F415610

General Info

Members Datasets Scaffolds Average Seq Length
343 243 319 268

Family's Representative Sequence

Representative Sequence 3300025940|Ga0207691_10009524|Ga0207691_1000952412
Length 259
Sequence VTGPQRIVCLTEEPTETLYLLGEQDRIVGISGFTVRPAVARREKPKVSAFTSAKIEAILALRPDFAIGFSDIQADIAAELVRRGVEVWISNHRSVDGILDYVRRLGALVHGLEAIEREAAALPRRPKVYFEEWDEPPITGIRWVAELVRIAGGDDIFPERALEPLAKQRILEDPAEVVRRAPDIILGSWCGKKFRPDRVAARPGWDAIPAVRDGELHEIKSPLILQPGPAALTDGVEAIARIVRAWAAKPAQRIAPPGT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
3 2739367700 Dyella sp. YR388 Isolate Unclassified
4 2818991457 Xanthomonas translucens 569 Isolate Unclassified
5 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
6 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
7 2884411467 Dyella sp. AD56 Isolate Rhizosphere
8 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
9 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
10 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
11 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
12 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
13 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
14 2919513703 Luteimonas sp. 3794 Isolate Unclassified
15 2919675420 Luteimonas terrae 4099 Isolate Unclassified
16 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
17 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
18 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
19 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
22 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
23 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
24 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
25 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
26 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
27 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
28 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
29 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
30 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
84 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
88 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
93 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
95 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
96 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
153 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
154 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
155 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
156 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
169 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
170 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
171 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
172 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
175 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
176 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
177 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
178 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
185 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
186 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
187 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
188 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
195 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
196 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
197 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
234 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
235 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
236 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
237 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
238 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
239 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
240 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
241 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
242 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
243 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.71
Metatranscriptomes 0.29
Isolates 7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.49
Nodule 0
Rhizoplane 4.96
Rhizosphere 66.76
Stem 0
Stem Tuber 0
Unclassified 10.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_776419 2162886007 Bacteria 5652
2 JGI24737J22298_10017015 3300001990 Bacteria 2344
3 JGI24738J21930_10016475 3300002075 Bacteria 1561
4 JGI25154J39366_1007672 3300002738 Bacteria 1453
5 JGI25157J39369_1001600 3300002741 Bacteria 7927
6 JGI25163J39215_1000768 3300002771 Bacteria 7895
7 JGI25164J39214_1001075 3300002772 Bacteria 8060
8 JGI25151J46595_10027378 3300003187 Bacteria 2286
9 JGI25165J46597_1001043 3300003214 Bacteria 18071
10 Ga0055538_1002162 3300003751 Bacteria 3066
11 Ga0055535_1001446 3300003761 Bacteria 12051
12 Ga0055542_1001002 3300003762 Bacteria 18071
13 Ga0055529_1001324 3300003763 Bacteria 8330
14 Ga0055524_1007989 3300003775 Bacteria 4439
15 Ga0055524_1009891 3300003775 Bacteria 3838
16 Ga0055536_1011054 3300003781 Bacteria 3508
17 Ga0055536_1027625 3300003781 Bacteria 1563
18 Ga0055530_10001430 3300003791 Bacteria 17478
19 Ga0055531_10004914 3300003794 Bacteria 7951
20 Ga0055531_10017766 3300003794 Bacteria 2979
21 Ga0055531_10034722 3300003794 Bacteria 1594
22 Ga0065704_10070982 3300005289 Bacteria 14069
23 Ga0065704_10073102 3300005289 Bacteria 7584
24 Ga0065715_10192895 3300005293 Bacteria 1404
25 Ga0070670_100070880 3300005331 Bacteria 2992
26 Ga0070666_10213095 3300005335 Bacteria 1361
27 Ga0070682_100244240 3300005337 Bacteria 1290
28 Ga0070689_100002814 3300005340 Bacteria 11436
29 Ga0070669_100111708 3300005353 Bacteria 2074
30 Ga0070671_100079101 3300005355 Bacteria 2748
31 Ga0070671_100080165 3300005355 Bacteria 2729
32 Ga0070667_100021268 3300005367 Bacteria 5390
33 Ga0070711_100001477 3300005439 Bacteria 12920
34 Ga0070678_100040237 3300005456 Bacteria 3306
35 Ga0068867_100081032 3300005459 Bacteria 2446
36 Ga0070706_100103662 3300005467 Bacteria 2645
37 Ga0070698_100177058 3300005471 Bacteria 2072
38 Ga0070698_100414651 3300005471 Bacteria 1281
39 Ga0070699_100463828 3300005518 Bacteria 1149
40 Ga0068853_100145258 3300005539 Bacteria 2131
41 Ga0070672_100001446 3300005543 Bacteria 14690
42 Ga0070672_100004048 3300005543 Bacteria 9567
43 Ga0070672_100186948 3300005543 Bacteria 1728
44 Ga0068855_100013929 3300005563 Bacteria 9698
45 Ga0070664_100226726 3300005564 Bacteria 1674
46 Ga0068854_100419572 3300005578 Bacteria 1111
47 Ga0068856_100029686 3300005614 Bacteria 5341
48 Ga0070702_100361371 3300005615 Bacteria 1026
