F415345

General Info

Members Datasets Scaffolds Average Seq Length
342 257 684 126

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0371118|Ga0501040_0371118_263_697
Length 144
Sequence VWLTAAAGSIDAHHNGRGIDMLRDVDAVAMLAVKDLDVAARFYEETLGLSRAGAEGDQVIVFASGDTLINVYRSSFAGTNKATALTWAVDDVEDVVRTLKAKGVKFEHYDLPDTRRAGDVHIAGNIKVAWFKDPDGNIHSVVNG

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
155 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
169 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
170 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
171 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
185 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
186 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
187 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
190 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
191 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
238 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
239 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
251 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
252 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
257 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 0.58
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.46
Nodule 0.29
Rhizoplane 5.26
Rhizosphere 92.4
Stem 0
Stem Tuber 0
Unclassified 11.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0371118 3300049576 Bacteria 1026
2 JGI24736J21556_1004900 3300001904 Bacteria 2274
3 JGI24746J21847_1035099 3300001977 Unclassified 693
4 JGI24740J21852_10001561 3300001979 Bacteria 10523
5 JGI24739J22299_10242374 3300001989 Unclassified 528
6 JGI24735J21928_10009656 3300002067 Bacteria 3092
7 JGI25406J46586_10030531 3300003203 Bacteria 2027
8 Ga0065712_10098640 3300005290 Bacteria 2114
9 Ga0065715_10978606 3300005293 Bacteria 551
10 Ga0065707_10222466 3300005295 Bacteria 1201
11 Ga0070658_10632182 3300005327 Bacteria 928
12 Ga0070676_10553663 3300005328 Unclassified 824
13 Ga0070683_100339690 3300005329 Bacteria 1430
14 Ga0070690_101771208 3300005330 Bacteria 503
15 Ga0070670_100096220 3300005331 Bacteria 2547
16 Ga0070666_10066500 3300005335 Bacteria 2446
17 Ga0070680_100004646 3300005336 Bacteria 10326
18 Ga0070680_100714026 3300005336 Bacteria 863
19 Ga0070689_100306740 3300005340 Bacteria 1322
20 Ga0070691_10000453 3300005341 Bacteria 15235
21 Ga0070691_10115061 3300005341 Bacteria 1349
22 Ga0070687_100022883 3300005343 Bacteria 2962
23 Ga0070687_100045354 3300005343 Bacteria 2244
24 Ga0070669_100209688 3300005353 Bacteria 1536
25 Ga0070669_100547460 3300005353 Bacteria 964
26 Ga0070675_101151432 3300005354 Bacteria 714
27 Ga0070671_100915786 3300005355 Bacteria 766
28 Ga0070673_100169336 3300005364 Bacteria 1863
29 Ga0070709_10013283 3300005434 Bacteria 4624
30 Ga0070713_100464880 3300005436 Unclassified 1190
31 Ga0070713_101041378 3300005436 Bacteria 790
32 Ga0070710_10091482 3300005437 Bacteria 1795
33 Ga0070701_10513357 3300005438 Bacteria 780
34 Ga0070711_100088357 3300005439 Bacteria 2227
35 Ga0070700_100582742 3300005441 Bacteria 874
36 Ga0070708_100000468 3300005445 Bacteria 30422
37 Ga0070708_101804301 3300005445 Bacteria 568
38 Ga0070663_100043115 3300005455 Bacteria 3173
39 Ga0070663_100912125 3300005455 Bacteria 759
40 Ga0070678_100436966 3300005456 Bacteria 1144
41 Ga0070681_10558384 3300005458 Bacteria 1059
