F415701

General Info

Members Datasets Scaffolds Average Seq Length
343 234 686 363

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0065414|Ga0495592_0065414_297_1526
Length 409
Sequence MAKLELKSVRKSFGNTTVIPGIDLVVEDGSCMVFVGPSGCGKSTLLRMIAGLEEVSSGEVHIDATRCDHLLPSARGMAMVFQSYALYPHMSIRENLRFGLVFQKTPKAEIEPRIQRAAEILQISHLLERKPSQLSGGQSQRVAIGRAIVKQPKGFLFDEPLSNLDAELRVKMRGEIVALHQRLKSTMIYVTHDQVEAMTMADTIVVLRNGQIEQSGSPAELYAHPKNLFVAGFLGSPQMNLLAAHGTLSGDGHPVFSVDEERLKIRLPRHANVAADTARCTIGIRPEHLSLREHGALRVSVTAREFLGAETIITGTLGSGETIRASLRGAIHVEIGEVLAFEPDLAHIHVFDQDGMALEEGLTRRWLRRGSAAHHPNTTNWGKRSMQRNNDIVQPPTRLSGFGVTRQSS

Samples

Sample ID Description Type Environment
1 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
61 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
113 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
114 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
121 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
185 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
186 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
187 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
188 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
191 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
192 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
193 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
194 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
195 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
196 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
199 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
200 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
201 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
202 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
203 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
204 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
205 2643221558 Rhizobium sp. Root149 Isolate Unclassified
206 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
207 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
208 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
209 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
210 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
211 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
212 2802429633 Rhizobium anhuiense J3 Isolate Nodule
213 2802429634 Rhizobium anhuiense S10 Isolate Nodule
214 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
215 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
216 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
217 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
218 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
219 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
220 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
221 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
222 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
223 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
224 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
225 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
226 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
227 2909042592 Labrys sp. LIt4 Isolate Nodule
228 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
229 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
230 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
231 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
232 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
233 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
234 8015556637 Bdellovibrio reynosensis LBG001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.92