49 Ga0068852_100022930 3300005616 Bacteria 5016
50 Ga0068859_100037834 3300005617 Bacteria 4842
51 Ga0068859_100301045 3300005617 Bacteria 1697
52 Ga0068864_100297718 3300005618 Bacteria 1509
53 Ga0068864_100559959 3300005618 Bacteria 1106
54 Ga0068858_100305654 3300005842 Bacteria 1518
55 Ga0068860_100080510 3300005843 Bacteria 3097
56 Ga0068860_100397697 3300005843 Bacteria 1363
57 Ga0068862_100086124 3300005844 Bacteria 2731
58 Ga0081540_1001157 3300005983 Bacteria 23238
59 Ga0075364_10000206 3300006051 Bacteria 27651
60 Ga0075364_10027798 3300006051 Bacteria 3616
61 Ga0097621_100129528 3300006237 Bacteria 2146
62 Ga0097621_100168063 3300006237 Bacteria 1889
63 Ga0075434_100237178 3300006871 Bacteria 1844
64 Ga0097620_100037832 3300006931 Bacteria 4842
65 Ga0097620_100301066 3300006931 Bacteria 1697
66 Ga0105251_10000013 3300009011 Bacteria 163226
67 Ga0105240_10028456 3300009093 Bacteria 7299
68 Ga0105240_10132898 3300009093 Bacteria 2982
69 Ga0105240_10217842 3300009093 Bacteria 2226
70 Ga0105240_10256764 3300009093 Bacteria 2018
71 Ga0111539_10532909 3300009094 Bacteria 1368
72 Ga0105243_10022444 3300009148 Bacteria 4797
73 Ga0105242_10059243 3300009176 Bacteria 3141
74 Ga0105248_10547356 3300009177 Bacteria 1305
75 Ga0105237_10123757 3300009545 Bacteria 2581
76 Ga0105237_10230512 3300009545 Bacteria 1853
77 Ga0105238_10010067 3300009551 Bacteria 9484
78 Ga0105238_10068568 3300009551 Bacteria 3548
79 Ga0105028_101076 3300009993 Bacteria 2887
80 Ga0105239_10034175 3300010375 Bacteria 5582
81 Ga0157370_10005515 3300013104 Bacteria 14180
82 Ga0157370_10018157 3300013104 Bacteria 7079
83 Ga0157369_10153366 3300013105 Bacteria 2434
84 Ga0157372_10004055 3300013307 Bacteria 15698
85 Ga0157372_10179404 3300013307 Bacteria 2451
86 Ga0157372_10251293 3300013307 Bacteria 2052
87 Ga0157380_10176023 3300014326 Bacteria 1875
88 Ga0157376_10050961 3300014969 Bacteria 3436
89 Ga0182006_1003130 3300015261 Bacteria 8659
90 Ga0182005_1003457 3300015265 Bacteria 5355
91 Ga0163161_10221075 3300017792 Bacteria 1466
92 Ga0213872_10000051 3300021361 Bacteria 107261
93 Ga0209435_103415 3300025206 Bacteria 1817
94 Ga0209784_100422 3300025224 Bacteria 18592
95 Ga0209674_100012 3300025226 Bacteria 950162
96 Ga0209672_101049 3300025228 Bacteria 11868
97 Ga0207427_100179 3300025231 Bacteria 67665
98 Ga0209437_100099 3300025233 Bacteria 229500
99 Ga0209437_102084 3300025233 Bacteria 4059
100 Ga0209258_100119 3300025242 Bacteria 183554
101 Ga0209258_101510 3300025242 Bacteria 7889
102 Ga0207425_1002589 3300025245 Bacteria 6280
103 Ga0209646_1001182 3300025246 Bacteria 7580
104 Ga0209026_1000276 3300025250 Bacteria 60964
105 Ga0209148_1000036 3300025254 Bacteria 530505
106 Ga0209759_1002497 3300025256 Bacteria 8025
107 Ga0209759_1004605 3300025256 Bacteria 5081
108 Ga0209233_1000040 3300025261 Bacteria 530395
109 Ga0209455_1000164 3300025272 Bacteria 114011
110 Ga0209673_1002228 3300025273 Bacteria 14062
111 Ga0209675_1009686 3300025291 Bacteria 3378
112 Ga0209676_1000027 3300025292 Bacteria 560222
113 Ga0209676_1002289 3300025292 Bacteria 13976
114 Ga0209676_1002836 3300025292 Bacteria 11460
115 Ga0209676_1005995 3300025292 Bacteria 6138
116 Ga0209676_1006110 3300025292 Bacteria 6045
117 Ga0209025_1000023 3300025294 Bacteria 541307
118 Ga0209025_1002559 3300025294 Bacteria 18956
119 Ga0209564_1011251 3300025295 Bacteria 4028
120 Ga0209758_1004219 3300025297 Bacteria 12172
121 Ga0209758_1015795 3300025297 Bacteria 3883
122 Ga0209050_1004595 3300025298 Bacteria 9241
123 Ga0209050_1027075 3300025298 Bacteria 1900
124 Ga0209256_1001931 3300025299 Bacteria 18905
125 Ga0209256_1001968 3300025299 Bacteria 18535
126 Ga0209051_1021291 3300025303 Bacteria 2765
127 Ga0209257_1000378 3300025304 Bacteria 88945
128 Ga0209257_1000623 3300025304 Bacteria 57092
129 Ga0209257_1001559 3300025304 Bacteria 26504
130 Ga0209257_1002172 3300025304 Bacteria 20325
131 Ga0209257_1003245 3300025304 Bacteria 14283
132 Ga0209257_1016938 3300025304 Bacteria 2906
133 Ga0209257_1022319 3300025304 Bacteria 2261
134 Ga0207713_1000262 3300025735 Bacteria 64928
135 Ga0207680_10034925 3300025903 Bacteria 2881
136 Ga0207647_10052007 3300025904 Bacteria 2529
137 Ga0207684_10082247 3300025910 Bacteria 2742
138 Ga0207707_10072979 3300025912 Bacteria 2992
139 Ga0207695_10000359 3300025913 Bacteria 104462
140 Ga0207695_10024339 3300025913 Bacteria 6816
141 Ga0207695_10267952 3300025913 Bacteria 1604
142 Ga0207671_10032980 3300025914 Bacteria 3855
143 Ga0207663_10012962 3300025916 Bacteria 4521
144 Ga0207657_10004311 3300025919 Bacteria 15074
145 Ga0207649_10005176 3300025920 Bacteria 7045
146 Ga0207649_10063825 3300025920 Bacteria 2327
147 Ga0207649_10069259 3300025920 Bacteria 2246
148 Ga0207681_10005529 3300025923 Bacteria 7762
149 Ga0207694_10040507 3300025924 Bacteria 3587
150 Ga0207694_10074834 3300025924 Bacteria 2651
151 Ga0207650_10397614 3300025925 Bacteria 1140
152 Ga0207659_10250900 3300025926 Bacteria 1436
153 Ga0207644_10014368 3300025931 Bacteria 5296
154 Ga0207644_10020013 3300025931 Bacteria 4546
155 Ga0207686_10167602 3300025934 Bacteria 1546
156 Ga0207686_10226091 3300025934 Bacteria 1354
157 Ga0207709_10002657 3300025935 Bacteria 11091
158 Ga0207670_10000951 3300025936 Bacteria 15281
159 Ga0207670_10411110 3300025936 Bacteria 1084
160 Ga0207691_10009524 3300025940 Bacteria 9327
161 Ga0207711_10675672 3300025941 Bacteria 963
162 Ga0207667_10006234 3300025949 Bacteria 14473
163 Ga0207667_10579695 3300025949 Bacteria 1133
164 Ga0207712_10128984 3300025961 Bacteria 1924
165 Ga0207668_10037848 3300025972 Bacteria 3233
166 Ga0207640_10013824 3300025981 Bacteria 4635
167 Ga0207640_10302137 3300025981 Bacteria 1266
168 Ga0207639_10000258 3300026041 Bacteria 38476
169 Ga0207678_10387005 3300026067 Bacteria 1209
170 Ga0207702_10001632 3300026078 Bacteria 22176
171 Ga0207702_10095591 3300026078 Bacteria 2611
172 Ga0207641_10007470 3300026088 Bacteria 9094
173 Ga0207641_10604624 3300026088 Bacteria 1074
174 Ga0207648_10063096 3300026089 Bacteria 3230
175 Ga0207676_10004311 3300026095 Bacteria 10061
176 Ga0207676_10223568 3300026095 Bacteria 1678
177 Ga0207675_100333059 3300026118 Bacteria 1484
178 Ga0207683_10004646 3300026121 Bacteria 11836
179 Ga0207683_10010121 3300026121 Bacteria 8046
180 Ga0207683_10050072 3300026121 Bacteria 3658
181 Ga0207683_10226890 3300026121 Bacteria 1703
182 Ga0207698_10013989 3300026142 Bacteria 5316
183 Ga0209969_1003645 3300027360 Bacteria 2135
