F415642

General Info

Members Datasets Scaffolds Average Seq Length
343 163 341 313

Family's Representative Sequence

Representative Sequence 3300031733|Ga0316577_10073962|Ga0316577_100739622
Length 335
Sequence MYTVLLTAPYMIFSLERFQSVFDRFDIRLIVPEVRERLDESELLQYAGQYDGTICGDDQYTARVIGACAPRLKVISKWGTGVDSIDAEACAKFGVRLGRTPNAFTTAVADTVMGYLLAFARRGPWMDAAMKKGEWNKLSGRTLSECVLGIVGVGAIGKAITRRARAFGVHVLGNDIVEIDHAFITETGIEMTGLEDLLARSDFVSLNCDLNPSSRHLMNAKTLALMKPSAVLINAARGSIVDEPAMVSALQKGRIAGAALDVFKTEPLPLDSPLRHMDNVLLAPHNANSSPAAWERVHWNTIRNLLEGLGLPTKDLLEGTKSSGHSSTGKPPARS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
3 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
93 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
94 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
103 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
104 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
117 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
137 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
138 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
139 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
140 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
141 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
142 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
143 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
144 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
145 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
146 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.29
Rhizoplane 0
Rhizosphere 98.54
Stem 0
Stem Tuber 0
Unclassified 1.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_253730 2162886007 Bacteria 18582
2 JGI24735J21928_10024374 3300002067 Bacteria 1831
3 JGI25406J46586_10003698 3300003203 Bacteria 7169
4 JGI25406J46586_10005443 3300003203 Bacteria 5906
5 JGI25406J46586_10005610 3300003203 Bacteria 5810
6 JGI25406J46586_10013802 3300003203 Bacteria 3454
7 Ga0065704_10000545 3300005289 Bacteria 21648
8 Ga0065704_10101351 3300005289 Viruses 2240
9 Ga0065707_10082082 3300005295 Bacteria 22476
10 Ga0065707_10085950 3300005295 Bacteria 5748
11 Ga0065707_10086992 3300005295 Bacteria 5213
12 Ga0065707_10116368 3300005295 Bacteria 2240
13 Ga0065707_10186339 3300005295 Bacteria 1386
14 Ga0070658_10002921 3300005327 Bacteria 14165
15 Ga0070670_100021339 3300005331 Bacteria 5572
16 Ga0068869_100209375 3300005334 Bacteria 1541
17 Ga0070680_100282246 3300005336 Bacteria 1407
18 Ga0070660_100156015 3300005339 Bacteria 1837
19 Ga0070689_100004213 3300005340 Bacteria 9700
20 Ga0070692_10105836 3300005345 Bacteria 1549
21 Ga0070668_100000265 3300005347 Bacteria 34509
22 Ga0070668_100056431 3300005347 Bacteria 3033
23 Ga0070669_100010405 3300005353 Bacteria 6606
24 Ga0070669_100122083 3300005353 Bacteria 1989
25 Ga0070674_100004507 3300005356 Bacteria 7950
26 Ga0070703_10030422 3300005406 Bacteria 1626
27 Ga0070709_10215020 3300005434 Unclassified 1368
28 Ga0070714_100197442 3300005435 Unclassified 1839
29 Ga0070705_100031449 3300005440 Bacteria 2939
30 Ga0070700_100000110 3300005441 Bacteria 52465
31 Ga0070700_100012627 3300005441 Bacteria 4722
32 Ga0070694_100006848 3300005444 Bacteria 6925
33 Ga0070694_100017812 3300005444 Bacteria 4493
34 Ga0070662_100215738 3300005457 Bacteria 1529
35 Ga0070681_10001306 3300005458 Bacteria 21747
36 Ga0070706_100308465 3300005467 Bacteria 1476
37 Ga0070707_100007849 3300005468 Bacteria 9906
38 Ga0070707_100013849 3300005468 Bacteria 7551
39 Ga0070698_100006389 3300005471 Bacteria 12798
40 Ga0070698_100054077 3300005471 Bacteria 4078
41 Ga0070698_100109846 3300005471 Bacteria 2724
42 Ga0070698_100192424 3300005471 Bacteria 1977
43 Ga0070699_100012037 3300005518 Bacteria 7469
44 Ga0070699_100015743 3300005518 Bacteria 6493
45 Ga0070699_100065367 3300005518 Bacteria 3156
46 Ga0070699_100084572 3300005518 Bacteria 2769
47 Ga0070679_100127260 3300005530 Bacteria 2529
48 Ga0070697_100096302 3300005536 Unclassified 2455
49 Ga0070696_100143227 3300005546 Unclassified 1749
50 Ga0070704_100010604 3300005549 Bacteria 5611
51 Ga0070704_100043044 3300005549 Unclassified 3128
52 Ga0070704_100219201 3300005549 Bacteria 1546
53 Ga0068857_100033763 3300005577 Bacteria 4525
54 Ga0070702_100042908 3300005615 Bacteria 2546
55 Ga0068859_100018556 3300005617 Bacteria 6992
56 Ga0068859_100105258 3300005617 Unclassified 2881
57 Ga0068859_100183980 3300005617 Bacteria 2173
58 Ga0068861_100006301 3300005719 Bacteria 8076
59 Ga0068863_100036688 3300005841 Unclassified 4669
60 Ga0068863_100118856 3300005841 Bacteria 2519
61 Ga0068858_100102142 3300005842 Bacteria 2674
62 Ga0068862_100023936 3300005844 Bacteria 5119
63 Ga0068862_100231413 3300005844 Bacteria 1677
64 Ga0068862_100238850 3300005844 Bacteria 1651
65 Ga0068862_100322729 3300005844 Bacteria 1426
66 Ga0081455_10002759 3300005937 Bacteria 20730
67 Ga0081455_10027145 3300005937 Bacteria 5250
68 Ga0081539_10000022 3300005985 Bacteria 356710
69 Ga0081539_10000380 3300005985 Bacteria 96999
70 Ga0081539_10000500 3300005985 Bacteria 82137
71 Ga0081539_10000859 3300005985 Bacteria 58193
72 Ga0081539_10005055 3300005985 Bacteria 13849
73 Ga0097621_100006774 3300006237 Bacteria 8138
74 Ga0097621_100081676 3300006237 Bacteria 2690
75 Ga0075428_100027392 3300006844 Bacteria 6305
76 Ga0075428_100078235 3300006844 Bacteria 3610
77 Ga0075428_100370307 3300006844 Unclassified 1536
78 Ga0075428_100441121 3300006844 Bacteria 1394
79 Ga0075431_100029288 3300006847 Bacteria 5665
80 Ga0075431_100055574 3300006847 Bacteria 4083
81 Ga0075431_100131123 3300006847 Bacteria 2585
82 Ga0075431_100245485 3300006847 Bacteria 1820
83 Ga0075431_100373361 3300006847 Bacteria 1431
84 Ga0075431_100448293 3300006847 Bacteria 1286
85 Ga0075433_10042288 3300006852 Bacteria 3953
86 Ga0075433_10056589 3300006852 Unclassified 3426
87 Ga0075433_10135251 3300006852 Bacteria 2191
88 Ga0075433_10137859 3300006852 Unclassified 2169
89 Ga0075434_100310349 3300006871 Bacteria 1598
90 Ga0075434_100626888 3300006871 Bacteria 1094
91 Ga0075429_100017158 3300006880 Bacteria 6262
92 Ga0075429_100027464 3300006880 Unclassified 4941