42 Ga0068867_100088786 3300005459 Bacteria 2343
43 Ga0068867_101070911 3300005459 Unclassified 735
44 Ga0070706_100380874 3300005467 Bacteria 1314
45 Ga0070698_100881285 3300005471 Bacteria 840
46 Ga0070679_100542040 3300005530 Bacteria 1107
47 Ga0070684_100001796 3300005535 Bacteria 15691
48 Ga0070684_102024006 3300005535 Bacteria 544
49 Ga0068853_100449065 3300005539 Bacteria 1212
50 Ga0070672_100110129 3300005543 Bacteria 2243
51 Ga0070686_100264922 3300005544 Bacteria 1261
52 Ga0070686_100397259 3300005544 Bacteria 1047
53 Ga0070686_101750642 3300005544 Bacteria 528
54 Ga0070693_101049673 3300005547 Bacteria 619
55 Ga0070665_100209505 3300005548 Bacteria 1950
56 Ga0070704_100562131 3300005549 Bacteria 998
57 Ga0070664_100429431 3300005564 Bacteria 1211
58 Ga0068857_100029707 3300005577 Bacteria 4824
59 Ga0068857_100468822 3300005577 Bacteria 1179
60 Ga0068856_100250621 3300005614 Unclassified 1786
61 Ga0068856_101272176 3300005614 Unclassified 751
62 Ga0070702_100185181 3300005615 Bacteria 1366
63 Ga0068852_100590136 3300005616 Bacteria 1114
64 Ga0068864_100881608 3300005618 Bacteria 883
65 Ga0068864_101388372 3300005618 Unclassified 704
66 Ga0068861_100184453 3300005719 Bacteria 1739
67 Ga0068861_100302329 3300005719 Bacteria 1386
68 Ga0068861_101727905 3300005719 Bacteria 619
69 Ga0068851_10094381 3300005834 Bacteria 1580
70 Ga0068870_10019570 3300005840 Bacteria 3285
71 Ga0068862_100082869 3300005844 Bacteria 2784
72 Ga0068862_100213872 3300005844 Bacteria 1743
73 Ga0068862_100292225 3300005844 Bacteria 1497
74 Ga0081538_10109103 3300005981 Bacteria 1364
75 Ga0081539_10001054 3300005985 Bacteria 50478
76 Ga0075364_10069677 3300006051 Bacteria 2314
77 Ga0075364_10812412 3300006051 Unclassified 637
78 Ga0075432_10302798 3300006058 Unclassified 664
79 Ga0070712_100284680 3300006175 Bacteria 1332
80 Ga0075369_10232559 3300006186 Bacteria 854
81 Ga0097621_100235418 3300006237 Unclassified 1599
82 Ga0068871_100260071 3300006358 Bacteria 1514
83 Ga0075428_100017078 3300006844 Bacteria 8017
84 Ga0075428_100219439 3300006844 Unclassified 2053
85 Ga0075428_100357289 3300006844 Bacteria 1568
86 Ga0075428_100387595 3300006844 Bacteria 1498
87 Ga0075430_100162553 3300006846 Bacteria 1859
88 Ga0075430_100258994 3300006846 Unclassified 1441
89 Ga0075430_101115352 3300006846 Bacteria 650
90 Ga0075431_100036556 3300006847 Bacteria 5058
91 Ga0075431_100338891 3300006847 Bacteria 1513
92 Ga0075431_100846176 3300006847 Bacteria 886
93 Ga0075433_10063365 3300006852 Bacteria 3239
94 Ga0075434_100050692 3300006871 Bacteria 4124
95 Ga0075429_100514714 3300006880 Bacteria 1049
96 Ga0075429_100523407 3300006880 Bacteria 1039
97 Ga0068865_101634943 3300006881 Bacteria 580
98 Ga0075436_100578912 3300006914 Bacteria 826
99 Ga0075435_100168492 3300007076 Bacteria 1847
100 Ga0105250_10238570 3300009092 Bacteria 775
101 Ga0111539_10120981 3300009094 Bacteria 3067
102 Ga0111539_10237927 3300009094 Bacteria 2119
103 Ga0111539_10565168 3300009094 Bacteria 1325
104 Ga0105245_12936820 3300009098 Unclassified 528
105 Ga0114129_13304851 3300009147 Bacteria 521
106 Ga0105243_11020411 3300009148 Unclassified 831
107 Ga0105243_11359893 3300009148 Bacteria 729
108 Ga0105242_11434504 3300009176 Bacteria 719
109 Ga0105248_11093294 3300009177 Unclassified 901
110 Ga0105248_12866373 3300009177 Bacteria 550
111 Ga0105249_10193507 3300009553 Bacteria 1986