Metatranscriptomes 0
Isolates 11.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.53
Nodule 2.92
Rhizoplane 0.29
Rhizosphere 50.73
Stem 0
Stem Tuber 1.75
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495592_0065414 3300046454 Bacteria 2662
2 SwRhRL2b_contig_2350440 2162886007 Bacteria 94688
3 JGI25158J39367_1000432 3300002739 Bacteria 8676
4 JGI25152J39213_1001021 3300002773 Bacteria 13419
5 JGI25159J45721_1000827 3300002987 Bacteria 13476
6 JGI25159J45721_1001268 3300002987 Bacteria 10660
7 JGI25151J46595_10004076 3300003187 Bacteria 7833
8 JGI25165J46597_1002628 3300003214 Bacteria 5423
9 JGI25153J46596_10001635 3300003215 Bacteria 13293
10 JGI25153J46596_10001732 3300003215 Bacteria 12952
11 JGI25153J46596_10004364 3300003215 Bacteria 7634
12 JGI25153J46596_10006319 3300003215 Bacteria 6031
13 JGI25153J46596_10026048 3300003215 Bacteria 2078
14 JGI25160J50197_1000050 3300003354 Bacteria 134394
15 JGI25160J50197_1019045 3300003354 Bacteria 2117
16 JGI25161J50226_1000034 3300003374 Bacteria 134394
17 JGI25161J50226_1000038 3300003374 Bacteria 131804
18 JGI25161J50226_1000911 3300003374 Bacteria 10641
19 Ga0055526_1001369 3300003771 Bacteria 17467
20 Ga0055526_1004044 3300003771 Bacteria 9007
21 Ga0055526_1006424 3300003771 Bacteria 6376
22 Ga0055524_1000512 3300003775 Bacteria 29872
23 Ga0055524_1005387 3300003775 Bacteria 5719
24 Ga0055536_1002545 3300003781 Bacteria 10195
25 Ga0055528_1000735 3300003790 Bacteria 22884
26 Ga0055528_1003136 3300003790 Bacteria 8479
27 Ga0055528_1012337 3300003790 Bacteria 3325
28 Ga0055530_10016091 3300003791 Bacteria 2407
29 Ga0055540_1006285 3300003792 Bacteria 4752
30 Ga0055531_10000703 3300003794 Bacteria 28514
31 Ga0055543_1000028 3300004625 Bacteria 134432
32 Ga0055543_1000056 3300004625 Bacteria 103704
33 Ga0055543_1000106 3300004625 Bacteria 73351
34 Ga0065165_1000223 3300005262 Bacteria 99462
35 Ga0065165_1003188 3300005262 Bacteria 12006
36 Ga0065165_1003616 3300005262 Bacteria 10614
37 Ga0065165_1009787 3300005262 Bacteria 4238
38 Ga0065704_10070139 3300005289 Bacteria 529843
39 Ga0070658_10274788 3300005327 Bacteria 1433
40 Ga0070676_10038061 3300005328 Bacteria 2777
41 Ga0070670_100343907 3300005331 Bacteria 1310
42 Ga0070660_100108276 3300005339 Bacteria 2209
43 Ga0070661_100045613 3300005344 Bacteria 3205
44 Ga0070674_100006760 3300005356 Bacteria 6716
45 Ga0070673_100072975 3300005364 Bacteria 2762
46 Ga0070673_100115920 3300005364 Bacteria 2228
47 Ga0070659_100110043 3300005366 Bacteria 2224
48 Ga0070708_100107854 3300005445 Bacteria 2557
49 Ga0070663_100014928 3300005455 Bacteria 4997
50 Ga0070678_100088543 3300005456 Bacteria 2367
51 Ga0070706_100054365 3300005467 Bacteria 3695
52 Ga0070699_100035901 3300005518 Bacteria 4286
53 Ga0070665_100015596 3300005548 Bacteria 7633
54 Ga0070665_100069654 3300005548 Bacteria 3526
55 Ga0070665_100109847 3300005548 Bacteria 2759
56 Ga0070665_100267509 3300005548 Bacteria 1711
57 Ga0068855_100161702 3300005563 Bacteria 2541
58 Ga0070664_100041694 3300005564 Bacteria 3873
59 Ga0068852_100212872 3300005616 Bacteria 1834
60 Ga0068864_100022960 3300005618 Bacteria 5234
61 Ga0068863_100107132 3300005841 Bacteria 2659
62 Ga0068863_100201112 3300005841 Bacteria 1917
63 Ga0075365_10000092 3300006038 Bacteria 26061
64 Ga0075363_100016390 3300006048 Bacteria 3660
65 Ga0075364_10024793 3300006051 Bacteria 3812
66 Ga0075362_10031988 3300006177 Bacteria 2280
67 Ga0075367_10000661 3300006178 Bacteria 13188
68 Ga0075369_10000625 3300006186 Bacteria 11210
69 Ga0075369_10024962 3300006186 Bacteria 2482
70 Ga0097621_100113767 3300006237 Bacteria 2289
71 Ga0075370_10003261 3300006353 Bacteria 7688
