F415342

General Info

Members Datasets Scaffolds Average Seq Length
342 235 300 280

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0087055|Ga0501034_0087055_2081_3037
Length 318
Sequence VLFARNVLFLFGLNISRIEKEYFKFEIKKRKFFMSLNPNSEQWTETISSKSSLFSLNLNEVWRYRDLVYMLVRRDFVTSFKQTVLGPVWFFINPILTTIMFVIIFGRVAGLSTDGAPQIPFYLAGVTMWNYFSSCLNGTSSVFRGNASIFGKVYFPRLVMPLSIVISNLMRFGVQFVLFAIVILYYLISNNSVHPNLWILITPFLIVLMAAFAMGTGMIFSSLTTKYKDFTMLLSFGVSLYMYATPVVIPISQFPERFRWILDINPLTGIFECFKYAYLGVGDFSVNMLLYSTIVIFVILAIGTIIFNKVEKSFMDTV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
4 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
5 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
6 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
7 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
8 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
9 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
10 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
11 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
12 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
13 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
14 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
15 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
16 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
17 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
18 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
19 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
20 2738541284 Pedobacter sp. YR016 Isolate Unclassified
21 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
22 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
23 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
24 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
25 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
26 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
27 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
28 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
29 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
30 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
31 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
32 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
33 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
34 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
35 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
36 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
37 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
38 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
39 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
40 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
41 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
42 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
43 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
44 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
45 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
46 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
47 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
48 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
49 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
50 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
51 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
52 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
53 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
54 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