184 Ga0209995_1002391 3300027471 Bacteria 2959
185 Ga0209982_1006238 3300027552 Bacteria 1732
186 Ga0209983_1000791 3300027665 Bacteria 6879
187 Ga0265354_1001853 3300028016 Bacteria 2839
188 Ga0268266_10000013 3300028379 Bacteria 649715
189 Ga0268266_10105710 3300028379 Bacteria 2488
190 Ga0268265_10030559 3300028380 Bacteria 3881
191 Ga0268265_10170068 3300028380 Bacteria 1862
192 Ga0268265_10804601 3300028380 Bacteria 916
193 Ga0268264_10045816 3300028381 Bacteria 3632
194 Ga0268264_10478038 3300028381 Bacteria 1211
195 Ga0316177_1082712 3300030731 Bacteria 2130
196 Ga0316176_1179031 3300030732 Bacteria 2190
197 Ga0316178_1137788 3300030735 Bacteria 2257
198 Ga0316182_1310129 3300030745 Bacteria 2951
199 Ga0265770_1000003 3300030878 Bacteria 24227
200 Ga0307513_10000456 3300031456 Bacteria 58897
201 Ga0307509_10061535 3300031507 Bacteria 3962
202 Ga0307413_10000233 3300031824 Bacteria 16508
203 Ga0307413_10085069 3300031824 Bacteria 2041
204 Ga0307412_10000665 3300031911 Bacteria 19930
205 Ga0307414_10006683 3300032004 Bacteria 6450
206 Ga0307414_10023925 3300032004 Bacteria 3884
207 Ga0307414_10050684 3300032004 Bacteria 2877
208 Ga0307414_10097394 3300032004 Bacteria 2203
209 Ga0307414_10136766 3300032004 Bacteria 1912
210 Ga0307414_10368310 3300032004 Bacteria 1238
211 Ga0307411_10092923 3300032005 Bacteria 2111
212 Ga0307415_100177474 3300032126 Bacteria 1668
213 Ga0373923_0130415 3300035111 Bacteria 1129
214 Ga0395899_0318358 3300037312 Bacteria 1048
215 Ga0395900_0000651 3300037418 Bacteria 46429
216 Ga0395900_0007702 3300037418 Bacteria 11106
217 Ga0436361_0736443 3300039447 Bacteria 20202
218 Ga0436361_1154293 3300039447 Bacteria 36752
219 Ga0439436_0000140 3300041404 Bacteria 16548
220 Ga0439436_0035232 3300041404 Bacteria 1446
221 Ga0439465_0009676 3300041413 Bacteria 3037
222 Ga0439465_0127770 3300041413 Bacteria 895
223 Ga0451791_0624506 3300041451 Bacteria 931
224 Ga0451800_0548804 3300041459 Bacteria 3717
225 Ga0451843_1759941 3300041509 Bacteria 1677
226 Ga0451853_0944584 3300041512 Bacteria 1545
227 Ga0439432_019005 3300042006 Bacteria 2293
228 Ga0439432_040803 3300042006 Bacteria 1471
229 Ga0439449_0013275 3300042007 Bacteria 3099
230 Ga0439449_0029611 3300042007 Bacteria 2040
231 Ga0439449_0077995 3300042007 Bacteria 1221
232 Ga0439452_059367 3300042010 Bacteria 860
233 Ga0439462_0012465 3300042015 Bacteria 2173
234 Ga0450897_004446 3300042128 Bacteria 1173
235 Ga0466972_0001275 3300044658 Bacteria 12158
236 Ga0466961_0306373 3300044693 Bacteria 970
237 Ga0495638_0000295 3300046460 Bacteria 64957
238 Ga0495638_0001233 3300046460 Bacteria 24188
239 Ga0495650_0000466 3300046471 Bacteria 62626
240 Ga0495606_0000016 3300046507 Bacteria 284865
241 Ga0495610_0007925 3300046512 Bacteria 6973
242 Ga0495616_0031329 3300046513 Bacteria 2785
243 Ga0495663_0001115 3300046525 Bacteria 8669
244 Ga0495654_0077425 3300046530 Bacteria 1565
245 Ga0495621_0036067 3300046539 Bacteria 1715
246 Ga0495621_0052383 3300046539 Bacteria 1463
247 Ga0495622_0052947 3300046557 Bacteria 1883
248 Ga0495656_0037252 3300046615 Bacteria 2008
249 Ga0495625_0016346 3300046660 Bacteria 5843
250 Ga0495625_0256508 3300046660 Bacteria 1133
251 Ga0495659_0017203 3300046664 Bacteria 2393
252 Ga0495659_0030240 3300046664 Bacteria 1884
253 Ga0495670_0000403 3300046691 Bacteria 20721
254 Ga0495649_0000228 3300046694 Bacteria 49043
255 Ga0495649_0031604 3300046694 Bacteria 2918
256 Ga0495636_0000475 3300047318 Bacteria 14776
257 Ga0495636_0028504 3300047318 Bacteria 2278
258 Ga0495685_039705 3300047447 Bacteria 1611
259 Ga0495615_0034784 3300048090 Bacteria 1228
260 Ga0496100_0040665 3300048903 Bacteria 2960
261 Ga0496100_0463069 3300048903 Bacteria 973
262 Ga0496101_0065307 3300048904 Bacteria 2653
263 Ga0496104_0006323 3300048907 Bacteria 10419
264 Ga0496105_0001376 3300048908 Bacteria 17099
265 Ga0496108_0022219 3300048911 Bacteria 5216
266 Ga0496109_0010566 3300048912 Bacteria 7894
267 Ga0496112_0072650 3300048915 Bacteria 3400
268 Ga0496113_0026001 3300048916 Bacteria 4181
269 Ga0496114_0001240 3300048917 Bacteria 19296
270 Ga0496114_0011002 3300048917 Bacteria 7214
271 Ga0496115_0000114 3300048918 Bacteria 73307
272 Ga0496115_0002199 3300048918 Bacteria 13961
273 Ga0496115_0015302 3300048918 Bacteria 5817
274 Ga0496115_0031106 3300048918 Bacteria 4203
275 Ga0496117_0019351 3300048920 Bacteria 5597
276 Ga0496117_0099758 3300048920 Bacteria 1841
277 Ga0496118_0000264 3300048921 Bacteria 91882
278 Ga0496118_0012446 3300048921 Bacteria 8164
279 Ga0496118_0082528 3300048921 Bacteria 2251
280 Ga0496119_0001652 3300048922 Bacteria 26251
281 Ga0496120_0001598 3300048923 Bacteria 26334
282 Ga0496122_0000566 3300048925 Bacteria 75845
283 Ga0496122_0006815 3300048925 Bacteria 12958
284 Ga0496122_0026798 3300048925 Bacteria 4953
285 Ga0496123_0000324 3300048926 Bacteria 91012
286 Ga0496123_0007877 3300048926 Bacteria 9903
287 Ga0496124_0001943 3300048927 Bacteria 28267
288 Ga0496126_0003693 3300048929 Bacteria 19116
289 Ga0496126_0008816 3300048929 Bacteria 10816
290 Ga0496126_0015681 3300048929 Bacteria 7613
291 Ga0496126_0024412 3300048929 Bacteria 5838
292 Ga0496126_0052444 3300048929 Bacteria 3706
293 Ga0495682_0027600 3300049460 Bacteria 2105
294 Ga0501033_0005592 3300049570 Bacteria 9932
295 Ga0501034_0000817 3300049571 Bacteria 46294
296 Ga0501034_0027414 3300049571 Bacteria 5793
297 Ga0501034_0262714 3300049571 Bacteria 1669
298 Ga0501037_0003481 3300049573 Bacteria 11423
299 Ga0501038_0013201 3300049574 Bacteria 7533
300 Ga0501047_0253976 3300049581 Bacteria 1606
301 Ga0501071_0046271 3300049587 Bacteria 3125
302 Ga0501071_0237665 3300049587 Bacteria 1373
303 Ga0501072_0091818 3300049588 Bacteria 2411
304 Ga0501072_0608286 3300049588 Bacteria 861
305 Ga0501074_0119211 3300049590 Bacteria 1887
306 Ga0501075_0188033 3300049591 Bacteria 1575
307 Ga0501075_0260485 3300049591 Bacteria 1322
308 Ga0501076_0231604 3300049592 Bacteria 1510
309 Ga0501080_0143522 3300049742 Bacteria 2207
310 Ga0501081_0363105 3300049743 Bacteria 1068
311 Ga0501035_0019380 3300049822 Bacteria 6258
312 Ga0501044_0005344 3300049823 Bacteria 14277
313 nmdc:mga00v17_118_c1 3300050491 Bacteria 46536
314 nmdc:mga00v17_71718_c1 3300050491 Bacteria 2148
315 nmdc:mga0n895_444311_c1 3300050512 Bacteria 1310
316 Ga0500643_004501 3300053087 Bacteria 6277
317 Ga0500651_0000135 3300053093 Bacteria 45998
318 Ga0500597_000037 3300053120 Bacteria 26711
319 Ga0500568_0000433 3300053139 Bacteria 31437