93 Ga0075429_100042874 3300006880 Bacteria 3937
94 Ga0075429_100108220 3300006880 Bacteria 2429
95 Ga0068865_100144176 3300006881 Bacteria 1799
96 Ga0075436_100000022 3300006914 Bacteria 117346
97 Ga0097620_100018556 3300006931 Bacteria 6992
98 Ga0097620_100105258 3300006931 Unclassified 2881
99 Ga0097620_100183980 3300006931 Bacteria 2173
100 Ga0075435_100011080 3300007076 Bacteria 6612
101 Ga0075435_100033395 3300007076 Bacteria 4068
102 Ga0099794_10050280 3300007265 Bacteria 2005
103 Ga0099795_10035222 3300007788 Unclassified 1749
104 Ga0105240_10350758 3300009093 Bacteria 1674
105 Ga0111539_10002145 3300009094 Bacteria 26384
106 Ga0111539_10019942 3300009094 Bacteria 8259
107 Ga0111539_10092543 3300009094 Bacteria 3553
108 Ga0114129_10005520 3300009147 Bacteria 17886
109 Ga0114129_10009931 3300009147 Bacteria 13567
110 Ga0114129_10015137 3300009147 Bacteria 10979
111 Ga0114129_10032106 3300009147 Bacteria 7423
112 Ga0114129_10070919 3300009147 Unclassified 4858
113 Ga0114129_10094338 3300009147 Bacteria 4144
114 Ga0114129_10321088 3300009147 Bacteria 2058
115 Ga0114129_10357134 3300009147 Bacteria 1934
116 Ga0114129_10429159 3300009147 Bacteria 1737
117 Ga0105243_10000574 3300009148 Bacteria 36971
118 Ga0105243_10005766 3300009148 Bacteria 9614
119 Ga0105243_10043943 3300009148 Bacteria 3504
120 Ga0105243_10403795 3300009148 Bacteria 1270
121 Ga0105241_10174773 3300009174 Unclassified 1776
122 Ga0105242_10000055 3300009176 Bacteria 76298
123 Ga0105242_10086985 3300009176 Bacteria 2624
124 Ga0105248_10004038 3300009177 Bacteria 16213
125 Ga0105248_10023873 3300009177 Bacteria 6796
126 Ga0105249_10000269 3300009553 Bacteria 54950
127 Ga0105249_10043853 3300009553 Bacteria 4069
128 Ga0105249_10076596 3300009553 Bacteria 3101
129 Ga0105249_10336434 3300009553 Bacteria 1525
130 Ga0105246_10243428 3300011119 Unclassified 1423
131 Ga0163162_10000090 3300013306 Bacteria 83702
132 Ga0157372_10040277 3300013307 Bacteria 5160
133 Ga0157372_10440909 3300013307 Bacteria 1518
134 Ga0157380_10075036 3300014326 Bacteria 2747
135 Ga0163161_10260650 3300017792 Bacteria 1354
136 Ga0213876_10000017 3300021384 Bacteria 297728
137 Ga0213876_10000771 3300021384 Bacteria 21987
138 Ga0207653_10034634 3300025885 Bacteria 1640
139 Ga0207647_10007582 3300025904 Bacteria 7823
140 Ga0207645_10120947 3300025907 Bacteria 1699
141 Ga0207705_10006483 3300025909 Bacteria 8670
142 Ga0207684_10144270 3300025910 Bacteria 2048
143 Ga0207695_10187901 3300025913 Bacteria 1984
144 Ga0207652_10258390 3300025921 Bacteria 1571
145 Ga0207646_10029737 3300025922 Bacteria 4961
146 Ga0207646_10044385 3300025922 Bacteria 3990
147 Ga0207646_10093299 3300025922 Bacteria 2695
148 Ga0207681_10040853 3300025923 Bacteria 3088
149 Ga0207664_10175115 3300025929 Unclassified 1839
150 Ga0207686_10000038 3300025934 Bacteria 127610
151 Ga0207709_10000017 3300025935 Bacteria 470753
152 Ga0207709_10000054 3300025935 Bacteria 223290
153 Ga0207709_10296470 3300025935 Bacteria 1201
154 Ga0207704_10118883 3300025938 Bacteria 1804
155 Ga0207711_10062060 3300025941 Bacteria 3224
156 Ga0207712_10000627 3300025961 Bacteria 27948
157 Ga0207668_10003302 3300025972 Bacteria 9458
158 Ga0207668_10083836 3300025972 Bacteria 2321
159 Ga0207708_10000028 3300026075 Bacteria 164263
160 Ga0207708_10111189 3300026075 Bacteria 2127
161 Ga0207708_10126525 3300026075 Bacteria 1995
162 Ga0207641_10024717 3300026088 Unclassified 4952
163 Ga0207674_10044626 3300026116 Bacteria 4566
164 Ga0207674_10114295 3300026116 Bacteria 2672
165 Ga0207675_100023647 3300026118 Bacteria 5716
166 Ga0207675_100139473 3300026118 Unclassified 2302
167 Ga0207675_100227825 3300026118 Bacteria 1797
168 Ga0207428_10006452 3300027907 Bacteria 10834
169 Ga0207428_10076688 3300027907 Bacteria 2617
170 Ga0268265_10461109 3300028380 Bacteria 1189
171 Ga0268265_10499990 3300028380 Bacteria 1145
172 Ga0268264_10434670 3300028381 Bacteria 1268
173 Ga0265326_10031609 3300028558 Bacteria 1508
174 Ga0265318_10003685 3300028577 Bacteria 7653
175 Ga0265323_10007889 3300028653 Bacteria 4402
176 Ga0265338_10169174 3300028800 Bacteria 1678
177 Ga0265328_10010510 3300031239 Bacteria 3722
178 Ga0265320_10020772 3300031240 Bacteria 3549
179 Ga0265340_10032440 3300031247 Bacteria 2607
180 Ga0265327_10066731 3300031251 Bacteria 1814
181 Ga0265316_10043335 3300031344 Bacteria 3588
182 Ga0307408_100014822 3300031548 Bacteria 5183
183 Ga0316575_10005585 3300031665 Bacteria 4488
184 Ga0316575_10010284 3300031665 Bacteria 3433
185 Ga0316576_10138174 3300031727 Bacteria 1834
186 Ga0316576_10165060 3300031727 Unclassified 1671
187 Ga0316576_10180630 3300031727 Bacteria 1592
188 Ga0316578_10027311 3300031728 Bacteria 3225
189 Ga0316578_10120213 3300031728 Unclassified 1579
190 Ga0316578_10221959 3300031728 Archaea 1136
191 Ga0307405_10007057 3300031731 Bacteria 5585
192 Ga0307405_10015942 3300031731 Bacteria 4085
193 Ga0307405_10071708 3300031731 Bacteria 2230
194 Ga0316577_10014388 3300031733 Bacteria 4342
195 Ga0316577_10020361 3300031733 Archaea 3677
196 Ga0316577_10073962 3300031733 Unclassified 1903
197 Ga0307413_10173781 3300031824 Unclassified 1528
198 Ga0307406_10004603 3300031901 Bacteria 7509
199 Ga0307407_10218099 3300031903 Unclassified 1288
200 Ga0307412_10004701 3300031911 Bacteria 7616
201 Ga0307409_100407825 3300031995 Unclassified 1300
202 Ga0307416_100020770 3300032002 Bacteria 4695
203 Ga0307414_10010741 3300032004 Bacteria 5334
204 Ga0316574_0006279 3300035398 Bacteria 6410
205 Ga0316574_0105345 3300035398 Unclassified 1806
206 Ga0373937_0035966 3300036401 Bacteria 4511
207 Ga0316582_0000074 3300036647 Bacteria 25393
208 Ga0316582_0000232 3300036647 Bacteria 18400
209 Ga0316582_0004148 3300036647 Bacteria 7258
210 Ga0316582_0029866 3300036647 Bacteria 3314
211 Ga0316582_0132414 3300036647 Bacteria 1676
212 Ga0316582_0206603 3300036647 Bacteria 1341
213 Ga0316584_0004110 3300036712 Bacteria 9595
214 Ga0316584_0006146 3300036712 Archaea 8123
215 Ga0316584_0024133 3300036712 Bacteria 4448
216 Ga0316584_0025921 3300036712 Unclassified 4304
217 Ga0316584_0148238 3300036712 Unclassified 1748
