ga0373958_0004798
585 Ga0373959_0007796
586 Ga0373938_0001687
587 Ga0373928_0002608
588 Ga0373951_0000106
589 Ga0373939_0007141
590 Ga0373955_0022498
591 Ga0373942_0000867
592 Ga0373961_0002021
593 Ga0373962_0000938
594 Ga0373931_0065700
595 Ga0373931_0089688
596 Ga0373937_0242236
597 Ga0450917_002801
598 Ga0439435_0002973
599 Ga0439464_0024595
600 Ga0451577_0334694
601 Ga0453684_0640917
602 Ga0451576_0014484
603 Ga0451576_0194578
604 Ga0466967_0568314
605 Ga0495587_0248845
606 Ga0495645_0005414
607 Ga0495659_0048993
608 Ga0495674_0059450
609 Ga0495680_0283889
610 Ga0496102_0156199
611 Ga0496106_0064242
612 Ga0496106_0216178
613 Ga0496107_0144467
614 Ga0496108_0115499
615 Ga0496108_0318053
616 Ga0496109_0618388
617 Ga0496110_0213213
618 Ga0496112_0282364
619 Ga0501034_0099620
620 Ga0501039_0060805
621 Ga0501040_0025584
622 Ga0501042_0021125
623 Ga0501047_0099853
624 Ga0501047_0216571
625 Ga0501048_0007476
626 Ga0501048_0082228
627 Ga0501067_0296238
628 Ga0501071_0008311
629 Ga0501071_0295812
630 Ga0501072_0014922
631 Ga0501072_0152727
632 Ga0501074_0073298
633 Ga0501075_0007929
634 Ga0501075_0108524
635 Ga0501076_0003966
636 Ga0501079_0183933
637 Ga0501080_0172679
638 Ga0501083_0027694
639 Ga0501045_0001669
640 nmdc:mga06z11_77817_c1
641 nmdc:mga05p37_127897_c1
642 nmdc:mga05p37_14159_c1
643 nmdc:mga05p37_15085_c1
644 nmdc:mga05p37_20670_c1
645 nmdc:mga05p37_300177_c1
646 nmdc:mga05p37_450393_c1
647 nmdc:mga05p37_46029_c1
648 nmdc:mga05p37_52514_c1
649 nmdc:mga05p37_53648_c1
650 nmdc:mga05p37_54721_c1
651 nmdc:mga09592_113982_c1
652 nmdc:mga09592_304530_c1
653 nmdc:mga09592_484523_c1
654 nmdc:mga09592_67294_c2
655 nmdc:mga0qj67_238501_c1
656 nmdc:mga0qj67_44169_c1
657 nmdc:mga06r32_63916_c1
658 nmdc:mga08y16_102698_c1
659 nmdc:mga08y16_1131_c1
660 nmdc:mga08y16_14171_c1
661 nmdc:mga08y16_20857_c1
662 nmdc:mga08y16_75997_c1
663 nmdc:mga08y16_92424_c1
664 nmdc:mga0n895_112341_c1
665 nmdc:mga0n895_247000_c1
666 nmdc:mga0n895_258567_c1
667 nmdc:mga0n895_47702_c1
668 nmdc:mga0n895_520100_c1
669 nmdc:mga0n895_978_c1
670 nmdc:mga0rr50_102273_c1
671 nmdc:mga0rr50_241934_c1
672 nmdc:mga0rr50_45_c1
673 nmdc:mga0rr50_521175_c1
674 nmdc:mga0rr50_5369_c1
675 nmdc:mga08x19_528_c1
676 nmdc:mga0a205_245062_c1
677 nmdc:mga0a205_397205_c1
678 nmdc:mga0a205_70520_c1
679 nmdc:mga0a205_72415_c1
680 nmdc:mga0a205_93508_c1
681 Ga0495619_0025156
682 Ga0501084_0018368
683 Ga0590071_029147
684 Ga0590074_003597
685 Ga0590075_000593
686 Ga0501082_0246230
687 Ga0501082_0555755
688 Ga0530510_0004325

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06750

A24_N_bact

Bacterial Peptidase A24 N-terminal domain

22

105

0.98

PF01478

Peptidase_A24

Type IV leader peptidase family

115

223

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s0x-assembly2.cif.gz_B-2 the crystal structure of gxgd membrane protease flak 0.615 101 251
3s0x-assembly2.cif.gz_B-2 the crystal structure of gxgd membrane protease flak 0.5193 101 251
5if2-assembly1.cif.gz_A crystal structure of polymerase acid protein (pa) from influenza a virus, wilson-smith/1933 (h1n1) bound to fragment hit ebsi-576 (5,6-dichloro-1h-1,3-benzodiazol-2-yl)methanol 0.3234 150 238
5ifd-assembly1.cif.gz_A crystal structure of polymerase acid protein (pa) from influenza a virus, wilson-smith/1933 (h1n1) bound to follow on fragment ebsi-4721 1-(4-fluorophenyl)-1h-imidazole 0.3197 150 238
2npk-assembly1.cif.gz_A an unusual twin-his arrangement in the pore of ammonia channels is essential for substrate conductance 0.2847 9 237
ID Description Score Start End Superfamily
af_P25960_74_220_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.914 98 237 1.20.120.1220
af_P25960_74_220_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8674 98 237 1.20.120.1220
af_Q46836_122_264_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8659 102 238 1.20.120.1220
af_I6Y9M6_1_137_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8115 102 244 1.20.120.1220
af_Q46836_122_264_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8101 102 238 1.20.120.1220
ID Description Score Start End GO Terms
AF-A0A524L4T3-F1-model_v4 Prepilin leader peptidase/N-methyltransferase (EC 2.1.1.-) (EC 3.4.23.43) 0.9753 2 216 GO:0004190
GO:0005886
GO:0006465
GO:0008168
GO:0032259
AF-A0A2M8B4S8-F1-model_v4 Prepilin leader peptidase/N-methyltransferase (EC 2.1.1.-) (EC 3.4.23.43) 0.9752 2 210 GO:0004190
GO:0005886
GO:0006465
GO:0008168
GO:0032259
AF-A0A3N5YQW9-F1-model_v4 Prepilin leader peptidase/N-methyltransferase (EC 2.1.1.-) (EC 3.4.23.43) 0.9741 7 194 GO:0004190
GO:0005886
GO:0006465
GO:0008168
GO:0032259
AF-X1I3C3-F1-model_v4 Prepilin peptidase A24 N-terminal domain-containing protein 0.9702 1 132 GO:0004190
GO:0005886
GO:0006465
AF-A0A2V8A479-F1-model_v4 Prepilin leader peptidase/N-methyltransferase (EC 2.1.1.-) (EC 3.4.23.43) 0.9699 1 256 GO:0004190
GO:0005886
GO:0006465
GO:0008168
GO:0032259

Map