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_100414651 Ga0070698_1004146512 249
2 3300028379 Ga0268266_10105710 Ga0268266_101057103 249
3 3300039447 Ga0436361_0736443 Ga0436361_0736443_12618_13367 249
4 3300005543 Ga0070672_100001446 Ga0070672_10000144612 250
5 3300025940 Ga0207691_10009524 Ga0207691_1000952412 250
6 3300044693 Ga0466961_0306373 Ga0466961_0306373_161_934 256
7 iso_pu_bacteria 2818991457 2819660732 259
8 iso_pu_bacteria 2852684882 2852686601 259
9 iso_pu_bacteria 2919130084 2919132657 259
10 iso_pu_bacteria 2929195423 2929196827 259
11 3300041512 Ga0451853_0944584 Ga0451853_0944584_315_1100 260
12 iso_pu_bacteria 2894414249 2894417205 260
13 iso_pu_bacteria 2895498888 2895499357 260
14 iso_pu_bacteria 2895511927 2895512377 260
15 iso_pu_bacteria 2895522137 2895522389 260
16 iso_pu_bacteria 2895525241 2895525841 260
17 iso_pu_bacteria 2919675420 2919678250 260
18 iso_pu_bacteria 2923516293 2923517513 260
19 3300006237 Ga0097621_100168063 Ga0097621_1001680632 261
20 iso_pu_bacteria 2643221581 2643913457 261
21 iso_pu_bacteria 640427133 640487250 261
22 iso_pu_bacteria 651053060 651175195 261
23 iso_pu_bacteria 8002869464 8002869715 261
24 iso_pu_bacteria 8003014200 8003016770 261
25 3300005337 Ga0070682_100244240 Ga0070682_1002442402 262
26 3300005578 Ga0068854_100419572 Ga0068854_1004195722 262
27 3300005615 Ga0070702_100361371 Ga0070702_1003613712 262
28 3300005616 Ga0068852_100022930 Ga0068852_1000229302 262
29 3300005983 Ga0081540_1001157 Ga0081540_10011575 262
30 3300006871 Ga0075434_100237178 Ga0075434_1002371782 262
31 3300009093 Ga0105240_10256764 Ga0105240_102567641 262
32 3300013104 Ga0157370_10005515 Ga0157370_100055152 262
33 3300025913 Ga0207695_10267952 Ga0207695_102679521 262
34 3300025981 Ga0207640_10013824 Ga0207640_100138243 262
35 3300025981 Ga0207640_10302137 Ga0207640_103021372 262
36 3300026142 Ga0207698_10013989 Ga0207698_100139892 262
37 3300046664 Ga0495659_0017203 Ga0495659_0017203_182_970 262
38 3300047318 Ga0495636_0028504 Ga0495636_0028504_1221_2009 262
39 3300048090 Ga0495615_0034784 Ga0495615_0034784_11_799 262
40 3300049587 Ga0501071_0237665 Ga0501071_0237665_103_894 262
41 3300049588 Ga0501072_0608286 Ga0501072_0608286_20_811 262
42 3300049591 Ga0501075_0260485 Ga0501075_0260485_293_1084 262
43 3300049592 Ga0501076_0231604 Ga0501076_0231604_677_1468 262
44 3300049743 Ga0501081_0363105 Ga0501081_0363105_37_828 262
45 3300050512 nmdc:mga0n895_444311_c1 nmdc:mga0n895_444311_c1_225_1055 262
46 3300053093 Ga0500651_0000135 Ga0500651_0000135_793_1596 262
47 iso_pu_bacteria 2919513703 2919515232 262
48 3300003187 JGI25151J46595_10027378 JGI25151J46595_100273783 263
49 3300003775 Ga0055524_1007989 Ga0055524_10079895 263
50 3300003775 Ga0055524_1009891 Ga0055524_10098914 263
51 3300003791 Ga0055530_10001430 Ga0055530_1000143017 263
52 3300003794 Ga0055531_10017766 Ga0055531_100177664 263
53 3300005289 Ga0065704_10073102 Ga0065704_1007310210 263
54 3300005331 Ga0070670_100070880 Ga0070670_1000708803 263
55 3300005439 Ga0070711_100001477 Ga0070711_1000014774 263
56 3300005456 Ga0070678_100040237 Ga0070678_1000402372 263
57 3300005614 Ga0068856_100029686 Ga0068856_1000296865 263
58 3300005617 Ga0068859_100037834 Ga0068859_1000378343 263
59 3300005618 Ga0068864_100559959 Ga0068864_1005599591 263
60 3300006931 Ga0097620_100037832 Ga0097620_1000378325 263
61 3300009011 Ga0105251_10000013 Ga0105251_10000013142 263
62 3300009093 Ga0105240_10028456 Ga0105240_100284567 263
63 3300009148 Ga0105243_10022444 Ga0105243_100224442 263
64 3300013104 Ga0157370_10018157 Ga0157370_100181572 263
65 3300013307 Ga0157372_10179404 Ga0157372_101794043 263
66 3300017792 Ga0163161_10221075 Ga0163161_102210751 263
67 3300025273 Ga0209673_1002228 Ga0209673_100222810 263
68 3300025291 Ga0209675_1009686 Ga0209675_10096863 263
69 3300025292 Ga0209676_1002289 Ga0209676_100228915 263
70 3300025292 Ga0209676_1005995 Ga0209676_10059953 263
71 3300025294 Ga0209025_1002559 Ga0209025_10025596 263
72 3300025295 Ga0209564_1011251 Ga0209564_10112513 263
73 3300025297 Ga0209758_1004219 Ga0209758_10042194 263
74 3300025298 Ga0209050_1004595 Ga0209050_10045955 263
75 3300025299 Ga0209256_1001931 Ga0209256_10019315 263
76 3300025299 Ga0209256_1001968 Ga0209256_100196816 263
77 3300025303 Ga0209051_1021291 Ga0209051_10212913 263
78 3300025304 Ga0209257_1001559 Ga0209257_10015596 263
79 3300025304 Ga0209257_1003245 Ga0209257_100324515 263
80 3300025304 Ga0209257_1016938 Ga0209257_10169383 263
81 3300025304 Ga0209257_1022319 Ga0209257_10223193 263
82 3300025735 Ga0207713_1000262 Ga0207713_100026258 263
83 3300025912 Ga0207707_10072979 Ga0207707_100729794 263
84 3300025913 Ga0207695_10024339 Ga0207695_100243393 263
85 3300025916 Ga0207663_10012962 Ga0207663_100129625 263
86 3300025920 Ga0207649_10063825 Ga0207649_100638253 263
87 3300025934 Ga0207686_10167602 Ga0207686_101676021 263
88 3300025935 Ga0207709_10002657 Ga0207709_100026572 263
89 3300025949 Ga0207667_10579695 Ga0207667_105796952 263
90 3300025961 Ga0207712_10128984 Ga0207712_101289842 263
91 3300025972 Ga0207668_10037848 Ga0207668_100378482 263