218 Ga0436365_0924676 3300039437 Bacteria 448697
219 Ga0436365_1176403 3300039437 Bacteria 22057
220 Ga0439448_0003293 3300042005 Bacteria 4465
221 Ga0451577_0028904 3300042876 Bacteria 5014
222 Ga0451577_0041343 3300042876 Bacteria 4138
223 Ga0451577_0043839 3300042876 Bacteria 4005
224 Ga0451577_0052914 3300042876 Bacteria 3626
225 Ga0451577_0070704 3300042876 Bacteria 3112
226 Ga0451577_0111148 3300042876 Unclassified 2452
227 Ga0451577_0113130 3300042876 Bacteria 2429
228 Ga0451577_0158390 3300042876 Bacteria 2038
229 Ga0451577_0171900 3300042876 Bacteria 1953
230 Ga0451577_0364330 3300042876 Bacteria 1311
231 Ga0451577_0504301 3300042876 Bacteria 1099
232 Ga0451577_0747280 3300042876 Bacteria 885
233 Ga0453683_0000731 3300044673 Bacteria 33613
234 Ga0453683_0001275 3300044673 Bacteria 22350
235 Ga0453683_0004127 3300044673 Bacteria 10428
236 Ga0453683_0033857 3300044673 Unclassified 3222
237 Ga0453683_0117158 3300044673 Bacteria 1676
238 Ga0466961_0121178 3300044693 Bacteria 1642
239 Ga0453684_0000012 3300044712 Bacteria 1062512
240 Ga0453684_0000047 3300044712 Bacteria 560243
241 Ga0453684_0000535 3300044712 Bacteria 144635
242 Ga0453684_0000718 3300044712 Bacteria 117108
243 Ga0453684_0000899 3300044712 Bacteria 99196
244 Ga0453684_0001230 3300044712 Bacteria 78346
245 Ga0453684_0002841 3300044712 Bacteria 40773
246 Ga0453684_0003136 3300044712 Bacteria 38060
247 Ga0453684_0003454 3300044712 Bacteria 35535
248 Ga0453684_0003847 3300044712 Bacteria 33075
249 Ga0453684_0015359 3300044712 Bacteria 12127
250 Ga0453684_0016234 3300044712 Bacteria 11666
251 Ga0453684_0019211 3300044712 Bacteria 10419
252 Ga0453684_0039191 3300044712 Bacteria 6462
253 Ga0453684_0042999 3300044712 Bacteria 6080
254 Ga0453684_0046276 3300044712 Bacteria 5788
255 Ga0453684_0053070 3300044712 Bacteria 5294
256 Ga0453684_0059353 3300044712 Unclassified 4933
257 Ga0453684_0061771 3300044712 Bacteria 4807
258 Ga0453684_0068797 3300044712 Bacteria 4494
259 Ga0453684_0101164 3300044712 Bacteria 3526
260 Ga0453684_0106395 3300044712 Bacteria 3419
261 Ga0453684_0112483 3300044712 Unclassified 3305
262 Ga0453684_0119307 3300044712 Bacteria 3188
263 Ga0453684_0169929 3300044712 Unclassified 2571
264 Ga0453684_0172189 3300044712 Bacteria 2550
265 Ga0453684_0244117 3300044712 Unclassified 2066
266 Ga0453684_0260480 3300044712 Bacteria 1987
267 Ga0453684_0488899 3300044712 Unclassified 1364
268 Ga0453684_0540593 3300044712 Bacteria 1285
269 Ga0451576_0000853 3300045051 Bacteria 59154
270 Ga0451576_0020715 3300045051 Bacteria 7158
271 Ga0451576_0046917 3300045051 Bacteria 4545
272 Ga0451576_0151519 3300045051 Bacteria 2418
273 Ga0451576_0152794 3300045051 Unclassified 2407
274 Ga0451576_0280116 3300045051 Unclassified 1743
275 Ga0451576_0284428 3300045051 Bacteria 1729
276 Ga0451576_0726175 3300045051 Unclassified 1044
277 Ga0495618_0124202 3300046514 Bacteria 1652
278 Ga0495667_0054136 3300046559 Unclassified 2641
279 Ga0495613_0000569 3300046689 Bacteria 30368
280 Ga0495680_0067675 3300047322 Bacteria 2730
281 Ga0495684_0000801 3300047471 Bacteria 25577
282 Ga0501038_0068102 3300049574 Plasmid 3027
283 Ga0501038_0152163 3300049574 Bacteria 1886
284 Ga0501038_0398156 3300049574 Bacteria 1066
285 Ga0501040_0227868 3300049576 Unclassified 1327
286 Ga0501068_0126140 3300049584 Bacteria 1599
287 Ga0501073_0028553 3300049589 Bacteria 3987
288 Ga0501073_0190292 3300049589 Bacteria 1420
289 Ga0501073_0203946 3300049589 Bacteria 1367
290 Ga0501075_0016962 3300049591 Bacteria 5253
291 Ga0501076_0279178 3300049592 Bacteria 1368
292 Ga0501198_003259 3300049649 Bacteria 2211
293 Ga0501202_001030 3300049652 Bacteria 4330
294 Ga0501217_002204 3300049661 Bacteria 3793
295 Ga0501224_000963 3300049664 Bacteria 3720
296 Ga0501227_002295 3300049665 Bacteria 4228
297 Ga0501233_013555 3300049668 Bacteria 1655
298 Ga0501235_005066 3300049669 Bacteria 2860
299 Ga0501236_005911 3300049670 Bacteria 1492
300 Ga0501257_005861 3300049686 Bacteria 2717
301 Ga0501229_001129 3300049706 Bacteria 3088
302 Ga0501234_002665 3300049707 Bacteria 2809
303 Ga0501079_0338240 3300049741 Unclassified 1179
304 Ga0501079_0478449 3300049741 Unclassified 979
305 Ga0501080_0146397 3300049742 Bacteria 2183
306 Ga0501080_0310462 3300049742 Bacteria 1429
307 Ga0501081_0202153 3300049743 Bacteria 1441
308 Ga0501083_0046412 3300049744 Bacteria 2937
309 Ga0501045_0248590 3300049824 Bacteria 1324
310 Ga0501204_008135 3300049850 Bacteria 1191
311 nmdc:mga05p37_107981_c1 3300050507 Unclassified 3423
312 nmdc:mga05p37_11571_c1 3300050507 Bacteria 10513
313 nmdc:mga05p37_130947_c1 3300050507 Unclassified 3078
314 nmdc:mga05p37_196966_c1 3300050507 Bacteria 2442
315 nmdc:mga05p37_29349_c1 3300050507 Bacteria 6712
316 nmdc:mga05p37_3702_c1 3300050507 Bacteria 17880
317 nmdc:mga09592_141429_c1 3300050508 Bacteria 2075
318 nmdc:mga09592_255156_c1 3300050508 Bacteria 1520
319 nmdc:mga09592_33667_c1 3300050508 Unclassified 4279
320 nmdc:mga0qj67_502911_c1 3300050509 Bacteria 974
321 nmdc:mga06r32_109824_c1 3300050510 Bacteria 2712
322 nmdc:mga06r32_179897_c1 3300050510 Bacteria 2100
323 nmdc:mga06r32_223644_c1 3300050510 Bacteria 1870
324 nmdc:mga06r32_348408_c1 3300050510 Bacteria 1466
325 nmdc:mga06r32_363860_c1 3300050510 Bacteria 1430
326 nmdc:mga08y16_21462_c1 3300050511 Bacteria 6819
327 nmdc:mga08y16_444429_c1 3300050511 Bacteria 1323
328 nmdc:mga08y16_8351_c1 3300050511 Bacteria 10834
329 nmdc:mga0n895_322229_c1 3300050512 Unclassified 1566
330 nmdc:mga0rr50_645_c2 3300050513 Bacteria 16677
331 nmdc:mga08x19_12_c1 3300050514 Bacteria 395395
332 nmdc:mga0a205_104241_c1 3300050515 Bacteria 2735
333 nmdc:mga0a205_104483_c1 3300050515 Bacteria 2732
334 nmdc:mga0a205_251664_c1 3300050515 Bacteria 1646
335 nmdc:mga0a205_416832_c1 3300050515 Unclassified 1205
336 nmdc:mga0a205_78082_c1 3300050515 Unclassified 3198
337 nmdc:mga0a205_9539_c1 3300050515 Bacteria 8880
338 Ga0501084_0001535 3300054114 Bacteria 18358
339 Ga0501084_0030072 3300054114 Bacteria 4544
340 Ga0501084_0045321 3300054114 Bacteria 3682
341 Ga0501082_0341130 3300060353 Bacteria 1306