112 Ga0105249_10236043 3300009553 Bacteria 1806
113 Ga0105246_10607327 3300011119 Unclassified 946
114 Ga0157370_11000330 3300013104 Bacteria 757
115 Ga0157378_10120609 3300013297 Bacteria 2417
116 Ga0157372_13254333 3300013307 Unclassified 518
117 Ga0157375_10133968 3300013308 Bacteria 2599
118 Ga0163163_13116250 3300014325 Unclassified 517
119 Ga0157380_10247478 3300014326 Bacteria 1611
120 Ga0157380_10517683 3300014326 Bacteria 1163
121 Ga0157379_10566255 3300014968 Bacteria 1058
122 Ga0163161_10053192 3300017792 Bacteria 2936
123 Ga0206355_1242805 3300020076 Bacteria 1400
124 Ga0224712_10046219 3300022467 Bacteria 1670
125 Ga0207697_10005056 3300025315 Bacteria 6178
126 Ga0207682_10006013 3300025893 Bacteria 4908
127 Ga0207692_10072746 3300025898 Bacteria 1817
128 Ga0207688_10020447 3300025901 Bacteria 3615
129 Ga0207647_10006191 3300025904 Bacteria 8718
130 Ga0207647_10322790 3300025904 Bacteria 877
131 Ga0207699_10040908 3300025906 Bacteria 2673
132 Ga0207643_10006901 3300025908 Bacteria 6091
133 Ga0207705_10001455 3300025909 Bacteria 18886
134 Ga0207684_10321526 3300025910 Bacteria 1333
135 Ga0207695_10012312 3300025913 Bacteria 10277
136 Ga0207671_10704939 3300025914 Bacteria 803
137 Ga0207663_10204218 3300025916 Bacteria 1428
138 Ga0207660_10003625 3300025917 Bacteria 10068
139 Ga0207660_10792124 3300025917 Bacteria 773
140 Ga0207662_10032459 3300025918 Bacteria 3040
141 Ga0207657_10003729 3300025919 Bacteria 16196
142 Ga0207649_10007281 3300025920 Bacteria 6016
143 Ga0207649_10890899 3300025920 Bacteria 697
144 Ga0207652_10276785 3300025921 Bacteria 1514
145 Ga0207681_10053065 3300025923 Bacteria 2751
146 Ga0207681_10055501 3300025923 Bacteria 2698
147 Ga0207681_10855856 3300025923 Unclassified 760
148 Ga0207694_10026589 3300025924 Bacteria 4404
149 Ga0207650_10052651 3300025925 Bacteria 3016
150 Ga0207659_11396567 3300025926 Bacteria 600
151 Ga0207700_10531268 3300025928 Unclassified 1043
152 Ga0207700_10534024 3300025928 Bacteria 1040
153 Ga0207700_10788387 3300025928 Bacteria 850
154 Ga0207690_10003780 3300025932 Bacteria 8964
155 Ga0207706_10015646 3300025933 Bacteria 6854
156 Ga0207706_10030776 3300025933 Bacteria 4787
157 Ga0207709_11762630 3300025935 Bacteria 515
158 Ga0207669_10048466 3300025937 Bacteria 2524
159 Ga0207704_10098122 3300025938 Bacteria 1945
160 Ga0207691_10015979 3300025940 Bacteria 7131
161 Ga0207691_10468561 3300025940 Bacteria 1071
162 Ga0207689_10186330 3300025942 Bacteria 1712
163 Ga0207661_10043845 3300025944 Bacteria 3531
164 Ga0207661_10048956 3300025944 Bacteria 3362
165 Ga0207661_10578949 3300025944 Bacteria 1030
166 Ga0207679_10158182 3300025945 Bacteria 1852
167 Ga0207679_10844734 3300025945 Bacteria 836
168 Ga0207667_10012721 3300025949 Bacteria 9666
169 Ga0207651_11111400 3300025960 Bacteria 708
170 Ga0207712_10037312 3300025961 Bacteria 3315
171 Ga0207668_10118831 3300025972 Bacteria 1998
172 Ga0207640_10010686 3300025981 Bacteria 5179
173 Ga0207658_11596606 3300025986 Bacteria 596
174 Ga0207639_10031905 3300026041 Bacteria 3874
175 Ga0207702_10296887 3300026078 Unclassified 1532
176 Ga0207648_10011443 3300026089 Bacteria 8356
177 Ga0207648_10379532 3300026089 Bacteria 1278
178 Ga0207648_11904563 3300026089 Bacteria 556
179 Ga0207676_11105354 3300026095 Unclassified 784
180 Ga0207674_10003722 3300026116 Bacteria 18621
181 Ga0207674_10740086 3300026116 Bacteria 949
182 Ga0207675_100203559 3300026118 Unclassified 1902