72 Ga0075370_10012260 3300006353 Bacteria 4524
73 Ga0075428_100423391 3300006844 Bacteria 1427
74 Ga0068865_100228377 3300006881 Bacteria 1459
75 Ga0068865_100257539 3300006881 Bacteria 1380
76 Ga0105240_10171605 3300009093 Bacteria 2568
77 Ga0105237_10000569 3300009545 Bacteria 51575
78 Ga0105237_10001671 3300009545 Bacteria 28711
79 Ga0105237_10288572 3300009545 Bacteria 1643
80 Ga0105238_10139991 3300009551 Bacteria 2397
81 Ga0105239_10000658 3300010375 Bacteria 49182
82 Ga0105239_10010795 3300010375 Bacteria 10205
83 Ga0105239_10081526 3300010375 Bacteria 3561
84 Ga0105246_10126687 3300011119 Bacteria 1901
85 Ga0157374_10009831 3300013296 Bacteria 8210
86 Ga0157374_10079876 3300013296 Bacteria 3100
87 Ga0157375_10061372 3300013308 Bacteria 3732
88 Ga0163163_10569853 3300014325 Bacteria 1195
89 Ga0157376_10099925 3300014969 Bacteria 2532
90 Ga0213876_10011406 3300021384 Bacteria 4745
91 Ga0213871_10006566 3300021441 Bacteria 2467
92 Ga0213871_10006590 3300021441 Bacteria 2464
93 Ga0213871_10013551 3300021441 Bacteria 1918
94 Ga0209436_100008 3300025208 Bacteria 145772
95 Ga0209436_100045 3300025208 Bacteria 69503
96 Ga0209437_100064 3300025233 Bacteria 334360
97 Ga0207425_1001048 3300025245 Bacteria 12805
98 Ga0207425_1003028 3300025245 Bacteria 5577
99 Ga0207425_1003184 3300025245 Bacteria 5362
100 Ga0209129_1000257 3300025258 Bacteria 54146
101 Ga0209129_1000360 3300025258 Bacteria 37819
102 Ga0209129_1001374 3300025258 Bacteria 13659
103 Ga0209129_1002278 3300025258 Bacteria 9579
104 Ga0209129_1002384 3300025258 Bacteria 9252
105 Ga0209233_1000081 3300025261 Bacteria 336832
106 Ga0209233_1000329 3300025261 Bacteria 48978
107 Ga0209673_1001789 3300025273 Bacteria 17771
108 Ga0209673_1001994 3300025273 Bacteria 15802
109 Ga0209673_1003065 3300025273 Bacteria 10288
110 Ga0209673_1004482 3300025273 Bacteria 7464
111 Ga0209673_1012671 3300025273 Bacteria 3382
112 Ga0209130_1000009 3300025284 Bacteria 498952
113 Ga0209130_1000019 3300025284 Bacteria 381993
114 Ga0209130_1000107 3300025284 Bacteria 134437
115 Ga0209676_1000698 3300025292 Bacteria 47152
116 Ga0209025_1001697 3300025294 Bacteria 26886
117 Ga0209025_1006184 3300025294 Bacteria 9409
118 Ga0209025_1011795 3300025294 Bacteria 5697
119 Ga0209564_1000284 3300025295 Bacteria 102684
120 Ga0209564_1001042 3300025295 Bacteria 33942
121 Ga0209564_1001507 3300025295 Bacteria 23305
122 Ga0209564_1013908 3300025295 Bacteria 3382
123 Ga0209758_1000329 3300025297 Bacteria 89451
124 Ga0209758_1000542 3300025297 Bacteria 59932
125 Ga0209758_1000672 3300025297 Bacteria 51157
126 Ga0209758_1002595 3300025297 Bacteria 18102
127 Ga0209758_1012568 3300025297 Bacteria 4723
128 Ga0209758_1016864 3300025297 Bacteria 3681
129 Ga0209256_1000902 3300025299 Bacteria 36378
130 Ga0209256_1003335 3300025299 Bacteria 11391
131 Ga0209256_1008361 3300025299 Bacteria 4820
132 Ga0209256_1012123 3300025299 Bacteria 3349
133 Ga0207426_1000005 3300025302 Bacteria 1037188
134 Ga0207426_1000041 3300025302 Bacteria 433536
135 Ga0207426_1000069 3300025302 Bacteria 334513
136 Ga0209051_1001956 3300025303 Bacteria 15846
137 Ga0209051_1002400 3300025303 Bacteria 13480
138 Ga0209051_1010994 3300025303 Bacteria 4513
139 Ga0209051_1033142 3300025303 Bacteria 1958
140 Ga0209257_1000897 3300025304 Bacteria 41804
141 Ga0209257_1000953 3300025304 Bacteria 39797
142 Ga0209257_1002566 3300025304 Bacteria 17698
143 Ga0209257_1014959 3300025304 Bacteria 3277
144 Ga0207645_10132312 3300025907 Bacteria 1624
145 Ga0207705_10009215 3300025909 Bacteria 7187
146 Ga0207684_10017681 3300025910 Bacteria 6117
147 Ga0207671_10000158 3300025914 Bacteria 105476