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049741 Ga0501079_0478449 Ga0501079_0478449_134_955 265
2 3300050509 nmdc:mga0qj67_502911_c1 nmdc:mga0qj67_502911_c1_97_951 265
3 3300005518 Ga0070699_100012037 Ga0070699_1000120376 269
4 3300042876 Ga0451577_0747280 Ga0451577_0747280_13_870 274
5 3300042876 Ga0451577_0113130 Ga0451577_0113130_812_1777 276
6 3300044712 Ga0453684_0244117 Ga0453684_0244117_294_1232 276
7 3300005617 Ga0068859_100018556 Ga0068859_1000185564 279
8 3300006931 Ga0097620_100018556 Ga0097620_1000185563 279
9 3300009177 Ga0105248_10023873 Ga0105248_100238733 279
10 3300025941 Ga0207711_10062060 Ga0207711_100620602 279
11 3300026118 Ga0207675_100227825 Ga0207675_1002278252 280
12 3300009148 Ga0105243_10403795 Ga0105243_104037952 281
13 3300026075 Ga0207708_10111189 Ga0207708_101111892 281
14 3300049741 Ga0501079_0338240 Ga0501079_0338240_97_1023 281
15 3300005458 Ga0070681_10001306 Ga0070681_1000130616 282
16 3300005518 Ga0070699_100084572 Ga0070699_1000845722 283
17 3300005844 Ga0068862_100023936 Ga0068862_1000239362 283
18 3300009148 Ga0105243_10043943 Ga0105243_100439432 283
19 3300026118 Ga0207675_100139473 Ga0207675_1001394732 283
20 3300005441 Ga0070700_100000110 Ga0070700_10000011026 284
21 3300026075 Ga0207708_10000028 Ga0207708_10000028105 284
22 3300045051 Ga0451576_0020715 Ga0451576_0020715_4304_5251 284
23 3300009553 Ga0105249_10336434 Ga0105249_103364342 285
24 3300042005 Ga0439448_0003293 Ga0439448_0003293_2272_3204 285
25 3300005844 Ga0068862_100231413 Ga0068862_1002314132 288
26 3300044712 Ga0453684_0059353 Ga0453684_0059353_3724_4641 288
27 3300049574 Ga0501038_0398156 Ga0501038_0398156_25_921 290
28 3300050510 nmdc:mga06r32_109824_c1 nmdc:mga06r32_109824_c1_1256_2185 290
29 3300005295 Ga0065707_10116368 Ga0065707_101163682 292
30 3300009094 Ga0111539_10002145 Ga0111539_1000214521 292
31 3300026116 Ga0207674_10114295 Ga0207674_101142952 292
32 3300027907 Ga0207428_10006452 Ga0207428_100064528 292
33 3300050511 nmdc:mga08y16_8351_c1 nmdc:mga08y16_8351_c1_50_991 292
34 3300006847 Ga0075431_100131123 Ga0075431_1001311232 294
35 3300044712 Ga0453684_0172189 Ga0453684_0172189_1110_2027 294
36 3300031731 Ga0307405_10015942 Ga0307405_100159422 298
37 3300031995 Ga0307409_100407825 Ga0307409_1004078252 298
38 3300003203 JGI25406J46586_10013802 JGI25406J46586_100138021 301
39 3300009553 Ga0105249_10000269 Ga0105249_1000026940 301
40 3300013306 Ga0163162_10000090 Ga0163162_1000009039 301
41 3300049574 Ga0501038_0152163 Ga0501038_0152163_900_1835 301
42 3300049824 Ga0501045_0248590 Ga0501045_0248590_143_1078 301
43 3300060353 Ga0501082_0341130 Ga0501082_0341130_184_1119 301
44 3300005467 Ga0070706_100308465 Ga0070706_1003084652 302
45 3300005468 Ga0070707_100007849 Ga0070707_1000078493 302
46 3300005471 Ga0070698_100054077 Ga0070698_1000540772 302
47 3300007265 Ga0099794_10050280 Ga0099794_100502802 302
48 3300025922 Ga0207646_10044385 Ga0207646_100443852 302
49 3300042876 Ga0451577_0041343 Ga0451577_0041343_2685_3614 302
50 3300042876 Ga0451577_0158390 Ga0451577_0158390_15_962 302
51 3300044712 Ga0453684_0001230 Ga0453684_0001230_39043_39954 302
52 3300044712 Ga0453684_0003136 Ga0453684_0003136_29732_30679 302
53 3300044712 Ga0453684_0046276 Ga0453684_0046276_3393_4322 302
54 3300005440 Ga0070705_100031449 Ga0070705_1000314493 303
55 3300005518 Ga0070699_100015743 Ga0070699_1000157432 303
56 3300005549 Ga0070704_100219201 Ga0070704_1002192012 303
57 3300005842 Ga0068858_100102142 Ga0068858_1001021422 303
58 3300050510 nmdc:mga06r32_363860_c1 nmdc:mga06r32_363860_c1_404_1315 303
59 iso_pu_bacteria 2791355082 2792584798 303
60 iso_pu_bacteria 2840878972 2840880915 303
61 3300031665 Ga0316575_10010284 Ga0316575_100102843 304
62 3300031728 Ga0316578_10027311 Ga0316578_100273113 304
63 3300035398 Ga0316574_0006279 Ga0316574_0006279_4588_5523 304
64 3300036647 Ga0316582_0004148 Ga0316582_0004148_1101_2036 304
65 3300044673 Ga0453683_0117158 Ga0453683_0117158_400_1359 304
66 3300049589 Ga0501073_0203946 Ga0501073_0203946_275_1189 304
67 3300006237 Ga0097621_100006774 Ga0097621_1000067743 305
68 3300028381 Ga0268264_10434670 Ga0268264_104346702 305
69 3300044712 Ga0453684_0019211 Ga0453684_0019211_3059_3976 305
70 3300044712 Ga0453684_0053070 Ga0453684_0053070_1512_2429 305
71 3300044712 Ga0453684_0488899 Ga0453684_0488899_387_1304 305
72 3300006847 Ga0075431_100029288 Ga0075431_1000292882 306
73 3300006880 Ga0075429_100108220 Ga0075429_1001082202 306
74 3300009147 Ga0114129_10015137 Ga0114129_100151378 306
75 3300049574 Ga0501038_0068102 Ga0501038_0068102_712_1632 306
76 3300049589 Ga0501073_0190292 Ga0501073_0190292_383_1327 306
77 3300050507 nmdc:mga05p37_130947_c1 nmdc:mga05p37_130947_c1_857_1777 306
78 3300050508 nmdc:mga09592_141429_c1 nmdc:mga09592_141429_c1_1012_1932 306
79 3300050510 nmdc:mga06r32_179897_c1 nmdc:mga06r32_179897_c1_518_1438 306
80 3300042876 Ga0451577_0171900 Ga0451577_0171900_633_1577 307
81 3300044712 Ga0453684_0000535 Ga0453684_0000535_29070_29993 307
82 3300009147 Ga0114129_10429159 Ga0114129_104291592 308
83 3300036647 Ga0316582_0000074 Ga0316582_0000074_9837_10793 308
84 3300044712 Ga0453684_0260480 Ga0453684_0260480_198_1124 308
85 3300045051 Ga0451576_0151519 Ga0451576_0151519_94_1020 308
86 3300050515 nmdc:mga0a205_416832_c1 nmdc:mga0a205_416832_c1_15_941 308