55 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
57 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
58 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
59 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
60 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
61 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
62 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
63 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
64 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
67 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
68 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
120 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
121 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
169 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
185 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
217 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
221 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
229 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
230 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
231 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
232 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
233 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
234 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.13
Metatranscriptomes 0.58
Isolates 12.28

Biome Distribution

Category Percentage (%)
Aerial Root 0.58
Bulb 0
Endosphere 6.14
Nodule 0.29
Rhizoplane 1.75
Rhizosphere 79.24
Stem 0
Stem Tuber 0
Unclassified 11.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
2 SwRhRL2b_contig_503364 2162886007 Bacteria 1086
3 JGI24736J21556_1002406 3300001904 Bacteria 3302
4 JGI24741J21665_1000053 3300001915 Bacteria 28323
5 JGI24740J21852_10006796 3300001979 Bacteria 4699
6 JGI24737J22298_10001385 3300001990 Bacteria 8609
7 JGI24735J21928_10000905 3300002067 Bacteria 10581
8 JGI24744J21845_10006775 3300002077 Bacteria 2371
9 JGI25162J39368_1000123 3300002737 Bacteria 85062
10 JGI25165J46597_1009353 3300003214 Bacteria 1480
11 rootH2_10291355 3300003320 Bacteria 1721
12 rootH2_10314100 3300003320 Bacteria 1242
13 rootL2_10035342 3300003322 Bacteria 31163
14 rootL2_10108558 3300003322 Bacteria 3843
15 rootL2_10209827 3300003322 Bacteria 1245
16 Ga0006562J51391_1034006 3300003578 Bacteria 2357
17 Ga0055534_1010414 3300003784 Bacteria 1949
18 Ga0058862_11672467 3300004803 Bacteria 1450
19 Ga0065714_10002476 3300005288 Bacteria 16393
20 Ga0065704_10070140 3300005289 Bacteria 482257
21 Ga0065704_10070627 3300005289 Bacteria 18948
22 Ga0065704_10075459 3300005289 Bacteria 5581
23 Ga0065704_10094467 3300005289 Bacteria 2541
24 Ga0065704_10155307 3300005289 Bacteria 1396
25 Ga0070658_10000301 3300005327 Bacteria 42860
26 Ga0070658_10153306 3300005327 Bacteria 1930
27 Ga0070683_100543008 3300005329 Bacteria 1111
28 Ga0070670_100020536 3300005331 Bacteria 5679
29 Ga0070670_100032995 3300005331 Unclassified 4462
30 Ga0070680_100002242 3300005336 Bacteria 14262
31 Ga0070680_100007099 3300005336 Bacteria 8539
32 Ga0070682_100031492 3300005337 Bacteria 3208
33 Ga0068868_100004333 3300005338 Bacteria 9947
34 Ga0070660_100067910 3300005339 Bacteria 2778
35 Ga0070660_100124876 3300005339 Bacteria 2056
36 Ga0070660_100160359 3300005339 Bacteria 1812
37 Ga0070668_100005392 3300005347 Bacteria 9493
38 Ga0070668_100033889 3300005347 Bacteria 3891
39 Ga0070675_100025422 3300005354 Bacteria 4747
40 Ga0070671_100015203 3300005355 Bacteria 6217