148 Ga0207671_10006153 3300025914 Bacteria 10785
149 Ga0207657_10088415 3300025919 Bacteria 2590
150 Ga0207649_10070607 3300025920 Bacteria 2228
151 Ga0207646_10028475 3300025922 Bacteria 5084
152 Ga0207650_10107660 3300025925 Bacteria 2154
153 Ga0207644_10050953 3300025931 Bacteria 2969
154 Ga0207706_10123671 3300025933 Bacteria 2276
155 Ga0207704_10243922 3300025938 Bacteria 1344
156 Ga0207691_10037793 3300025940 Bacteria 4469
157 Ga0207711_10080512 3300025941 Bacteria 2845
158 Ga0207667_10015344 3300025949 Bacteria 8709
159 Ga0207678_10020315 3300026067 Bacteria 5828
160 Ga0207678_10032416 3300026067 Bacteria 4554
161 Ga0207678_10111533 3300026067 Bacteria 2334
162 Ga0207648_10181019 3300026089 Bacteria 1865
163 Ga0207674_10015538 3300026116 Bacteria 8360
164 Ga0207683_10116817 3300026121 Bacteria 2392
165 Ga0207698_10307084 3300026142 Bacteria 1479
166 Ga0209371_1000981 3300027312 Bacteria 21998
167 Ga0209971_1020942 3300027682 Bacteria 1555
168 Ga0268266_10000280 3300028379 Bacteria 84153
169 Ga0268266_10001256 3300028379 Bacteria 30990
170 Ga0268266_10028208 3300028379 Bacteria 4773
171 Ga0268266_10029177 3300028379 Bacteria 4690
172 Ga0268266_10224664 3300028379 Bacteria 1727
173 Ga0307515_10003607 3300028794 Bacteria 32504
174 Ga0307515_10034697 3300028794 Bacteria 8242
175 Ga0307515_10240722 3300028794 Bacteria 1581
176 Ga0268256_1000829 3300030500 Bacteria 21998
177 Ga0307513_10064730 3300031456 Bacteria 3850
178 Ga0307513_10286188 3300031456 Bacteria 1422
179 Ga0307408_100374712 3300031548 Bacteria 1215
180 Ga0265313_10053636 3300031595 Bacteria 1918
181 Ga0265314_10030949 3300031711 Bacteria 3956
182 Ga0316576_10046076 3300031727 Bacteria 3155
183 Ga0307516_10203841 3300031730 Bacteria 1696
184 Ga0307413_10005276 3300031824 Bacteria 5746
185 Ga0307409_100012640 3300031995 Bacteria 5390
186 Ga0307409_100174969 3300031995 Bacteria 1893
187 Ga0307414_10010597 3300032004 Bacteria 5359
188 Ga0307414_10116369 3300032004 Bacteria 2046
189 Ga0373927_0000408 3300035695 Bacteria 33083
190 Ga0373925_0000597 3300037068 Bacteria 34700
191 Ga0395905_0000511 3300037471 Bacteria 53190
192 Ga0395905_0007978 3300037471 Bacteria 10467
193 Ga0395905_0062422 3300037471 Bacteria 3485
194 Ga0400488_08008 3300038741 Bacteria 3011
195 Ga0400486_21685 3300038742 Bacteria 15458
196 Ga0400483_149099 3300039062 Bacteria 4376
197 Ga0436365_0766950 3300039437 Bacteria 1807
198 Ga0436365_0866931 3300039437 Bacteria 14960
199 Ga0436360_0920351 3300039438 Bacteria 2042
200 Ga0436360_1188252 3300039438 Bacteria 5305
201 Ga0436361_0101892 3300039447 Bacteria 1805
202 Ga0436361_0777863 3300039447 Bacteria 6376
203 Ga0436361_0994328 3300039447 Bacteria 5264
204 Ga0436361_1090183 3300039447 Bacteria 2750
205 Ga0436363_0668039 3300039450 Bacteria 15158
206 Ga0436363_0951171 3300039450 Bacteria 6413
207 Ga0436362_0063162 3300039453 Bacteria 2606
208 Ga0439465_0003906 3300041413 Bacteria 4861
209 Ga0439446_0000047 3300042156 Bacteria 19267
210 Ga0451576_0011635 3300045051 Bacteria 9968
211 Ga0495603_0000031 3300046455 Bacteria 60069
212 Ga0495629_0168789 3300046459 Bacteria 1519
213 Ga0495638_0032939 3300046460 Bacteria 3316
214 Ga0495651_0082229 3300046462 Bacteria 2430
215 Ga0495653_0000084 3300046463 Bacteria 78987
216 Ga0495580_0000088 3300046472 Bacteria 59968
217 Ga0495582_0006454 3300046473 Bacteria 6515
218 Ga0495664_0015507 3300046477 Bacteria 4332
219 Ga0495606_0041085 3300046507 Bacteria 3103
220 Ga0495618_0010150 3300046514 Bacteria 5695
221 Ga0495628_0000150 3300046516 Bacteria 60379
222 Ga0495630_0010765 3300046517 Bacteria 6604
223 Ga0495648_0000258 3300046524 Bacteria 60073