87 3300005336 Ga0070680_100282246 Ga0070680_1002822462 309
88 3300005347 Ga0070668_100056431 Ga0070668_1000564313 309
89 3300005353 Ga0070669_100010405 Ga0070669_1000104051 309
90 3300005356 Ga0070674_100004507 Ga0070674_1000045073 309
91 3300005719 Ga0068861_100006301 Ga0068861_1000063011 309
92 3300006881 Ga0068865_100144176 Ga0068865_1001441762 309
93 3300009176 Ga0105242_10086985 Ga0105242_100869853 309
94 3300009553 Ga0105249_10043853 Ga0105249_100438533 309
95 3300017792 Ga0163161_10260650 Ga0163161_102606501 309
96 3300025907 Ga0207645_10120947 Ga0207645_101209472 309
97 3300025923 Ga0207681_10040853 Ga0207681_100408533 309
98 3300025972 Ga0207668_10083836 Ga0207668_100838363 309
99 3300026075 Ga0207708_10126525 Ga0207708_101265252 309
100 3300028380 Ga0268265_10499990 Ga0268265_104999902 309
101 3300044693 Ga0466961_0121178 Ga0466961_0121178_399_1346 309
102 3300049591 Ga0501075_0016962 Ga0501075_0016962_3819_4748 309
103 3300049743 Ga0501081_0202153 Ga0501081_0202153_339_1268 309
104 3300054114 Ga0501084_0045321 Ga0501084_0045321_1410_2339 309
105 3300005345 Ga0070692_10105836 Ga0070692_101058361 310
106 3300005444 Ga0070694_100006848 Ga0070694_1000068489 310
107 3300009093 Ga0105240_10350758 Ga0105240_103507582 310
108 3300013307 Ga0157372_10040277 Ga0157372_100402772 310
109 3300025913 Ga0207695_10187901 Ga0207695_101879012 310
110 3300044712 Ga0453684_0042999 Ga0453684_0042999_4744_5700 310
111 3300050515 nmdc:mga0a205_104483_c1 nmdc:mga0a205_104483_c1_32_964 310
112 3300049670 Ga0501236_005911 Ga0501236_005911_78_1016 311
113 3300049707 Ga0501234_002665 Ga0501234_002665_1085_2023 311
114 3300002067 JGI24735J21928_10024374 JGI24735J21928_100243742 312
115 3300003203 JGI25406J46586_10003698 JGI25406J46586_100036984 312
116 3300003203 JGI25406J46586_10005610 JGI25406J46586_100056104 312
117 3300005327 Ga0070658_10002921 Ga0070658_100029213 312
118 3300005331 Ga0070670_100021339 Ga0070670_1000213393 312
119 3300005334 Ga0068869_100209375 Ga0068869_1002093751 312
120 3300005339 Ga0070660_100156015 Ga0070660_1001560151 312
121 3300005347 Ga0070668_100000265 Ga0070668_10000026525 312
122 3300005406 Ga0070703_10030422 Ga0070703_100304222 312
123 3300005434 Ga0070709_10215020 Ga0070709_102150202 312
124 3300005435 Ga0070714_100197442 Ga0070714_1001974422 312
125 3300005468 Ga0070707_100013849 Ga0070707_1000138492 312
126 3300005471 Ga0070698_100006389 Ga0070698_1000063897 312
127 3300005471 Ga0070698_100192424 Ga0070698_1001924241 312
128 3300005518 Ga0070699_100065367 Ga0070699_1000653672 312
129 3300005530 Ga0070679_100127260 Ga0070679_1001272602 312
130 3300005536 Ga0070697_100096302 Ga0070697_1000963022 312
131 3300005549 Ga0070704_100043044 Ga0070704_1000430443 312
132 3300005577 Ga0068857_100033763 Ga0068857_1000337634 312
133 3300005615 Ga0070702_100042908 Ga0070702_1000429082 312
134 3300005617 Ga0068859_100105258 Ga0068859_1001052582 312
135 3300005617 Ga0068859_100183980 Ga0068859_1001839801 312
136 3300005841 Ga0068863_100036688 Ga0068863_1000366883 312
137 3300005841 Ga0068863_100118856 Ga0068863_1001188562 312
138 3300005844 Ga0068862_100238850 Ga0068862_1002388502 312
139 3300005985 Ga0081539_10000022 Ga0081539_1000002226 312
140 3300005985 Ga0081539_10000380 Ga0081539_1000038024 312
141 3300005985 Ga0081539_10000500 Ga0081539_1000050064 312
142 3300006237 Ga0097621_100081676 Ga0097621_1000816763 312
143 3300006844 Ga0075428_100370307 Ga0075428_1003703072 312
144 3300006852 Ga0075433_10042288 Ga0075433_100422882 312
145 3300006852 Ga0075433_10135251 Ga0075433_101352512 312
146 3300006871 Ga0075434_100626888 Ga0075434_1006268881 312
147 3300006931 Ga0097620_100105258 Ga0097620_1001052582 312
148 3300006931 Ga0097620_100183980 Ga0097620_1001839801 312
149 3300007076 Ga0075435_100011080 Ga0075435_1000110804 312
150 3300007788 Ga0099795_10035222 Ga0099795_100352222 312
151 3300009094 Ga0111539_10019942 Ga0111539_100199423 312
152 3300009147 Ga0114129_10032106 Ga0114129_100321063 312
153 3300009147 Ga0114129_10321088 Ga0114129_103210882 312
154 3300009147 Ga0114129_10357134 Ga0114129_103571341 312
155 3300009148 Ga0105243_10000574 Ga0105243_1000057410 312
156 3300009174 Ga0105241_10174773 Ga0105241_101747732 312
157 3300009176 Ga0105242_10000055 Ga0105242_1000005556 312
158 3300009177 Ga0105248_10004038 Ga0105248_1000403818 312
159 3300011119 Ga0105246_10243428 Ga0105246_102434282 312
160 3300013307 Ga0157372_10440909 Ga0157372_104409092 312
161 3300021384 Ga0213876_10000017 Ga0213876_10000017142 312
162 3300021384 Ga0213876_10000771 Ga0213876_100007713 312
163 3300025885 Ga0207653_10034634 Ga0207653_100346342 312
164 3300025904 Ga0207647_10007582 Ga0207647_100075827 312
165 3300025909 Ga0207705_10006483 Ga0207705_100064833 312
166 3300025921 Ga0207652_10258390 Ga0207652_102583902 312
167 3300025922 Ga0207646_10093299 Ga0207646_100932992 312
168 3300025929 Ga0207664_10175115 Ga0207664_101751152 312
169 3300025934 Ga0207686_10000038 Ga0207686_1000003857 312
170 3300025935 Ga0207709_10000017 Ga0207709_1000001750 312
171 3300025935 Ga0207709_10000054 Ga0207709_1000005450 312
172 3300025961 Ga0207712_10000627 Ga0207712_1000062719 312
173 3300025972 Ga0207668_10003302 Ga0207668_100033029 312
174 3300026088 Ga0207641_10024717 Ga0207641_100247174 312
175 3300026116 Ga0207674_10044626 Ga0207674_100446264 312