92 3300026078 Ga0207702_10001632 Ga0207702_1000163214 263
93 3300026078 Ga0207702_10095591 Ga0207702_100955913 263
94 3300026088 Ga0207641_10007470 Ga0207641_100074704 263
95 3300026095 Ga0207676_10004311 Ga0207676_100043112 263
96 3300026095 Ga0207676_10223568 Ga0207676_102235681 263
97 3300026121 Ga0207683_10004646 Ga0207683_100046467 263
98 3300026121 Ga0207683_10010121 Ga0207683_100101212 263
99 3300026121 Ga0207683_10050072 Ga0207683_100500722 263
100 3300028379 Ga0268266_10000013 Ga0268266_1000001392 263
101 3300028381 Ga0268264_10045816 Ga0268264_100458165 263
102 3300035111 Ga0373923_0130415 Ga0373923_0130415_272_1072 263
103 3300037312 Ga0395899_0318358 Ga0395899_0318358_120_917 263
104 3300037418 Ga0395900_0000651 Ga0395900_0000651_18731_19528 263
105 3300037418 Ga0395900_0007702 Ga0395900_0007702_2164_2961 263
106 3300041459 Ga0451800_0548804 Ga0451800_0548804_2529_3320 263
107 3300042006 Ga0439432_040803 Ga0439432_040803_391_1182 263
108 3300042007 Ga0439449_0013275 Ga0439449_0013275_1342_2133 263
109 3300046539 Ga0495621_0052383 Ga0495621_0052383_262_1053 263
110 3300046664 Ga0495659_0030240 Ga0495659_0030240_19_810 263
111 3300047318 Ga0495636_0000475 Ga0495636_0000475_7504_8295 263
112 3300047447 Ga0495685_039705 Ga0495685_039705_320_1117 263
113 3300048903 Ga0496100_0040665 Ga0496100_0040665_504_1304 263
114 3300048904 Ga0496101_0065307 Ga0496101_0065307_284_1084 263
115 3300048907 Ga0496104_0006323 Ga0496104_0006323_8516_9316 263
116 3300048908 Ga0496105_0001376 Ga0496105_0001376_11198_11998 263
117 3300048917 Ga0496114_0011002 Ga0496114_0011002_285_1085 263
118 3300048920 Ga0496117_0019351 Ga0496117_0019351_2036_2827 263
119 3300048921 Ga0496118_0012446 Ga0496118_0012446_3407_4198 263
120 3300048921 Ga0496118_0082528 Ga0496118_0082528_844_1635 263
121 3300048922 Ga0496119_0001652 Ga0496119_0001652_23299_24090 263
122 3300048923 Ga0496120_0001598 Ga0496120_0001598_23382_24173 263
123 3300048925 Ga0496122_0000566 Ga0496122_0000566_23625_24416 263
124 3300048925 Ga0496122_0026798 Ga0496122_0026798_4106_4909 263
125 3300048926 Ga0496123_0000324 Ga0496123_0000324_81172_81963 263
126 3300048927 Ga0496124_0001943 Ga0496124_0001943_21129_21920 263
127 iso_pu_bacteria 2842918807 2842921504 263
128 iso_pu_bacteria 2953994433 2953997492 263
129 2162886007 SwRhRL2b_contig_776419 SwRhRL2b_0161.00001710 264
130 3300001990 JGI24737J22298_10017015 JGI24737J22298_100170154 264
131 3300002075 JGI24738J21930_10016475 JGI24738J21930_100164751 264
132 3300002738 JGI25154J39366_1007672 JGI25154J39366_10076722 264
133 3300002741 JGI25157J39369_1001600 JGI25157J39369_100160011 264
134 3300002771 JGI25163J39215_1000768 JGI25163J39215_100076811 264
135 3300002772 JGI25164J39214_1001075 JGI25164J39214_100107511 264
136 3300003214 JGI25165J46597_1001043 JGI25165J46597_100104319 264
137 3300003751 Ga0055538_1002162 Ga0055538_10021621 264
138 3300003761 Ga0055535_1001446 Ga0055535_10014461 264
139 3300003762 Ga0055542_1001002 Ga0055542_100100219 264
140 3300003763 Ga0055529_1001324 Ga0055529_100132412 264
141 3300003781 Ga0055536_1011054 Ga0055536_10110545 264
142 3300003781 Ga0055536_1027625 Ga0055536_10276251 264
143 3300003794 Ga0055531_10004914 Ga0055531_100049144 264
144 3300003794 Ga0055531_10034722 Ga0055531_100347222 264
145 3300005289 Ga0065704_10070982 Ga0065704_1007098213 264
146 3300005293 Ga0065715_10192895 Ga0065715_101928952 264
147 3300005335 Ga0070666_10213095 Ga0070666_102130952 264
148 3300005340 Ga0070689_100002814 Ga0070689_10000281410 264
149 3300005353 Ga0070669_100111708 Ga0070669_1001117082 264
150 3300005355 Ga0070671_100079101 Ga0070671_1000791011 264
151 3300005355 Ga0070671_100080165 Ga0070671_1000801654 264
152 3300005367 Ga0070667_100021268 Ga0070667_1000212683 264
153 3300005459 Ga0068867_100081032 Ga0068867_1000810322 264
154 3300005467 Ga0070706_100103662 Ga0070706_1001036622 264
155 3300005471 Ga0070698_100177058 Ga0070698_1001770582 264
156 3300005518 Ga0070699_100463828 Ga0070699_1004638281 264
157 3300005539 Ga0068853_100145258 Ga0068853_1001452582 264
158 3300005543 Ga0070672_100004048 Ga0070672_1000040486 264
159 3300005543 Ga0070672_100186948 Ga0070672_1001869482 264
160 3300005563 Ga0068855_100013929 Ga0068855_10001392910 264
161 3300005564 Ga0070664_100226726 Ga0070664_1002267262 264
162 3300005617 Ga0068859_100301045 Ga0068859_1003010452 264
163 3300005618 Ga0068864_100297718 Ga0068864_1002977182 264
164 3300005842 Ga0068858_100305654 Ga0068858_1003056543 264
165 3300005843 Ga0068860_100080510 Ga0068860_1000805102 264
166 3300005843 Ga0068860_100397697 Ga0068860_1003976972 264
167 3300005844 Ga0068862_100086124 Ga0068862_1000861241 264
168 3300006051 Ga0075364_10000206 Ga0075364_100002068 264
169 3300006051 Ga0075364_10027798 Ga0075364_100277984 264
170 3300006237 Ga0097621_100129528 Ga0097621_1001295282 264
171 3300006931 Ga0097620_100301066 Ga0097620_1003010662 264
172 3300009093 Ga0105240_10132898 Ga0105240_101328982 264
173 3300009093 Ga0105240_10217842 Ga0105240_102178421 264
174 3300009094 Ga0111539_10532909 Ga0111539_105329092 264