41 Ga0070673_100159703 3300005364 Unclassified 1916
42 Ga0070659_100002177 3300005366 Bacteria 13962
43 Ga0070667_100065126 3300005367 Bacteria 3094
44 Ga0070713_100060272 3300005436 Bacteria 3172
45 Ga0070662_100000273 3300005457 Bacteria 30505
46 Ga0070681_10029020 3300005458 Bacteria 5555
47 Ga0070698_100463356 3300005471 Bacteria 1203
48 Ga0070679_100005487 3300005530 Bacteria 11757
49 Ga0068853_100064233 3300005539 Bacteria 3182
50 Ga0068855_100000098 3300005563 Bacteria 105977
51 Ga0068855_100000246 3300005563 Bacteria 68191
52 Ga0068855_100004293 3300005563 Bacteria 17420
53 Ga0068855_100017752 3300005563 Bacteria 8554
54 Ga0068855_100304291 3300005563 Bacteria 1765
55 Ga0068857_100057046 3300005577 Bacteria 3466
56 Ga0068856_100000006 3300005614 Bacteria 223827
57 Ga0068856_100004154 3300005614 Bacteria 14469
58 Ga0068856_100049263 3300005614 Bacteria 4152
59 Ga0068856_100147328 3300005614 Bacteria 2362
60 Ga0068856_100569148 3300005614 Unclassified 1154
61 Ga0068866_10049017 3300005718 Bacteria 2138
62 Ga0068861_100555961 3300005719 Bacteria 1046
63 Ga0068851_10030675 3300005834 Bacteria 2667
64 Ga0068863_100087963 3300005841 Bacteria 2944
65 Ga0097621_100000503 3300006237 Bacteria 27338
66 Ga0075370_10145449 3300006353 Bacteria 1387
67 Ga0068871_100009454 3300006358 Bacteria 7065
68 Ga0068871_100379568 3300006358 Bacteria 1255
69 Ga0075431_100003977 3300006847 Bacteria 14407
70 Ga0075429_100107665 3300006880 Bacteria 2436
71 Ga0097620_100012023 3300006931 Bacteria 8696
72 Ga0105244_10000005 3300009036 Bacteria 481412
73 Ga0105250_10019213 3300009092 Bacteria 2762
74 Ga0105240_10000047 3300009093 Bacteria 239067
75 Ga0111539_10005994 3300009094 Bacteria 15706
76 Ga0114129_10009167 3300009147 Bacteria 14108
77 Ga0105243_10000216 3300009148 Bacteria 67300
78 Ga0105241_10342859 3300009174 Bacteria 1295
79 Ga0105248_10076681 3300009177 Bacteria 3757
80 Ga0105237_10001137 3300009545 Bacteria 35733
81 Ga0105237_10001178 3300009545 Bacteria 34927
82 Ga0105237_10005890 3300009545 Bacteria 13744
83 Ga0105249_10002034 3300009553 Bacteria 17542
84 Ga0105239_10000240 3300010375 Bacteria 81097
85 Ga0105239_10000659 3300010375 Bacteria 49123
86 Ga0105239_10000759 3300010375 Bacteria 45638
87 Ga0105239_10001566 3300010375 Bacteria 30205
88 Ga0157373_10000032 3300013100 Bacteria 126310
89 Ga0157373_10008545 3300013100 Bacteria 7605
90 Ga0157373_10107430 3300013100 Unclassified 1962
91 Ga0157371_10000069 3300013102 Bacteria 165391
92 Ga0157371_10000257 3300013102 Bacteria 73583
93 Ga0157371_10000521 3300013102 Bacteria 45906
94 Ga0157371_10018704 3300013102 Bacteria 5119
95 Ga0157371_10040730 3300013102 Bacteria 3316
96 Ga0157371_10043978 3300013102 Bacteria 3181
97 Ga0157371_10102261 3300013102 Bacteria 2033
98 Ga0157370_10001978 3300013104 Bacteria 25174
99 Ga0157370_10005939 3300013104 Bacteria 13603
100 Ga0157370_10023638 3300013104 Bacteria 6099
101 Ga0157370_10027323 3300013104 Bacteria 5627
102 Ga0157370_10038948 3300013104 Bacteria 4597
103 Ga0157370_10094264 3300013104 Bacteria 2809
104 Ga0157370_10442840 3300013104 Bacteria 1195
105 Ga0157370_10658071 3300013104 Unclassified 957
106 Ga0157369_10000939 3300013105 Bacteria 37034
107 Ga0157369_10384626 3300013105 Bacteria 1456
108 Ga0157374_10009787 3300013296 Bacteria 8233
109 Ga0157374_10015542 3300013296 Bacteria 6677
110 Ga0157374_10283320 3300013296 Unclassified 1636
111 Ga0157378_10000370 3300013297 Bacteria 44420
112 Ga0157378_10282359 3300013297 Bacteria 1601