183 Ga0207675_102509000 3300026118 Bacteria 526
184 Ga0207683_10032059 3300026121 Bacteria 4563
185 Ga0207698_10001611 3300026142 Bacteria 13137
186 Ga0207698_10078086 3300026142 Bacteria 2657
187 Ga0209973_1013626 3300027252 Bacteria 1004
188 Ga0209967_1034431 3300027364 Bacteria 763
189 Ga0209981_1003164 3300027378 Bacteria 2130
190 Ga0209996_1007742 3300027395 Bacteria 1402
191 Ga0209984_1025183 3300027424 Bacteria 827
192 Ga0209968_1036824 3300027526 Bacteria 829
193 Ga0209999_1027910 3300027543 Bacteria 1046
194 Ga0209982_1001415 3300027552 Bacteria 3275
195 Ga0209970_1006898 3300027614 Bacteria 1864
196 Ga0209970_1009999 3300027614 Bacteria 1550
197 Ga0210002_1000250 3300027617 Bacteria 7685
198 Ga0209971_1001241 3300027682 Bacteria 6389
199 Ga0209971_1012715 3300027682 Bacteria 1993
200 Ga0209966_1141828 3300027695 Bacteria 557
201 Ga0209998_10002304 3300027717 Bacteria 4414
202 Ga0209974_10002953 3300027876 Bacteria 6172
203 Ga0207428_10003701 3300027907 Bacteria 14689
204 Ga0268265_10075185 3300028380 Bacteria 2645
205 Ga0268265_10722238 3300028380 Unclassified 964
206 Ga0268265_12598256 3300028380 Bacteria 512
207 Ga0265338_10005352 3300028800 Bacteria 16785
208 Ga0265338_10976286 3300028800 Unclassified 574
209 Ga0265328_10000871 3300031239 Bacteria 13981
210 Ga0265320_10001607 3300031240 Bacteria 16194
211 Ga0265339_10057219 3300031249 Bacteria 2108
212 Ga0307408_100417377 3300031548 Bacteria 1156
213 Ga0265342_10001427 3300031712 Bacteria 22273
214 Ga0307405_10747669 3300031731 Bacteria 814
215 Ga0307413_10139775 3300031824 Bacteria 1671
216 Ga0307410_10141476 3300031852 Bacteria 1780
217 Ga0307407_10228852 3300031903 Bacteria 1261
218 Ga0307409_100106544 3300031995 Bacteria 2340
219 Ga0307416_100322042 3300032002 Bacteria 1549
220 Ga0307416_100458597 3300032002 Bacteria 1329
221 Ga0307416_100654404 3300032002 Unclassified 1136
222 Ga0307414_10182145 3300032004 Bacteria 1690
223 Ga0307411_10165083 3300032005 Bacteria 1663
224 Ga0307415_100952295 3300032126 Bacteria 795
225 Ga0307415_101325453 3300032126 Unclassified 683
226 Ga0373951_0150423 3300035091 Bacteria 652
227 Ga0373953_0078046 3300035117 Unclassified 1373
228 Ga0373953_0426107 3300035117 Unclassified 585
229 Ga0373954_0044687 3300035118 Bacteria 2068
230 Ga0373954_0110361 3300035118 Bacteria 1330
231 Ga0373956_0015528 3300035119 Bacteria 3189
232 Ga0373956_0280010 3300035119 Bacteria 794
233 Ga0373955_0008662 3300035172 Bacteria 4734
234 Ga0373955_0371860 3300035172 Bacteria 867
235 Ga0373961_0236204 3300035241 Bacteria 657
236 Ga0373931_1223690 3300035691 Bacteria 515
237 Ga0373927_0065072 3300035695 Bacteria 2359
238 Ga0373933_0003668 3300035724 Bacteria 8501
239 Ga0373933_0017142 3300035724 Bacteria 4060
240 Ga0373933_0039409 3300035724 Bacteria 2780
241 Ga0373937_0013563 3300036401 Bacteria 7180
242 Ga0373925_0293799 3300037068 Bacteria 1311
243 Ga0395899_0041394 3300037312 Bacteria 3442
244 Ga0395900_0308370 3300037418 Bacteria 1567
245 Ga0395898_0065973 3300037466 Bacteria 3508
246 Ga0395905_0040353 3300037471 Bacteria 4378
247 Ga0395905_0181510 3300037471 Bacteria 1976
248 Ga0395905_0367705 3300037471 Unclassified 1331
249 Ga0395905_0516692 3300037471 Bacteria 1095
250 Ga0395905_0670967 3300037471 Bacteria 939
251 Ga0395901_0222896 3300038443 Bacteria 1970
252 Ga0439438_152905 3300041405 Bacteria 550