224 Ga0495648_0089370 3300046524 Bacteria 1729
225 Ga0495666_0000716 3300046526 Bacteria 15139
226 Ga0495652_0001787 3300046529 Bacteria 22961
227 Ga0495665_0000022 3300046531 Bacteria 60359
228 Ga0495586_0000217 3300046535 Bacteria 38452
229 Ga0495645_0008419 3300046543 Bacteria 7205
230 Ga0495634_0033897 3300046642 Bacteria 3505
231 Ga0495635_0029744 3300046663 Bacteria 3799
232 Ga0495646_0033868 3300046680 Bacteria 3175
233 Ga0495613_0021272 3300046689 Bacteria 4837
234 Ga0495624_0000092 3300046690 Bacteria 60383
235 Ga0495671_0079510 3300046692 Bacteria 1607
236 Ga0495600_0011570 3300046809 Bacteria 5503
237 Ga0495581_0000823 3300047315 Bacteria 16514
238 Ga0495604_0001481 3300047317 Bacteria 19345
239 Ga0495674_0000114 3300047319 Bacteria 60379
240 Ga0495676_0012543 3300047321 Bacteria 7629
241 Ga0495680_0000242 3300047322 Bacteria 60061
242 Ga0495679_000167 3300047446 Bacteria 59598
243 Ga0495684_0124230 3300047471 Bacteria 1942
244 Ga0495602_0000174 3300048088 Bacteria 60071
245 Ga0495614_0000010 3300048089 Bacteria 60071
246 Ga0496106_0000128 3300048909 Bacteria 58226
247 Ga0496117_0047383 3300048920 Bacteria 3082
248 Ga0496119_0038563 3300048922 Bacteria 3085
249 Ga0496120_0035935 3300048923 Bacteria 2955
250 Ga0496121_0003149 3300048924 Bacteria 23797
251 Ga0496121_0028193 3300048924 Bacteria 5233
252 Ga0496122_0192283 3300048925 Bacteria 1203
253 Ga0496123_0022125 3300048926 Bacteria 4911
254 Ga0496126_0007247 3300048929 Bacteria 12195
255 Ga0496126_0048712 3300048929 Bacteria 3871
256 Ga0496126_0070232 3300048929 Bacteria 3121
257 Ga0496126_0180235 3300048929 Bacteria 1795
258 Ga0501032_0047663 3300049569 Bacteria 2893
259 Ga0501033_0000059 3300049570 Bacteria 105311
260 Ga0501033_0015759 3300049570 Bacteria 5730
261 Ga0501033_0044169 3300049570 Bacteria 3317
262 Ga0501034_0037908 3300049571 Bacteria 4882
263 Ga0501034_0040345 3300049571 Bacteria 4725
264 Ga0501034_0049103 3300049571 Bacteria 4259
265 Ga0501034_0119625 3300049571 Bacteria 2620
266 Ga0501034_0245732 3300049571 Bacteria 1734
267 Ga0501036_0117569 3300049572 Bacteria 2245
268 Ga0501038_0002566 3300049574 Bacteria 16937
269 Ga0501040_0001532 3300049576 Archaea 14695
270 Ga0501043_0059242 3300049579 Bacteria 3005
271 Ga0501043_0189574 3300049579 Bacteria 1599
272 Ga0501047_0052291 3300049581 Bacteria 3948
273 Ga0501068_0036930 3300049584 Bacteria 2924
274 Ga0501070_0010252 3300049586 Bacteria 7927
275 Ga0501070_0010442 3300049586 Bacteria 7849
276 Ga0501073_0155520 3300049589 Bacteria 1585
277 Ga0501073_0362487 3300049589 Bacteria 1001
278 Ga0501083_0008184 3300049744 Bacteria 7396
279 Ga0501035_0000213 3300049822 Bacteria 69670
280 Ga0501035_0062261 3300049822 Bacteria 3320
281 Ga0501035_0088207 3300049822 Bacteria 2733
282 Ga0501044_0083791 3300049823 Bacteria 3223
283 Ga0501044_0174586 3300049823 Bacteria 2118
284 nmdc:mga03683_39100_c1 3300050489 Bacteria 1941
285 nmdc:mga03n38_8803_c1 3300050490 Bacteria 3640
286 nmdc:mga0yw44_1631_c1 3300050492 Bacteria 9026
287 nmdc:mga0k408_2670_c1 3300050493 Bacteria 9454
288 nmdc:mga06z11_23472_c1 3300050494 Bacteria 2898
289 nmdc:mga06z11_24782_c1 3300050494 Bacteria 2835
290 nmdc:mga07m45_19084_c2 3300050496 Bacteria 3414
291 nmdc:mga07m45_7353_c1 3300050496 Bacteria 5623
292 nmdc:mga0sz30_30035_c1 3300050516 Bacteria 2244
293 nmdc:mga0sz30_457_c1 3300050516 Bacteria 15437
294 Ga0500651_0013631 3300053093 Bacteria 4959
295 Ga0500658_0022531 3300053134 Bacteria 2396
296 Ga0500559_0011461 3300053136 Bacteria 3786
297 Ga0500568_0001602 3300053139 Bacteria 14316
298 Ga0500590_001788 3300053148 Bacteria 9078
299 Ga0500620_042246 3300053155 Bacteria 1501
300 Ga0500622_0000709 3300053156 Bacteria 29268