176 3300027907 Ga0207428_10076688 Ga0207428_100766882 312
177 3300031548 Ga0307408_100014822 Ga0307408_1000148223 312
178 3300031727 Ga0316576_10180630 Ga0316576_101806302 312
179 3300031731 Ga0307405_10007057 Ga0307405_100070573 312
180 3300031824 Ga0307413_10173781 Ga0307413_101737811 312
181 3300031901 Ga0307406_10004603 Ga0307406_100046034 312
182 3300031911 Ga0307412_10004701 Ga0307412_100047014 312
183 3300032002 Ga0307416_100020770 Ga0307416_1000207703 312
184 3300032004 Ga0307414_10010741 Ga0307414_100107413 312
185 3300036401 Ga0373937_0035966 Ga0373937_0035966_811_1773 312
186 3300036647 Ga0316582_0206603 Ga0316582_0206603_51_992 312
187 3300039437 Ga0436365_0924676 Ga0436365_0924676_119701_120642 312
188 3300039437 Ga0436365_1176403 Ga0436365_1176403_9885_10826 312
189 3300044712 Ga0453684_0002841 Ga0453684_0002841_9543_10481 312
190 3300044712 Ga0453684_0003454 Ga0453684_0003454_351_1292 312
191 3300044712 Ga0453684_0039191 Ga0453684_0039191_5021_5959 312
192 3300046514 Ga0495618_0124202 Ga0495618_0124202_572_1534 312
193 3300046559 Ga0495667_0054136 Ga0495667_0054136_336_1298 312
194 3300046689 Ga0495613_0000569 Ga0495613_0000569_3225_4187 312
195 3300047322 Ga0495680_0067675 Ga0495680_0067675_14_976 312
196 3300047471 Ga0495684_0000801 Ga0495684_0000801_19323_20285 312
197 3300049576 Ga0501040_0227868 Ga0501040_0227868_335_1300 312
198 3300049584 Ga0501068_0126140 Ga0501068_0126140_363_1304 312
199 3300049592 Ga0501076_0279178 Ga0501076_0279178_167_1114 312
200 3300049649 Ga0501198_003259 Ga0501198_003259_1037_1978 312
201 3300049652 Ga0501202_001030 Ga0501202_001030_2677_3618 312
202 3300049661 Ga0501217_002204 Ga0501217_002204_2302_3243 312
203 3300049664 Ga0501224_000963 Ga0501224_000963_755_1696 312
204 3300049665 Ga0501227_002295 Ga0501227_002295_2631_3572 312
205 3300049668 Ga0501233_013555 Ga0501233_013555_40_981 312
206 3300049669 Ga0501235_005066 Ga0501235_005066_537_1478 312
207 3300049686 Ga0501257_005861 Ga0501257_005861_1024_1965 312
208 3300049706 Ga0501229_001129 Ga0501229_001129_688_1629 312
209 3300049742 Ga0501080_0310462 Ga0501080_0310462_177_1118 312
210 3300049744 Ga0501083_0046412 Ga0501083_0046412_1658_2599 312
211 3300049850 Ga0501204_008135 Ga0501204_008135_95_1036 312
212 3300050507 nmdc:mga05p37_107981_c1 nmdc:mga05p37_107981_c1_237_1178 312
213 3300050507 nmdc:mga05p37_29349_c1 nmdc:mga05p37_29349_c1_4188_5147 312
214 3300050510 nmdc:mga06r32_223644_c1 nmdc:mga06r32_223644_c1_298_1269 312
215 3300050511 nmdc:mga08y16_21462_c1 nmdc:mga08y16_21462_c1_4349_5290 312
216 3300050512 nmdc:mga0n895_322229_c1 nmdc:mga0n895_322229_c1_171_1112 312
217 3300050515 nmdc:mga0a205_251664_c1 nmdc:mga0a205_251664_c1_246_1187 312
218 3300031733 Ga0316577_10014388 Ga0316577_100143884 313
219 3300036647 Ga0316582_0029866 Ga0316582_0029866_420_1367 313
220 3300036712 Ga0316584_0024133 Ga0316584_0024133_1642_2589 313
221 3300042876 Ga0451577_0504301 Ga0451577_0504301_22_963 313
222 3300006847 Ga0075431_100373361 Ga0075431_1003733612 314
223 3300036712 Ga0316584_0025921 Ga0316584_0025921_1663_2625 314
224 3300036712 Ga0316584_0148238 Ga0316584_0148238_630_1595 314
225 3300042876 Ga0451577_0043839 Ga0451577_0043839_2397_3341 314
226 3300044673 Ga0453683_0033857 Ga0453683_0033857_1480_2445 314
227 3300006914 Ga0075436_100000022 Ga0075436_10000002254 315
228 3300007076 Ga0075435_100033395 Ga0075435_1000333953 315
229 3300036647 Ga0316582_0132414 Ga0316582_0132414_508_1464 315
230 3300042876 Ga0451577_0364330 Ga0451577_0364330_290_1258 315
231 3300044712 Ga0453684_0000047 Ga0453684_0000047_117094_118062 315
232 3300044712 Ga0453684_0000899 Ga0453684_0000899_45887_46834 315
233 3300044712 Ga0453684_0101164 Ga0453684_0101164_590_1537 315
234 3300050513 nmdc:mga0rr50_645_c2 nmdc:mga0rr50_645_c2_3535_4512 315
235 3300050514 nmdc:mga08x19_12_c1 nmdc:mga08x19_12_c1_335566_336543 315
236 3300005937 Ga0081455_10027145 Ga0081455_100271452 316
237 3300006852 Ga0075433_10137859 Ga0075433_101378592 316
238 3300009147 Ga0114129_10009931 Ga0114129_1000993110 316
239 3300025910 Ga0207684_10144270 Ga0207684_101442702 316
240 3300025922 Ga0207646_10029737 Ga0207646_100297373 316
241 3300042876 Ga0451577_0028904 Ga0451577_0028904_2729_3700 316
242 3300042876 Ga0451577_0070704 Ga0451577_0070704_302_1252 316
243 3300044673 Ga0453683_0001275 Ga0453683_0001275_16521_17471 316
244 3300044712 Ga0453684_0015359 Ga0453684_0015359_5752_6723 316
245 3300044712 Ga0453684_0061771 Ga0453684_0061771_1607_2578 316
246 3300044712 Ga0453684_0068797 Ga0453684_0068797_2331_3302 316
247 3300044712 Ga0453684_0119307 Ga0453684_0119307_1958_2908 316
248 3300044712 Ga0453684_0169929 Ga0453684_0169929_138_1109 316
249 3300045051 Ga0451576_0046917 Ga0451576_0046917_3020_3991 316
250 3300045051 Ga0451576_0280116 Ga0451576_0280116_338_1288 316
251 3300045051 Ga0451576_0284428 Ga0451576_0284428_724_1695 316
252 3300050507 nmdc:mga05p37_11571_c1 nmdc:mga05p37_11571_c1_1700_2650 316
253 3300050515 nmdc:mga0a205_78082_c1 nmdc:mga0a205_78082_c1_528_1478 316
254 3300006844 Ga0075428_100078235 Ga0075428_1000782354 317
255 3300006880 Ga0075429_100027464 Ga0075429_1000274642 317
256 3300028558 Ga0265326_10031609 Ga0265326_100316092 317
257 3300028577 Ga0265318_10003685 Ga0265318_100036854 317
258 3300028800 Ga0265338_10169174 Ga0265338_101691742 317