253 Ga0451804_1146449 3300041463 Unclassified 534
254 Ga0451807_2628583 3300041486 Bacteria 573
255 Ga0451843_0077162 3300041509 Bacteria 572
256 Ga0451853_1690989 3300041512 Bacteria 614
257 Ga0439432_248468 3300042006 Bacteria 510
258 Ga0450920_121356 3300042122 Bacteria 549
259 Ga0450909_052506 3300042185 Bacteria 637
260 Ga0451576_0515246 3300045051 Bacteria 1256
261 Ga0495641_0133208 3300046461 Unclassified 1109
262 Ga0495651_0016397 3300046462 Bacteria 5738
263 Ga0495662_0355026 3300046476 Bacteria 721
264 Ga0495664_0185782 3300046477 Bacteria 1260
265 Ga0495664_0463391 3300046477 Bacteria 758
266 Ga0495584_0223175 3300046491 Bacteria 958
267 Ga0495594_0504003 3300046499 Unclassified 687
268 Ga0495608_0546050 3300046511 Bacteria 699
269 Ga0495628_0013286 3300046516 Bacteria 6927
270 Ga0495628_0120733 3300046516 Unclassified 2011
271 Ga0495630_0627641 3300046517 Bacteria 823
272 Ga0495652_0118371 3300046529 Bacteria 2117
273 Ga0495587_0001885 3300046536 Bacteria 13948
274 Ga0495587_0022469 3300046536 Bacteria 3884
275 Ga0495645_0000392 3300046543 Bacteria 30352
276 Ga0495667_0001228 3300046559 Bacteria 16774
277 Ga0495588_0130395 3300046674 Bacteria 1326
278 Ga0495599_0671800 3300046678 Unclassified 599
279 Ga0495623_0021138 3300046679 Bacteria 4205
280 Ga0495658_0786400 3300046683 Bacteria 609
281 Ga0495613_0749200 3300046689 Bacteria 640
282 Ga0495600_0075073 3300046809 Bacteria 2208
283 Ga0495600_0220930 3300046809 Bacteria 1212
284 Ga0495604_0080196 3300047317 Bacteria 2446
285 Ga0495674_1452913 3300047319 Unclassified 509
286 Ga0495675_0584599 3300047444 Unclassified 634
287 Ga0495684_0080965 3300047471 Unclassified 2465
288 Ga0496101_1069713 3300048904 Bacteria 634
289 Ga0496104_0025943 3300048907 Bacteria 5404
290 Ga0496105_0249472 3300048908 Bacteria 1438
291 Ga0496106_1085109 3300048909 Bacteria 628
292 Ga0496108_0066180 3300048911 Bacteria 3047
293 Ga0496109_0164352 3300048912 Bacteria 2080
294 Ga0496109_2065873 3300048912 Bacteria 502
295 Ga0496111_0045464 3300048914 Bacteria 3159
296 Ga0496112_0559048 3300048915 Bacteria 1078
297 Ga0496113_0340025 3300048916 Bacteria 1204
298 Ga0496114_0067316 3300048917 Bacteria 3004
299 Ga0496114_0180428 3300048917 Bacteria 1844
300 Ga0496114_0194847 3300048917 Bacteria 1773
301 Ga0496114_0710113 3300048917 Bacteria 881
302 Ga0496115_0188551 3300048918 Bacteria 1704
303 Ga0496115_0230282 3300048918 Bacteria 1528
304 Ga0501031_0476906 3300049568 Bacteria 805
305 Ga0501036_0118954 3300049572 Unclassified 2231
306 Ga0501039_0342957 3300049575 Bacteria 1174
307 Ga0501040_0257071 3300049576 Bacteria 1246
308 Ga0501042_0146282 3300049578 Bacteria 1704
309 Ga0501042_0501716 3300049578 Bacteria 881
310 Ga0501048_0121001 3300049582 Bacteria 1850
311 Ga0501070_0179117 3300049586 Bacteria 1745
312 Ga0501072_0839595 3300049588 Bacteria 718
313 Ga0501073_0445787 3300049589 Bacteria 895
314 Ga0501075_0345465 3300049591 Bacteria 1134
315 Ga0501076_0132718 3300049592 Bacteria 2020
316 Ga0501077_0293086 3300049593 Bacteria 1036
317 Ga0501211_039842 3300049658 Unclassified 557
318 Ga0501079_0852719 3300049741 Bacteria 717
319 Ga0501079_0943675 3300049741 Bacteria 679
320 Ga0501080_1575855 3300049742 Bacteria 557
321 nmdc:mga00v17_212247_c1 3300050491 Bacteria 1253
322 nmdc:mga09592_150897_c1 3300050508 Bacteria 2005
323 nmdc:mga0qj67_41996_c1 3300050509 Bacteria 3599
324 nmdc:mga0qj67_499031_c1 3300050509 Bacteria 978