175 3300009176 Ga0105242_10059243 Ga0105242_100592432 264
176 3300009177 Ga0105248_10547356 Ga0105248_105473561 264
177 3300009545 Ga0105237_10123757 Ga0105237_101237572 264
178 3300009545 Ga0105237_10230512 Ga0105237_102305122 264
179 3300009551 Ga0105238_10010067 Ga0105238_100100673 264
180 3300009551 Ga0105238_10068568 Ga0105238_100685684 264
181 3300009993 Ga0105028_101076 Ga0105028_1010762 264
182 3300010375 Ga0105239_10034175 Ga0105239_100341756 264
183 3300013105 Ga0157369_10153366 Ga0157369_101533663 264
184 3300013307 Ga0157372_10004055 Ga0157372_1000405517 264
185 3300013307 Ga0157372_10251293 Ga0157372_102512931 264
186 3300014326 Ga0157380_10176023 Ga0157380_101760232 264
187 3300014969 Ga0157376_10050961 Ga0157376_100509617 264
188 3300015261 Ga0182006_1003130 Ga0182006_100313011 264
189 3300015265 Ga0182005_1003457 Ga0182005_10034574 264
190 3300021361 Ga0213872_10000051 Ga0213872_1000005187 264
191 3300025206 Ga0209435_103415 Ga0209435_1034153 264
192 3300025224 Ga0209784_100422 Ga0209784_10042219 264
193 3300025226 Ga0209674_100012 Ga0209674_100012193 264
194 3300025228 Ga0209672_101049 Ga0209672_1010493 264
195 3300025231 Ga0207427_100179 Ga0207427_10017960 264
196 3300025233 Ga0209437_100099 Ga0209437_10009991 264
197 3300025233 Ga0209437_102084 Ga0209437_1020844 264
198 3300025242 Ga0209258_100119 Ga0209258_10011961 264
199 3300025242 Ga0209258_101510 Ga0209258_10151010 264
200 3300025245 Ga0207425_1002589 Ga0207425_10025893 264
201 3300025246 Ga0209646_1001182 Ga0209646_100118211 264
202 3300025250 Ga0209026_1000276 Ga0209026_10002761 264
203 3300025254 Ga0209148_1000036 Ga0209148_1000036360 264
204 3300025256 Ga0209759_1002497 Ga0209759_100249711 264
205 3300025256 Ga0209759_1004605 Ga0209759_10046053 264
206 3300025261 Ga0209233_1000040 Ga0209233_1000040358 264
207 3300025272 Ga0209455_1000164 Ga0209455_100016491 264
208 3300025292 Ga0209676_1000027 Ga0209676_1000027233 264
209 3300025292 Ga0209676_1002836 Ga0209676_10028365 264
210 3300025292 Ga0209676_1006110 Ga0209676_10061105 264
211 3300025294 Ga0209025_1000023 Ga0209025_1000023149 264
212 3300025297 Ga0209758_1015795 Ga0209758_10157951 264
213 3300025298 Ga0209050_1027075 Ga0209050_10270752 264
214 3300025304 Ga0209257_1000378 Ga0209257_100037873 264
215 3300025304 Ga0209257_1000623 Ga0209257_100062320 264
216 3300025304 Ga0209257_1002172 Ga0209257_100217215 264
217 3300025903 Ga0207680_10034925 Ga0207680_100349253 264
218 3300025904 Ga0207647_10052007 Ga0207647_100520072 264
219 3300025910 Ga0207684_10082247 Ga0207684_100822472 264
220 3300025913 Ga0207695_10000359 Ga0207695_100003592 264
221 3300025914 Ga0207671_10032980 Ga0207671_100329801 264
222 3300025919 Ga0207657_10004311 Ga0207657_1000431118 264
223 3300025920 Ga0207649_10005176 Ga0207649_100051765 264
224 3300025920 Ga0207649_10069259 Ga0207649_100692592 264
225 3300025923 Ga0207681_10005529 Ga0207681_100055294 264
226 3300025924 Ga0207694_10040507 Ga0207694_100405074 264
227 3300025924 Ga0207694_10074834 Ga0207694_100748342 264
228 3300025925 Ga0207650_10397614 Ga0207650_103976142 264
229 3300025926 Ga0207659_10250900 Ga0207659_102509002 264
230 3300025931 Ga0207644_10014368 Ga0207644_100143684 264
231 3300025931 Ga0207644_10020013 Ga0207644_100200136 264
232 3300025934 Ga0207686_10226091 Ga0207686_102260912 264
233 3300025936 Ga0207670_10000951 Ga0207670_100009518 264
234 3300025936 Ga0207670_10411110 Ga0207670_104111101 264
235 3300025941 Ga0207711_10675672 Ga0207711_106756721 264
236 3300025949 Ga0207667_10006234 Ga0207667_100062342 264
237 3300026041 Ga0207639_10000258 Ga0207639_100002582 264
238 3300026067 Ga0207678_10387005 Ga0207678_103870052 264
239 3300026088 Ga0207641_10604624 Ga0207641_106046241 264
240 3300026089 Ga0207648_10063096 Ga0207648_100630964 264
241 3300026118 Ga0207675_100333059 Ga0207675_1003330592 264
242 3300026121 Ga0207683_10226890 Ga0207683_102268902 264
243 3300027360 Ga0209969_1003645 Ga0209969_10036452 264
244 3300027471 Ga0209995_1002391 Ga0209995_10023913 264
245 3300027552 Ga0209982_1006238 Ga0209982_10062382 264
246 3300027665 Ga0209983_1000791 Ga0209983_10007913 264
247 3300028016 Ga0265354_1001853 Ga0265354_10018532 264
248 3300028380 Ga0268265_10030559 Ga0268265_100305592 264
249 3300028380 Ga0268265_10170068 Ga0268265_101700682 264
250 3300028380 Ga0268265_10804601 Ga0268265_108046011 264
251 3300028381 Ga0268264_10478038 Ga0268264_104780381 264
252 3300030731 Ga0316177_1082712 Ga0316177_10827123 264
253 3300030732 Ga0316176_1179031 Ga0316176_11790313 264
254 3300030735 Ga0316178_1137788 Ga0316178_11377883 264
255 3300030745 Ga0316182_1310129 Ga0316182_13101292 264
256 3300030878 Ga0265770_1000003 Ga0265770_100000312 264
257 3300031456 Ga0307513_10000456 Ga0307513_1000045616 264
258 3300031507 Ga0307509_10061535 Ga0307509_100615354 264
259 3300031824 Ga0307413_10000233 Ga0307413_100002337 264
260 3300031824 Ga0307413_10085069 Ga0307413_100850693 264
261 3300031911 Ga0307412_10000665 Ga0307412_100006656 264
262 3300032004 Ga0307414_10006683 Ga0307414_100066837 264
263 3300032004 Ga0307414_10023925 Ga0307414_100239256 264