259 3300031239 Ga0265328_10010510 Ga0265328_100105104 317
260 3300031240 Ga0265320_10020772 Ga0265320_100207723 317
261 3300031247 Ga0265340_10032440 Ga0265340_100324402 317
262 3300031344 Ga0265316_10043335 Ga0265316_100433352 317
263 3300042876 Ga0451577_0052914 Ga0451577_0052914_668_1639 317
264 3300044673 Ga0453683_0000731 Ga0453683_0000731_6011_6964 317
265 3300044673 Ga0453683_0004127 Ga0453683_0004127_947_1900 317
266 3300044712 Ga0453684_0000012 Ga0453684_0000012_359380_360333 317
267 3300045051 Ga0451576_0000853 Ga0451576_0000853_14283_15239 317
268 3300045051 Ga0451576_0152794 Ga0451576_0152794_1256_2209 317
269 3300049589 Ga0501073_0028553 Ga0501073_0028553_1231_2208 317
270 3300049742 Ga0501080_0146397 Ga0501080_0146397_1156_2133 317
271 3300050508 nmdc:mga09592_33667_c1 nmdc:mga09592_33667_c1_917_1885 317
272 3300054114 Ga0501084_0001535 Ga0501084_0001535_7247_8224 317
273 3300003203 JGI25406J46586_10005443 JGI25406J46586_100054433 318
274 3300005295 Ga0065707_10086992 Ga0065707_100869924 318
275 3300005295 Ga0065707_10186339 Ga0065707_101863392 318
276 3300005546 Ga0070696_100143227 Ga0070696_1001432271 318
277 3300005549 Ga0070704_100010604 Ga0070704_1000106044 318
278 3300005985 Ga0081539_10000859 Ga0081539_1000085912 318
279 3300005985 Ga0081539_10005055 Ga0081539_100050557 318
280 3300006847 Ga0075431_100448293 Ga0075431_1004482932 318
281 3300006852 Ga0075433_10056589 Ga0075433_100565892 318
282 3300009148 Ga0105243_10005766 Ga0105243_100057666 318
283 3300031727 Ga0316576_10138174 Ga0316576_101381741 318
284 3300031728 Ga0316578_10221959 Ga0316578_102219591 318
285 3300031733 Ga0316577_10020361 Ga0316577_100203612 318
286 3300031903 Ga0307407_10218099 Ga0307407_102180992 318
287 3300036712 Ga0316584_0006146 Ga0316584_0006146_1142_2131 318
288 3300050515 nmdc:mga0a205_9539_c1 nmdc:mga0a205_9539_c1_5236_6192 318
289 3300005289 Ga0065704_10101351 Ga0065704_101013512 319
290 3300005295 Ga0065707_10085950 Ga0065707_100859505 319
291 3300005340 Ga0070689_100004213 Ga0070689_1000042137 319
292 3300005441 Ga0070700_100012627 Ga0070700_1000126274 319
293 3300005444 Ga0070694_100017812 Ga0070694_1000178122 319
294 3300005937 Ga0081455_10002759 Ga0081455_1000275913 319
295 3300006844 Ga0075428_100027392 Ga0075428_1000273926 319
296 3300006844 Ga0075428_100441121 Ga0075428_1004411212 319
297 3300006847 Ga0075431_100055574 Ga0075431_1000555742 319
298 3300006847 Ga0075431_100245485 Ga0075431_1002454852 319
299 3300006871 Ga0075434_100310349 Ga0075434_1003103492 319
300 3300006880 Ga0075429_100017158 Ga0075429_1000171583 319
301 3300006880 Ga0075429_100042874 Ga0075429_1000428742 319
302 3300009094 Ga0111539_10092543 Ga0111539_100925433 319
303 3300009147 Ga0114129_10005520 Ga0114129_100055201 319
304 3300009147 Ga0114129_10070919 Ga0114129_100709195 319
305 3300009147 Ga0114129_10094338 Ga0114129_100943383 319
306 3300028653 Ga0265323_10007889 Ga0265323_100078892 319
307 3300031731 Ga0307405_10071708 Ga0307405_100717082 319
308 3300035398 Ga0316574_0105345 Ga0316574_0105345_532_1515 319
309 3300042876 Ga0451577_0111148 Ga0451577_0111148_1190_2149 319
310 3300044712 Ga0453684_0016234 Ga0453684_0016234_9067_10026 319
311 3300044712 Ga0453684_0106395 Ga0453684_0106395_2389_3348 319
312 3300045051 Ga0451576_0726175 Ga0451576_0726175_16_975 319
313 3300050507 nmdc:mga05p37_196966_c1 nmdc:mga05p37_196966_c1_866_1825 319
314 3300050507 nmdc:mga05p37_3702_c1 nmdc:mga05p37_3702_c1_64_1023 319
315 3300050510 nmdc:mga06r32_348408_c1 nmdc:mga06r32_348408_c1_170_1144 319
316 3300050511 nmdc:mga08y16_444429_c1 nmdc:mga08y16_444429_c1_142_1101 319
317 3300050515 nmdc:mga0a205_104241_c1 nmdc:mga0a205_104241_c1_1433_2407 319
318 3300054114 Ga0501084_0030072 Ga0501084_0030072_3285_4259 319
319 3300031251 Ga0265327_10066731 Ga0265327_100667312 320
320 3300031665 Ga0316575_10005585 Ga0316575_100055853 320
321 3300036647 Ga0316582_0000232 Ga0316582_0000232_5569_6558 320
322 3300036712 Ga0316584_0004110 Ga0316584_0004110_133_1122 320
323 3300044712 Ga0453684_0112483 Ga0453684_0112483_488_1450 320
324 3300044712 Ga0453684_0540593 Ga0453684_0540593_179_1141 320
325 3300044712 Ga0453684_0000718 Ga0453684_0000718_73028_73996 321
326 3300044712 Ga0453684_0003847 Ga0453684_0003847_13073_14059 321
327 3300005353 Ga0070669_100122083 Ga0070669_1001220832 322
328 3300005457 Ga0070662_100215738 Ga0070662_1002157381 322
329 3300005844 Ga0068862_100322729 Ga0068862_1003227292 322
330 3300009553 Ga0105249_10076596 Ga0105249_100765963 322
331 3300014326 Ga0157380_10075036 Ga0157380_100750362 322
332 3300025935 Ga0207709_10296470 Ga0207709_102964702 322
333 3300025938 Ga0207704_10118883 Ga0207704_101188832 322
334 3300026118 Ga0207675_100023647 Ga0207675_1000236475 322
335 3300028380 Ga0268265_10461109 Ga0268265_104611092 322
336 3300031727 Ga0316576_10165060 Ga0316576_101650602 322
337 3300031728 Ga0316578_10120213 Ga0316578_101202132 322
338 3300031733 Ga0316577_10073962 Ga0316577_100739622 322
339 2162886007 SwRhRL2b_contig_253730 SwRhRL2b_0095.00002900 323
340 3300005289 Ga0065704_10000545 Ga0065704_100005458 323
341 3300005295 Ga0065707_10082082 Ga0065707_100820829 323
342 3300005471 Ga0070698_100109846 Ga0070698_1001098462 323
343 3300050508 nmdc:mga09592_255156_c1 nmdc:mga09592_255156_c1_124_1098 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