325 nmdc:mga0qj67_967081_c1 3300050509 Bacteria 669
326 nmdc:mga06r32_1145802_c1 3300050510 Bacteria 725
327 nmdc:mga06r32_153521_c1 3300050510 Bacteria 2282
328 nmdc:mga06r32_165385_c1 3300050510 Bacteria 2195
329 nmdc:mga06r32_34500_c1 3300050510 Bacteria 4771
330 nmdc:mga08y16_377846_c1 3300050511 Bacteria 1453
331 nmdc:mga0n895_67396_c1 3300050512 Bacteria 3545
332 nmdc:mga0rr50_150277_c1 3300050513 Bacteria 1881
333 nmdc:mga08x19_482626_c1 3300050514 Bacteria 874
334 nmdc:mga0a205_5063_c1 3300050515 Bacteria 6759
335 nmdc:mga0sz30_166458_c1 3300050516 Bacteria 977
336 Ga0495601_0185224 3300053077 Bacteria 1361
337 Ga0495612_0000489 3300053078 Bacteria 15785
338 Ga0495619_0229471 3300053085 Bacteria 1286
339 Ga0501084_0291626 3300054114 Bacteria 1378
340 Ga0501082_1064047 3300060353 Bacteria 707
341 2694628428 2693429783 Bacteria 7019804
342 2874171836 2874168670 Bacteria 8062617
343 Ga0501040_0371118
344 JGI24736J21556_1004900
345 JGI24746J21847_1035099
346 JGI24740J21852_10001561
347 JGI24739J22299_10242374
348 JGI24735J21928_10009656
349 JGI25406J46586_10030531
350 Ga0065712_10098640
351 Ga0065715_10978606
352 Ga0065707_10222466
353 Ga0070658_10632182
354 Ga0070676_10553663
355 Ga0070683_100339690
356 Ga0070690_101771208
357 Ga0070670_100096220
358 Ga0070666_10066500
359 Ga0070680_100004646
360 Ga0070680_100714026
361 Ga0070689_100306740
362 Ga0070691_10000453
363 Ga0070691_10115061
364 Ga0070687_100022883
365 Ga0070687_100045354
366 Ga0070669_100209688
367 Ga0070669_100547460
368 Ga0070675_101151432
369 Ga0070671_100915786
370 Ga0070673_100169336
371 Ga0070709_10013283
372 Ga0070713_100464880
373 Ga0070713_101041378
374 Ga0070710_10091482
375 Ga0070701_10513357
376 Ga0070711_100088357
377 Ga0070700_100582742
378 Ga0070708_100000468
379 Ga0070708_101804301
380 Ga0070663_100043115
381 Ga0070663_100912125
382 Ga0070678_100436966
383 Ga0070681_10558384
384 Ga0068867_100088786
385 Ga0068867_101070911
386 Ga0070706_100380874
387 Ga0070698_100881285
388 Ga0070679_100542040
389 Ga0070684_100001796
390 Ga0070684_102024006
391 Ga0068853_100449065
392 Ga0070672_100110129
393 Ga0070686_100264922
394 Ga0070686_100397259
395 Ga0070686_101750642
396 Ga0070693_101049673
397 Ga0070665_100209505
398 Ga0070704_100562131
399 Ga0070664_100429431
400 Ga0068857_100029707
401 Ga0068857_100468822
402 Ga0068856_100250621
403 Ga0068856_101272176
404 Ga0070702_100185181
405 Ga0068852_100590136
406 Ga0068864_100881608
407 Ga0068864_101388372
408 Ga0068861_100184453
409 Ga0068861_100302329
410 Ga0068861_101727905
411 Ga0068851_10094381
412 Ga0068870_10019570
413 Ga0068862_100082869
414 Ga0068862_100213872
415 Ga0068862_100292225
416 Ga0081538_10109103
417 Ga0081539_10001054
418 Ga0075364_10069677
419 Ga0075364_10812412
420 Ga0075432_10302798
421 Ga0070712_100284680
422 Ga0075369_10232559
423 Ga0097621_100235418
424 Ga0068871_100260071
425 Ga0075428_100017078
426 Ga0075428_100219439
427 Ga0075428_100357289
428 Ga0075428_100387595
429 Ga0075430_100162553
430 Ga0075430_100258994
431 Ga0075430_101115352
432 Ga0075431_100036556
433 Ga0075431_100338891
434 Ga0075431_100846176
435 Ga0075433_10063365
436 Ga0075434_100050692
437 Ga0075429_100514714
438 Ga0075429_100523407
439 Ga0068865_101634943
440 Ga0075436_100578912
441 Ga0075435_100168492
442 Ga0105250_10238570
443 Ga0111539_10120981
444 Ga0111539_10237927
445 Ga0111539_10565168