264 3300032004 Ga0307414_10050684 Ga0307414_100506843 264
265 3300032004 Ga0307414_10097394 Ga0307414_100973943 264
266 3300032004 Ga0307414_10136766 Ga0307414_101367662 264
267 3300032004 Ga0307414_10368310 Ga0307414_103683102 264
268 3300032005 Ga0307411_10092923 Ga0307411_100929231 264
269 3300032126 Ga0307415_100177474 Ga0307415_1001774742 264
270 3300039447 Ga0436361_1154293 Ga0436361_1154293_19008_19808 264
271 3300041404 Ga0439436_0000140 Ga0439436_0000140_159_971 264
272 3300041404 Ga0439436_0035232 Ga0439436_0035232_478_1392 264
273 3300041413 Ga0439465_0009676 Ga0439465_0009676_2188_2991 264
274 3300041413 Ga0439465_0127770 Ga0439465_0127770_29_823 264
275 3300041451 Ga0451791_0624506 Ga0451791_0624506_25_828 264
276 3300041509 Ga0451843_1759941 Ga0451843_1759941_761_1591 264
277 3300042006 Ga0439432_019005 Ga0439432_019005_494_1294 264
278 3300042007 Ga0439449_0029611 Ga0439449_0029611_1071_1991 264
279 3300042007 Ga0439449_0077995 Ga0439449_0077995_301_1095 264
280 3300042010 Ga0439452_059367 Ga0439452_059367_17_817 264
281 3300042015 Ga0439462_0012465 Ga0439462_0012465_27_827 264
282 3300042128 Ga0450897_004446 Ga0450897_004446_338_1150 264
283 3300044658 Ga0466972_0001275 Ga0466972_0001275_10087_10884 264
284 3300046460 Ga0495638_0000295 Ga0495638_0000295_54432_55256 264
285 3300046460 Ga0495638_0001233 Ga0495638_0001233_13676_14509 264
286 3300046471 Ga0495650_0000466 Ga0495650_0000466_39_872 264
287 3300046507 Ga0495606_0000016 Ga0495606_0000016_170172_170996 264
288 3300046512 Ga0495610_0007925 Ga0495610_0007925_1108_1920 264
289 3300046513 Ga0495616_0031329 Ga0495616_0031329_1678_2475 264
290 3300046525 Ga0495663_0001115 Ga0495663_0001115_3081_3878 264
291 3300046530 Ga0495654_0077425 Ga0495654_0077425_565_1365 264
292 3300046539 Ga0495621_0036067 Ga0495621_0036067_632_1444 264
293 3300046557 Ga0495622_0052947 Ga0495622_0052947_950_1774 264
294 3300046615 Ga0495656_0037252 Ga0495656_0037252_55_861 264
295 3300046660 Ga0495625_0016346 Ga0495625_0016346_844_1668 264
296 3300046660 Ga0495625_0256508 Ga0495625_0256508_201_1025 264
297 3300046691 Ga0495670_0000403 Ga0495670_0000403_14910_15722 264
298 3300046694 Ga0495649_0000228 Ga0495649_0000228_43304_44128 264
299 3300046694 Ga0495649_0031604 Ga0495649_0031604_61_873 264
300 3300048903 Ga0496100_0463069 Ga0496100_0463069_95_910 264
301 3300048911 Ga0496108_0022219 Ga0496108_0022219_2814_3629 264
302 3300048912 Ga0496109_0010566 Ga0496109_0010566_2838_3653 264
303 3300048915 Ga0496112_0072650 Ga0496112_0072650_1744_2559 264
304 3300048916 Ga0496113_0026001 Ga0496113_0026001_1510_2325 264
305 3300048917 Ga0496114_0001240 Ga0496114_0001240_3384_4184 264
306 3300048918 Ga0496115_0000114 Ga0496115_0000114_42282_43106 264
307 3300048918 Ga0496115_0002199 Ga0496115_0002199_4593_5417 264
308 3300048918 Ga0496115_0015302 Ga0496115_0015302_2660_3493 264
309 3300048918 Ga0496115_0031106 Ga0496115_0031106_3305_4129 264
310 3300048920 Ga0496117_0099758 Ga0496117_0099758_317_1114 264
311 3300048921 Ga0496118_0000264 Ga0496118_0000264_64463_65260 264
312 3300048925 Ga0496122_0006815 Ga0496122_0006815_5212_6009 264
313 3300048926 Ga0496123_0007877 Ga0496123_0007877_6892_7725 264
314 3300048929 Ga0496126_0003693 Ga0496126_0003693_14964_15764 264
315 3300048929 Ga0496126_0008816 Ga0496126_0008816_1904_2701 264
316 3300048929 Ga0496126_0015681 Ga0496126_0015681_435_1259 264
317 3300048929 Ga0496126_0024412 Ga0496126_0024412_82_906 264
318 3300048929 Ga0496126_0052444 Ga0496126_0052444_800_1633 264
319 3300049460 Ga0495682_0027600 Ga0495682_0027600_1222_2046 264
320 3300049570 Ga0501033_0005592 Ga0501033_0005592_2709_3506 264
321 3300049571 Ga0501034_0000817 Ga0501034_0000817_2880_3674 264
322 3300049571 Ga0501034_0027414 Ga0501034_0027414_2534_3364 264
323 3300049571 Ga0501034_0262714 Ga0501034_0262714_728_1570 264
324 3300049573 Ga0501037_0003481 Ga0501037_0003481_7941_8771 264
325 3300049574 Ga0501038_0013201 Ga0501038_0013201_3824_4654 264
326 3300049581 Ga0501047_0253976 Ga0501047_0253976_684_1514 264
327 3300049587 Ga0501071_0046271 Ga0501071_0046271_1708_2538 264
328 3300049588 Ga0501072_0091818 Ga0501072_0091818_1498_2310 264
329 3300049590 Ga0501074_0119211 Ga0501074_0119211_992_1798 264
330 3300049591 Ga0501075_0188033 Ga0501075_0188033_201_1010 264
331 3300049742 Ga0501080_0143522 Ga0501080_0143522_699_1508 264
332 3300049822 Ga0501035_0019380 Ga0501035_0019380_2879_3709 264
333 3300049823 Ga0501044_0005344 Ga0501044_0005344_12061_12891 264
334 3300050491 nmdc:mga00v17_118_c1 nmdc:mga00v17_118_c1_40854_41651 264
335 3300050491 nmdc:mga00v17_71718_c1 nmdc:mga00v17_71718_c1_1160_1957 264
336 3300053087 Ga0500643_004501 Ga0500643_004501_2780_3574 264
337 3300053120 Ga0500597_000037 Ga0500597_000037_10029_10823 264
338 3300053139 Ga0500568_0000433 Ga0500568_0000433_28458_29267 264
339 iso_pu_bacteria 2739367700 2739729974 264
340 iso_pu_bacteria 2884411467 2884412982 264
341 iso_pu_bacteria 8021622325 8021623865 264
342 iso_pu_bacteria 8021626552 8021630085 264
343 iso_pu_bacteria 8021648035 8021648131 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01497