113 Ga0163162_10003569 3300013306 Bacteria 14879
114 Ga0157372_10000327 3300013307 Bacteria 52004
115 Ga0157372_10006205 3300013307 Bacteria 12701
116 Ga0157372_10006889 3300013307 Bacteria 12091
117 Ga0157372_10027698 3300013307 Bacteria 6175
118 Ga0157372_10184248 3300013307 Bacteria 2418
119 Ga0157372_10220351 3300013307 Bacteria 2199
120 Ga0157372_10627576 3300013307 Unclassified 1252
121 Ga0157372_10854930 3300013307 Bacteria 1056
122 Ga0157372_10872556 3300013307 Unclassified 1044
123 Ga0157375_10000141 3300013308 Bacteria 72136
124 Ga0157375_10005044 3300013308 Bacteria 11468
125 Ga0157375_10196028 3300013308 Bacteria 2175
126 Ga0163163_10000215 3300014325 Bacteria 60028
127 Ga0163163_10170548 3300014325 Unclassified 2222
128 Ga0182008_10000003 3300014497 Bacteria 456880
129 Ga0182008_10000006 3300014497 Bacteria 378521
130 Ga0157377_10018527 3300014745 Bacteria 3619
131 Ga0157379_10094971 3300014968 Bacteria 2675
132 Ga0157376_10000216 3300014969 Bacteria 39942
133 Ga0163161_10000863 3300017792 Bacteria 23632
134 Ga0163161_10017377 3300017792 Bacteria 5033
135 Ga0163161_10033944 3300017792 Bacteria 3648
136 Ga0213872_10010670 3300021361 Bacteria 4366
137 Ga0213876_10011649 3300021384 Bacteria 4694
138 Ga0209437_100251 3300025233 Bacteria 85135
139 Ga0209026_1008604 3300025250 Bacteria 2110
140 Ga0209233_1000478 3300025261 Bacteria 24667
141 Ga0209675_1000066 3300025291 Bacteria 171883
142 Ga0209050_1000879 3300025298 Bacteria 40293
143 Ga0207696_1022969 3300025711 Bacteria 1973
144 Ga0207655_1000016 3300025728 Bacteria 551476
145 Ga0207647_10000041 3300025904 Bacteria 92367
146 Ga0207647_10026626 3300025904 Bacteria 3781
147 Ga0207647_10157567 3300025904 Unclassified 1325
148 Ga0207705_10000336 3300025909 Bacteria 42484
149 Ga0207705_10120920 3300025909 Bacteria 1943
150 Ga0207707_10328831 3300025912 Unclassified 1319
151 Ga0207695_10000010 3300025913 Bacteria 981919
152 Ga0207695_10100705 3300025913 Bacteria 2884
153 Ga0207695_10191219 3300025913 Bacteria 1964
154 Ga0207671_10001141 3300025914 Bacteria 31777
155 Ga0207671_10002987 3300025914 Bacteria 17333
156 Ga0207693_10394890 3300025915 Bacteria 1081
157 Ga0207660_10002900 3300025917 Bacteria 11206
158 Ga0207657_10078242 3300025919 Bacteria 2785
159 Ga0207657_10109050 3300025919 Unclassified 2288
160 Ga0207657_10156634 3300025919 Bacteria 1852
161 Ga0207652_10004076 3300025921 Bacteria 11918
162 Ga0207650_10030832 3300025925 Bacteria 3867
163 Ga0207659_10034471 3300025926 Bacteria 3491
164 Ga0207700_10206768 3300025928 Bacteria 1657
165 Ga0207644_10008407 3300025931 Bacteria 6755
166 Ga0207690_10003394 3300025932 Bacteria 9517
167 Ga0207706_10000380 3300025933 Bacteria 48389
168 Ga0207709_10000084 3300025935 Bacteria 161002
169 Ga0207667_10000014 3300025949 Bacteria 421261
170 Ga0207667_10000823 3300025949 Bacteria 40119
171 Ga0207667_10008112 3300025949 Bacteria 12514
172 Ga0207667_10034884 3300025949 Bacteria 5400
173 Ga0207667_10256749 3300025949 Bacteria 1788
174 Ga0207651_10697176 3300025960 Bacteria 894
175 Ga0207712_10006004 3300025961 Bacteria 7663
176 Ga0207668_10082730 3300025972 Bacteria 2333
177 Ga0207668_10083586 3300025972 Bacteria 2323
178 Ga0207640_10022577 3300025981 Bacteria 3769
179 Ga0207658_10032346 3300025986 Bacteria 3723
180 Ga0207677_10013263 3300026023 Bacteria 4770
181 Ga0207702_10000023 3300026078 Bacteria 189234
182 Ga0207702_10014889 3300026078 Bacteria 6451
183 Ga0207702_10077521 3300026078 Bacteria 2875
184 Ga0207641_10073525 3300026088 Bacteria 2946