301 Ga0500627_0080138 3300053158 Bacteria 1455
302 Ga0500633_0002199 3300053160 Bacteria 3951
303 Ga0500634_0049347 3300053161 Bacteria 2269
304 Ga0500636_0045813 3300053177 Bacteria 2579
305 Ga0501082_0103873 3300060353 Bacteria 2458
306 2511175120 2510917026 Bacteria 7046020
307 2511199918 2510917030 Bacteria 7460662
308 2515644619 2515154114 Bacteria 7848616
309 2585227317 2582581298 Bacteria 7315509
310 2585335930 2582581316 Bacteria 7774528
311 2585395186 2582581866 Bacteria 6859583
312 2585550731 2585427529 Bacteria 7395659
313 2643814536 2643221558 Bacteria 5460675
314 2643883191 2643221574 Bacteria 2789653
315 2644242118 2643221643 Bacteria 5749658
316 2644547442 2643221699 Bacteria 5731501
317 2644552386 2643221699 Bacteria 5731501
318 2707098245 2706794495 Bacteria 4536932
319 2739038365 2738541333 Bacteria 7106503
320 2792643676 2791355094 Bacteria 7011481
321 2806047837 2802429633 Bacteria 7341974
322 2806055475 2802429634 Bacteria 7083200
323 2806061518 2802429635 Bacteria 7650140
324 2806070207 2802429636 Bacteria 7597525
325 2837680655 2837678835 Bacteria 5252418
326 2840880259 2840878972 Bacteria 5483153
327 2842484433 2842482326 Bacteria 7212537
328 2854603002 2854601825 Bacteria 4797592
329 2855198636 2855195626 Bacteria 4927512
330 2857523981 2857516855 Bacteria 7787325
331 2858469716 2858466076 Bacteria 4722413
332 2871273156 2871272651 Bacteria 5042015
333 2871283224 2871282230 Bacteria 4917173
334 2885321093 2885318864 Bacteria 6729568
335 2900053573 2900051742 Bacteria 4985156
336 2909042813 2909042592 Bacteria 6499737
337 2919108262 2919100787 Bacteria 7710546
338 2919176738 2919171160 Bacteria 6499771
339 2920766684 2920760137 Bacteria 7427611
340 3000018087 3000017691 Bacteria 3772574
341 3005451469 3005445848 Bacteria 6906074
342 8005575615 8005570704 Bacteria 6957481
343 8015559331 8015556637 Bacteria 3582323
344 Ga0495592_0065414
345 SwRhRL2b_contig_2350440
346 JGI25158J39367_1000432
347 JGI25152J39213_1001021
348 JGI25159J45721_1000827
349 JGI25159J45721_1001268
350 JGI25151J46595_10004076
351 JGI25165J46597_1002628
352 JGI25153J46596_10001635
353 JGI25153J46596_10001732
354 JGI25153J46596_10004364
355 JGI25153J46596_10006319
356 JGI25153J46596_10026048
357 JGI25160J50197_1000050
358 JGI25160J50197_1019045
359 JGI25161J50226_1000034
360 JGI25161J50226_1000038
361 JGI25161J50226_1000911
362 Ga0055526_1001369
363 Ga0055526_1004044
364 Ga0055526_1006424
365 Ga0055524_1000512
366 Ga0055524_1005387
367 Ga0055536_1002545
368 Ga0055528_1000735
369 Ga0055528_1003136
370 Ga0055528_1012337
371 Ga0055530_10016091
372 Ga0055540_1006285
373 Ga0055531_10000703
374 Ga0055543_1000028
375 Ga0055543_1000056
376 Ga0055543_1000106
377 Ga0065165_1000223
378 Ga0065165_1003188
379 Ga0065165_1003616
380 Ga0065165_1009787
381 Ga0065704_10070139
382 Ga0070658_10274788
383 Ga0070676_10038061
384 Ga0070670_100343907
385 Ga0070660_100108276
386 Ga0070661_100045613
387 Ga0070674_100006760
388 Ga0070673_100072975
389 Ga0070673_100115920
390 Ga0070659_100110043
391 Ga0070708_100107854
392 Ga0070663_100014928
393 Ga0070678_100088543
394 Ga0070706_100054365
395 Ga0070699_100035901
396 Ga0070665_100015596
397 Ga0070665_100069654
398 Ga0070665_100109847
399 Ga0070665_100267509
400 Ga0068855_100161702
401 Ga0070664_100041694
402 Ga0068852_100212872
403 Ga0068864_100022960
404 Ga0068863_100107132
405 Ga0068863_100201112
406 Ga0075365_10000092
407 Ga0075363_100016390
408 Ga0075364_10024793
409 Ga0075362_10031988
410 Ga0075367_10000661
411 Ga0075369_10000625
412 Ga0075369_10024962
413 Ga0097621_100113767
414 Ga0075370_10003261
415 Ga0075370_10012260