Peripla_BP_2

Periplasmic binding protein

7

116

0.97

PF01497

Peripla_BP_2

Periplasmic binding protein

110

223

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4m7o-assembly1.cif.gz_A the crystal structure of a possible an iron-binding (periplasmic solute-binding) protein from staphylococcus epidermidis atcc 12228. 0.8582 1 256
4m7o-assembly1.cif.gz_A the crystal structure of a possible an iron-binding (periplasmic solute-binding) protein from staphylococcus epidermidis atcc 12228. 0.849 1 256
5m2q-assembly1.cif.gz_A structure of cobinamide-bound btuf mutant w66f, the periplasmic vitamin b12 binding protein in e.coli 0.8481 4 258
2rg7-assembly1.cif.gz_C apo- crystal structure of a periplasmic heme binding protein from shigella dysenteriae 0.8473 4 255
5m34-assembly1.cif.gz_A structure of cobinamide-bound btuf mutant w66y, the periplasmic vitamin b12 binding protein in e.coli 0.8464 1 258
ID Description Score Start End Superfamily
af_Q2G0F6_19_140_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9105 4 119 3.40.50.1980
2rg7D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8871 4 119 3.40.50.1980
2r79A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.88 3 118 3.40.50.1980
5y8bA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8732 2 119 3.40.50.1980
3nu1A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.862 4 119 3.40.50.1980
ID Description Score Start End GO Terms
AF-A0A4Q6GJA2-F1-model_v4 Cobalamin-binding protein 1.001 139 263
AF-A0A011NQL8-F1-model_v4 Vitamin B12-binding protein 0.9896 3 262
AF-A0A8A8VHZ1-F1-model_v4 deleted 0.9872 2 264
AF-A0A4Q8M1G8-F1-model_v4 Cobalamin-binding protein 0.9848 1 260 GO:0071281
AF-A0A643FJS1-F1-model_v4 ABC transporter substrate-binding protein 0.9837 2 264

Feature Viewer

pLDDT pTM Quality
93.89 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map