446 Ga0105245_12936820
447 Ga0114129_13304851
448 Ga0105243_11020411
449 Ga0105243_11359893
450 Ga0105242_11434504
451 Ga0105248_11093294
452 Ga0105248_12866373
453 Ga0105249_10193507
454 Ga0105249_10236043
455 Ga0105246_10607327
456 Ga0157370_11000330
457 Ga0157378_10120609
458 Ga0157372_13254333
459 Ga0157375_10133968
460 Ga0163163_13116250
461 Ga0157380_10247478
462 Ga0157380_10517683
463 Ga0157379_10566255
464 Ga0163161_10053192
465 Ga0206355_1242805
466 Ga0224712_10046219
467 Ga0207697_10005056
468 Ga0207682_10006013
469 Ga0207692_10072746
470 Ga0207688_10020447
471 Ga0207647_10006191
472 Ga0207647_10322790
473 Ga0207699_10040908
474 Ga0207643_10006901
475 Ga0207705_10001455
476 Ga0207684_10321526
477 Ga0207695_10012312
478 Ga0207671_10704939
479 Ga0207663_10204218
480 Ga0207660_10003625
481 Ga0207660_10792124
482 Ga0207662_10032459
483 Ga0207657_10003729
484 Ga0207649_10007281
485 Ga0207649_10890899
486 Ga0207652_10276785
487 Ga0207681_10053065
488 Ga0207681_10055501
489 Ga0207681_10855856
490 Ga0207694_10026589
491 Ga0207650_10052651
492 Ga0207659_11396567
493 Ga0207700_10531268
494 Ga0207700_10534024
495 Ga0207700_10788387
496 Ga0207690_10003780
497 Ga0207706_10015646
498 Ga0207706_10030776
499 Ga0207709_11762630
500 Ga0207669_10048466
501 Ga0207704_10098122
502 Ga0207691_10015979
503 Ga0207691_10468561
504 Ga0207689_10186330
505 Ga0207661_10043845
506 Ga0207661_10048956
507 Ga0207661_10578949
508 Ga0207679_10158182
509 Ga0207679_10844734
510 Ga0207667_10012721
511 Ga0207651_11111400
512 Ga0207712_10037312
513 Ga0207668_10118831
514 Ga0207640_10010686
515 Ga0207658_11596606
516 Ga0207639_10031905
517 Ga0207702_10296887
518 Ga0207648_10011443
519 Ga0207648_10379532
520 Ga0207648_11904563
521 Ga0207676_11105354
522 Ga0207674_10003722
523 Ga0207674_10740086
524 Ga0207675_100203559
525 Ga0207675_102509000
526 Ga0207683_10032059
527 Ga0207698_10001611
528 Ga0207698_10078086
529 Ga0209973_1013626
530 Ga0209967_1034431
531 Ga0209981_1003164
532 Ga0209996_1007742
533 Ga0209984_1025183
534 Ga0209968_1036824
535 Ga0209999_1027910
536 Ga0209982_1001415
537 Ga0209970_1006898
538 Ga0209970_1009999
539 Ga0210002_1000250
540 Ga0209971_1001241
541 Ga0209971_1012715
542 Ga0209966_1141828
543 Ga0209998_10002304
544 Ga0209974_10002953
545 Ga0207428_10003701
546 Ga0268265_10075185
547 Ga0268265_10722238
548 Ga0268265_12598256
549 Ga0265338_10005352
550 Ga0265338_10976286
551 Ga0265328_10000871
552 Ga0265320_10001607
553 Ga0265339_10057219
554 Ga0307408_100417377
555 Ga0265342_10001427
556 Ga0307405_10747669
557 Ga0307413_10139775
558 Ga0307410_10141476
559 Ga0307407_10228852
560 Ga0307409_100106544
561 Ga0307416_100322042
562 Ga0307416_100458597
563 Ga0307416_100654404
564 Ga0307414_10182145
565 Ga0307411_10165083
566 Ga0307415_100952295
567 Ga0307415_101325453
568 Ga0373951_0150423
569 Ga0373953_0078046
570 Ga0373953_0426107
571 Ga0373954_0044687
572 Ga0373954_0110361
573 Ga0373956_0015528
574 Ga0373956_0280010
575 Ga0373955_0008662
576 Ga0373955_0371860
577 Ga0373961_0236204
578 Ga0373931_1223690
579 Ga0373927_0065072
580 Ga0373933_0003668
581 Ga0373933_0017142
582 Ga0373933_0039409
583 Ga0373937_0013563
584 Ga0373925_0293799
585 Ga0395899_0041394
586 Ga0395900_0308370
587 Ga0395898_0065973
588 Ga0395905_0040353
589 Ga0395905_0181510
590 Ga0395905_0367705
591 Ga0395905_0516692
592 Ga0395905_0670967
593 Ga0395901_0222896