185 Ga0207674_10018153 3300026116 Bacteria 7654
186 Ga0207675_100225203 3300026118 Unclassified 1808
187 Ga0307517_10026155 3300028786 Bacteria 7088
188 Ga0265338_10015498 3300028800 Bacteria 8368
189 Ga0265339_10174992 3300031249 Bacteria 1072
190 Ga0307516_10042125 3300031730 Bacteria 4532
191 Ga0307412_10000027 3300031911 Bacteria 214663
192 Ga0307412_10008629 3300031911 Bacteria 5827
193 Ga0307416_100000006 3300032002 Bacteria 466074
194 Ga0307510_10001133 3300033180 Bacteria 28580
195 Ga0373953_0053475 3300035117 Bacteria 1637
196 Ga0373954_0038265 3300035118 Bacteria 2231
197 Ga0395899_0000049 3300037312 Bacteria 225231
198 Ga0395899_0058448 3300037312 Bacteria 2844
199 Ga0395900_0000541 3300037418 Bacteria 52877
200 Ga0395900_0087180 3300037418 Bacteria 3208
201 Ga0395900_0138781 3300037418 Unclassified 2490
202 Ga0395900_0351708 3300037418 Bacteria 1447
203 Ga0395901_0143245 3300038443 Bacteria 2512
204 Ga0400490_48759 3300038726 Bacteria 15842
205 Ga0436365_0599632 3300039437 Bacteria 7051
206 Ga0436365_1081099 3300039437 Bacteria 41037
207 Ga0436360_1195894 3300039438 Bacteria 1127
208 Ga0436361_0033376 3300039447 Bacteria 9178
209 Ga0436361_0295894 3300039447 Bacteria 17469
210 Ga0436361_0318011 3300039447 Bacteria 3391
211 Ga0436361_1138820 3300039447 Bacteria 1143
212 Ga0439465_0003550 3300041413 Bacteria 5082
213 Ga0439445_0001701 3300042004 Bacteria 4831
214 Ga0453683_0295853 3300044673 Bacteria 1035
215 Ga0453684_0001660 3300044712 Bacteria 60336
216 Ga0453684_0001748 3300044712 Bacteria 58096
217 Ga0453684_0075376 3300044712 Bacteria 4240
218 Ga0466968_0036692 3300044735 Bacteria 2055
219 Ga0451576_0009348 3300045051 Bacteria 11372
220 Ga0495627_000022 3300046453 Bacteria 254672
221 Ga0495627_007455 3300046453 Bacteria 4189
222 Ga0495592_0139241 3300046454 Bacteria 1690
223 Ga0495638_0025374 3300046460 Unclassified 3854
224 Ga0495596_0007137 3300046500 Bacteria 5057
225 Ga0495606_0010107 3300046507 Bacteria 7878
226 Ga0495606_0029912 3300046507 Bacteria 3816
227 Ga0495606_0072839 3300046507 Bacteria 2157
228 Ga0495610_0000005 3300046512 Bacteria 924111
229 Ga0495616_0001171 3300046513 Bacteria 18545
230 Ga0495648_0017373 3300046524 Bacteria 5144
231 Ga0495663_0000093 3300046525 Bacteria 39511
232 Ga0495663_0001020 3300046525 Bacteria 9258
233 Ga0495652_0015055 3300046529 Bacteria 6928
234 Ga0495654_0000003 3300046530 Bacteria 863485
235 Ga0495609_0000003 3300046538 Bacteria 711547
236 Ga0495645_0141111 3300046543 Bacteria 1680
237 Ga0495633_0101611 3300046558 Bacteria 1335
238 Ga0495667_0081676 3300046559 Bacteria 2100
239 Ga0495611_0000026 3300046648 Bacteria 118428
240 Ga0495625_0034846 3300046660 Bacteria 3712
241 Ga0495625_0193322 3300046660 Bacteria 1347
242 Ga0495661_0001729 3300046665 Bacteria 17655
243 Ga0495599_0007660 3300046678 Bacteria 6556
244 Ga0495623_0058114 3300046679 Bacteria 2432
245 Ga0495669_0049044 3300046684 Bacteria 1890
246 Ga0495660_0004838 3300046810 Bacteria 8124
247 Ga0495604_0040098 3300047317 Bacteria 3678
248 Ga0495636_0000011 3300047318 Bacteria 87862
249 Ga0495686_0000069 3300047472 Bacteria 217778
250 Ga0495602_0049316 3300048088 Bacteria 3772
251 Ga0496102_0017191 3300048905 Bacteria 6333
252 Ga0496103_0253459 3300048906 Bacteria 1132
253 Ga0496105_0112280 3300048908 Bacteria 2249
254 Ga0496105_0179137 3300048908 Bacteria 1736
255 Ga0496114_0000603 3300048917 Bacteria 26557
256 Ga0496115_0005239 3300048918 Bacteria 9424
257 Ga0496116_0000029 3300048919 Bacteria 422187