113

287

0.98

PF00389

2-Hacid_dh

D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain

10

310

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rj6-assembly1.cif.gz_B crystal structure of phgdh in complex with bi-4924 0.9275 101 308
7va1-assembly1.cif.gz_B crystal structure of human 3-phosphoglycerate dehydrogenase in complex with gdd-04-35 0.9199 106 292
6rj6-assembly1.cif.gz_A crystal structure of phgdh in complex with bi-4924 0.919 106 304
5unn-assembly1.cif.gz_B crystal structure of nadph-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in apo form 0.9165 104 291
6rj6-assembly1.cif.gz_B crystal structure of phgdh in complex with bi-4924 0.9149 101 308
ID Description Score Start End Superfamily
af_Q2FZW9_121_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9716 146 286 3.40.50.720
af_A0A1D6HR89_2_270_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9676 147 176 3.50.50.60
af_Q4CQU6_365_588_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9632 147 176 3.50.50.60
af_Q9VII9_150_293_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9623 146 286 3.40.50.720
af_Q7SZY8_153_293_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9617 147 286 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A661PLZ0-F1-model_v4 Dihydrofolate reductase 0.9959 108 311 GO:0016614
GO:0051287
AF-A0A353H3K0-F1-model_v4 Dihydrofolate reductase 0.9813 86 322 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A661WBD7-F1-model_v4 Dihydrofolate reductase 0.979 55 313 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A7W0G3C9-F1-model_v4 Dihydrofolate reductase 0.9776 130 311 GO:0016614
GO:0051287
AF-A0A3N5M9J6-F1-model_v4 Dihydrofolate reductase 0.9736 1 271 GO:0005829
GO:0016618
GO:0030267
GO:0051287

Feature Viewer

pLDDT pTM Quality
94.49 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map