416 Ga0075428_100423391
417 Ga0068865_100228377
418 Ga0068865_100257539
419 Ga0105240_10171605
420 Ga0105237_10000569
421 Ga0105237_10001671
422 Ga0105237_10288572
423 Ga0105238_10139991
424 Ga0105239_10000658
425 Ga0105239_10010795
426 Ga0105239_10081526
427 Ga0105246_10126687
428 Ga0157374_10009831
429 Ga0157374_10079876
430 Ga0157375_10061372
431 Ga0163163_10569853
432 Ga0157376_10099925
433 Ga0213876_10011406
434 Ga0213871_10006566
435 Ga0213871_10006590
436 Ga0213871_10013551
437 Ga0209436_100008
438 Ga0209436_100045
439 Ga0209437_100064
440 Ga0207425_1001048
441 Ga0207425_1003028
442 Ga0207425_1003184
443 Ga0209129_1000257
444 Ga0209129_1000360
445 Ga0209129_1001374
446 Ga0209129_1002278
447 Ga0209129_1002384
448 Ga0209233_1000081
449 Ga0209233_1000329
450 Ga0209673_1001789
451 Ga0209673_1001994
452 Ga0209673_1003065
453 Ga0209673_1004482
454 Ga0209673_1012671
455 Ga0209130_1000009
456 Ga0209130_1000019
457 Ga0209130_1000107
458 Ga0209676_1000698
459 Ga0209025_1001697
460 Ga0209025_1006184
461 Ga0209025_1011795
462 Ga0209564_1000284
463 Ga0209564_1001042
464 Ga0209564_1001507
465 Ga0209564_1013908
466 Ga0209758_1000329
467 Ga0209758_1000542
468 Ga0209758_1000672
469 Ga0209758_1002595
470 Ga0209758_1012568
471 Ga0209758_1016864
472 Ga0209256_1000902
473 Ga0209256_1003335
474 Ga0209256_1008361
475 Ga0209256_1012123
476 Ga0207426_1000005
477 Ga0207426_1000041
478 Ga0207426_1000069
479 Ga0209051_1001956
480 Ga0209051_1002400
481 Ga0209051_1010994
482 Ga0209051_1033142
483 Ga0209257_1000897
484 Ga0209257_1000953
485 Ga0209257_1002566
486 Ga0209257_1014959
487 Ga0207645_10132312
488 Ga0207705_10009215
489 Ga0207684_10017681
490 Ga0207671_10000158
491 Ga0207671_10006153
492 Ga0207657_10088415
493 Ga0207649_10070607
494 Ga0207646_10028475
495 Ga0207650_10107660
496 Ga0207644_10050953
497 Ga0207706_10123671
498 Ga0207704_10243922
499 Ga0207691_10037793
500 Ga0207711_10080512
501 Ga0207667_10015344
502 Ga0207678_10020315
503 Ga0207678_10032416
504 Ga0207678_10111533
505 Ga0207648_10181019
506 Ga0207674_10015538
507 Ga0207683_10116817
508 Ga0207698_10307084
509 Ga0209371_1000981
510 Ga0209971_1020942
511 Ga0268266_10000280
512 Ga0268266_10001256
513 Ga0268266_10028208
514 Ga0268266_10029177
515 Ga0268266_10224664
516 Ga0307515_10003607
517 Ga0307515_10034697
518 Ga0307515_10240722
519 Ga0268256_1000829
520 Ga0307513_10064730
521 Ga0307513_10286188
522 Ga0307408_100374712
523 Ga0265313_10053636
524 Ga0265314_10030949
525 Ga0316576_10046076
526 Ga0307516_10203841
527 Ga0307413_10005276
528 Ga0307409_100012640
529 Ga0307409_100174969
530 Ga0307414_10010597
531 Ga0307414_10116369
532 Ga0373927_0000408
533 Ga0373925_0000597
534 Ga0395905_0000511
535 Ga0395905_0007978
536 Ga0395905_0062422
537 Ga0400488_08008
538 Ga0400486_21685
539 Ga0400483_149099
540 Ga0436365_0766950
541 Ga0436365_0866931
542 Ga0436360_0920351
543 Ga0436360_1188252
544 Ga0436361_0101892
545 Ga0436361_0777863
546 Ga0436361_0994328
547 Ga0436361_1090183
548 Ga0436363_0668039
549 Ga0436363_0951171
550 Ga0436362_0063162
551 Ga0439465_0003906
552 Ga0439446_0000047
553 Ga0451576_0011635
554 Ga0495603_0000031
555 Ga0495629_0168789
556 Ga0495638_0032939
557 Ga0495651_0082229
558 Ga0495653_0000084
559 Ga0495580_0000088
560 Ga0495582_0006454
561 Ga0495664_0015507
562 Ga0495606_0041085
563 Ga0495618_0010150
564 Ga0495628_0000150
565 Ga0495630_0010765
566 Ga0495648_0000258
567 Ga0495648_0089370
568 Ga0495666_0000716
569 Ga0495652_0001787
570 Ga0495665_0000022
571 Ga0495586_0000217
572 Ga0495645_0008419
573 Ga0495634_0033897
574 Ga0495635_0029744
575 Ga0495646_0033868
576 Ga0495613_0021272
577 Ga0495624_0000092
578 Ga0495671_0079510