594 Ga0439438_152905
595 Ga0451804_1146449
596 Ga0451807_2628583
597 Ga0451843_0077162
598 Ga0451853_1690989
599 Ga0439432_248468
600 Ga0450920_121356
601 Ga0450909_052506
602 Ga0451576_0515246
603 Ga0495641_0133208
604 Ga0495651_0016397
605 Ga0495662_0355026
606 Ga0495664_0185782
607 Ga0495664_0463391
608 Ga0495584_0223175
609 Ga0495594_0504003
610 Ga0495608_0546050
611 Ga0495628_0013286
612 Ga0495628_0120733
613 Ga0495630_0627641
614 Ga0495652_0118371
615 Ga0495587_0001885
616 Ga0495587_0022469
617 Ga0495645_0000392
618 Ga0495667_0001228
619 Ga0495588_0130395
620 Ga0495599_0671800
621 Ga0495623_0021138
622 Ga0495658_0786400
623 Ga0495613_0749200
624 Ga0495600_0075073
625 Ga0495600_0220930
626 Ga0495604_0080196
627 Ga0495674_1452913
628 Ga0495675_0584599
629 Ga0495684_0080965
630 Ga0496101_1069713
631 Ga0496104_0025943
632 Ga0496105_0249472
633 Ga0496106_1085109
634 Ga0496108_0066180
635 Ga0496109_0164352
636 Ga0496109_2065873
637 Ga0496111_0045464
638 Ga0496112_0559048
639 Ga0496113_0340025
640 Ga0496114_0067316
641 Ga0496114_0180428
642 Ga0496114_0194847
643 Ga0496114_0710113
644 Ga0496115_0188551
645 Ga0496115_0230282
646 Ga0501031_0476906
647 Ga0501036_0118954
648 Ga0501039_0342957
649 Ga0501040_0257071
650 Ga0501042_0146282
651 Ga0501042_0501716
652 Ga0501048_0121001
653 Ga0501070_0179117
654 Ga0501072_0839595
655 Ga0501073_0445787
656 Ga0501075_0345465
657 Ga0501076_0132718
658 Ga0501077_0293086
659 Ga0501211_039842
660 Ga0501079_0852719
661 Ga0501079_0943675
662 Ga0501080_1575855
663 nmdc:mga00v17_212247_c1
664 nmdc:mga09592_150897_c1
665 nmdc:mga0qj67_41996_c1
666 nmdc:mga0qj67_499031_c1
667 nmdc:mga0qj67_967081_c1
668 nmdc:mga06r32_1145802_c1
669 nmdc:mga06r32_153521_c1
670 nmdc:mga06r32_165385_c1
671 nmdc:mga06r32_34500_c1
672 nmdc:mga08y16_377846_c1
673 nmdc:mga0n895_67396_c1
674 nmdc:mga0rr50_150277_c1
675 nmdc:mga08x19_482626_c1
676 nmdc:mga0a205_5063_c1
677 nmdc:mga0sz30_166458_c1
678 Ga0495601_0185224
679 Ga0495612_0000489
680 Ga0495619_0229471
681 Ga0501084_0291626
682 Ga0501082_1064047
683 2694628428
684 2874171836

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

139

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.818 4 124
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8105 4 124
3vyt-assembly1.cif.gz_A-2 crystal structure of the hypc-hypd-hype complex (form i inward) 0.8039 29 51
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.803 4 124
5tc2-assembly1.cif.gz_B c-terminal domain of hiv-1 integrase, crystal structure 0.7942 28 51
ID Description Score Start End Superfamily
af_Q2FYM3_1_61_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8257 8 54 3.10.180.10
4npsA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8248 30 51 2.40.50.140
af_Q75LC0_81_174_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8165 29 47 2.40.50.140
3vytA00 Mainly Beta;Roll;SH3 type barrels.; 0.8039 29 51 2.30.30.140
4n04B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8026 6 124 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7X6BGT0-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9788 1 124 GO:0016829
GO:0051213
AF-A0A7X6BGT0-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9711 1 124 GO:0016829
GO:0051213
AF-A0A2V8EBM5-F1-model_v4 Glyoxalase 0.9554 1 126
AF-A0A2V7WGR3-F1-model_v4 Glyoxalase 0.953 37 126
AF-A0A2T4VEU5-F1-model_v4 VOC domain-containing protein 0.9516 2 125

Map