579 Ga0495600_0011570
580 Ga0495581_0000823
581 Ga0495604_0001481
582 Ga0495674_0000114
583 Ga0495676_0012543
584 Ga0495680_0000242
585 Ga0495679_000167
586 Ga0495684_0124230
587 Ga0495602_0000174
588 Ga0495614_0000010
589 Ga0496106_0000128
590 Ga0496117_0047383
591 Ga0496119_0038563
592 Ga0496120_0035935
593 Ga0496121_0003149
594 Ga0496121_0028193
595 Ga0496122_0192283
596 Ga0496123_0022125
597 Ga0496126_0007247
598 Ga0496126_0048712
599 Ga0496126_0070232
600 Ga0496126_0180235
601 Ga0501032_0047663
602 Ga0501033_0000059
603 Ga0501033_0015759
604 Ga0501033_0044169
605 Ga0501034_0037908
606 Ga0501034_0040345
607 Ga0501034_0049103
608 Ga0501034_0119625
609 Ga0501034_0245732
610 Ga0501036_0117569
611 Ga0501038_0002566
612 Ga0501040_0001532
613 Ga0501043_0059242
614 Ga0501043_0189574
615 Ga0501047_0052291
616 Ga0501068_0036930
617 Ga0501070_0010252
618 Ga0501070_0010442
619 Ga0501073_0155520
620 Ga0501073_0362487
621 Ga0501083_0008184
622 Ga0501035_0000213
623 Ga0501035_0062261
624 Ga0501035_0088207
625 Ga0501044_0083791
626 Ga0501044_0174586
627 nmdc:mga03683_39100_c1
628 nmdc:mga03n38_8803_c1
629 nmdc:mga0yw44_1631_c1
630 nmdc:mga0k408_2670_c1
631 nmdc:mga06z11_23472_c1
632 nmdc:mga06z11_24782_c1
633 nmdc:mga07m45_19084_c2
634 nmdc:mga07m45_7353_c1
635 nmdc:mga0sz30_30035_c1
636 nmdc:mga0sz30_457_c1
637 Ga0500651_0013631
638 Ga0500658_0022531
639 Ga0500559_0011461
640 Ga0500568_0001602
641 Ga0500590_001788
642 Ga0500620_042246
643 Ga0500622_0000709
644 Ga0500627_0080138
645 Ga0500633_0002199
646 Ga0500634_0049347
647 Ga0500636_0045813
648 Ga0501082_0103873
649 2511175120
650 2511199918
651 2515644619
652 2585227317
653 2585335930
654 2585395186
655 2585550731
656 2643814536
657 2643883191
658 2644242118
659 2644547442
660 2644552386
661 2707098245
662 2739038365
663 2792643676
664 2806047837
665 2806055475
666 2806061518
667 2806070207
668 2837680655
669 2840880259
670 2842484433
671 2854603002
672 2855198636
673 2857523981
674 2858469716
675 2871273156
676 2871283224
677 2885321093
678 2900053573
679 2909042813
680 2919108262
681 2919176738
682 2920766684
683 3000018087
684 3005451469
685 8005575615
686 8015559331

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08402

TOBE_2

TOBE domain

282

351

0.96

PF00005

ABC_tran

ABC transporter

19

162

0.95

PF17912

OB_MalK

MalK OB fold domain

235

289

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9552 4 233
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9527 4 233
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9509 4 234
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.9483 4 212
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9468 1 217
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.985 3 216 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.984 4 233 3.40.50.300
af_Q2G089_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.978 4 234 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9777 1 217 3.40.50.300
af_O69724_1_242_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9724 4 235 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A519YL00-F1-model_v4 deleted 0.985 4 233
AF-A0A3M1A2L0-F1-model_v4 ATP-binding cassette domain-containing protein 0.9838 1 208 GO:0005524
GO:0015423
GO:0016887
GO:0055052
GO:1990060
AF-A0A661S1Z9-F1-model_v4 Iron ABC transporter ATP-binding protein 0.9835 4 236 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A603BF62-F1-model_v4 ABC transporter ATP-binding protein 0.9835 4 233 GO:0005524
GO:0016887
AF-A0A2N6DB41-F1-model_v4 Glycine betaine ABC transporter ATP-binding protein 0.9825 4 236 GO:0005524
GO:0016020
GO:0016887
GO:0031460

Map