258 Ga0496117_0000007 3300048920 Bacteria 720505
259 Ga0496118_0000104 3300048921 Bacteria 157435
260 Ga0496119_0000007 3300048922 Bacteria 475920
261 Ga0496122_0000222 3300048925 Bacteria 126693
262 Ga0496122_0000724 3300048925 Bacteria 64522
263 Ga0496122_0003160 3300048925 Bacteria 22018
264 Ga0496122_0003562 3300048925 Bacteria 20353
265 Ga0496122_0009530 3300048925 Bacteria 10205
266 Ga0496123_0000592 3300048926 Bacteria 61754
267 Ga0496123_0012316 3300048926 Bacteria 7304
268 Ga0496123_0014775 3300048926 Bacteria 6446
269 Ga0496124_0005164 3300048927 Bacteria 14855
270 Ga0496124_0267149 3300048927 Bacteria 1255
271 Ga0496125_0000498 3300048928 Bacteria 68479
272 Ga0496125_0012483 3300048928 Bacteria 8430
273 Ga0496125_0018950 3300048928 Bacteria 6513
274 Ga0496126_0001962 3300048929 Bacteria 29153
275 Ga0501034_0087055 3300049571 Bacteria 3124
276 Ga0501036_0407963 3300049572 Unclassified 1133
277 Ga0501251_000464 3300049681 Bacteria 3624
278 Ga0501269_000031 3300049766 Bacteria 44939
279 Ga0501035_0008102 3300049822 Bacteria 9794
280 nmdc:mga03683_898_c1 3300050489 Bacteria 8564
281 nmdc:mga0k408_17819_c1 3300050493 Bacteria 3959
282 nmdc:mga0k408_3920_c1 3300050493 Bacteria 7891
283 nmdc:mga0k408_3984_c1 3300050493 Bacteria 7831
284 nmdc:mga07m45_20261_c1 3300050496 Bacteria 1395
285 nmdc:mga07m45_224566_c1 3300050496 Bacteria 1093
286 nmdc:mga05p37_72145_c1 3300050507 Unclassified 4248
287 nmdc:mga09592_377139_c1 3300050508 Unclassified 1226
288 nmdc:mga09592_53168_c1 3300050508 Bacteria 3419
289 nmdc:mga06r32_32403_c1 3300050510 Bacteria 4917
290 nmdc:mga08y16_76985_c1 3300050511 Bacteria 3477
291 Ga0495601_0023125 3300053077 Bacteria 3818
292 Ga0495619_0057616 3300053085 Bacteria 2578
293 Ga0500651_0085454 3300053093 Bacteria 1949
294 Ga0500555_000802 3300053103 Bacteria 11320
295 Ga0500556_0000441 3300053104 Bacteria 29701
296 Ga0500642_0047502 3300053130 Bacteria 1881
297 Ga0500564_043652 3300053138 Bacteria 2061
298 Ga0500568_0001850 3300053139 Bacteria 13039
299 Ga0500622_0002113 3300053156 Bacteria 14791
300 Ga0501084_0195422 3300054114 Bacteria 1707

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10627576 Ga0157372_106275762 228
2 3300005289 Ga0065704_10075459 Ga0065704_100754593 237
3 3300013102 Ga0157371_10018704 Ga0157371_100187045 237
4 3300013104 Ga0157370_10658071 Ga0157370_106580711 237
5 3300013104 Ga0157370_10442840 Ga0157370_104428402 248
6 3300053085 Ga0495619_0057616 Ga0495619_0057616_70_828 249
7 3300005339 Ga0070660_100160359 Ga0070660_1001603592 252
8 3300025919 Ga0207657_10156634 Ga0207657_101566342 252
9 3300003320 rootH2_10314100 rootH2_103141002 255
10 3300005563 Ga0068855_100017752 Ga0068855_1000177523 256
11 3300013102 Ga0157371_10043978 Ga0157371_100439782 256
12 3300025949 Ga0207667_10034884 Ga0207667_100348843 256
13 3300039447 Ga0436361_0318011 Ga0436361_0318011_556_1332 256
14 3300050493 nmdc:mga0k408_17819_c1 nmdc:mga0k408_17819_c1_1775_2638 256
15 3300014497 Ga0182008_10000006 Ga0182008_10000006163 258
16 3300039437 Ga0436365_0599632 Ga0436365_0599632_4999_5841 260
17 3300037418 Ga0395900_0000541 Ga0395900_0000541_49077_49940 261
18 3300037418 Ga0395900_0351708 Ga0395900_0351708_423_1286 261
19 3300009545 Ga0105237_10001178 Ga0105237_1000117826 263
20 3300025914 Ga0207671_10001141 Ga0207671_1000114126 263
21 3300025981 Ga0207640_10022577 Ga0207640_100225774 263
22 3300053093 Ga0500651_0085454 Ga0500651_0085454_771_1610 263
23 3300002737 JGI25162J39368_1000123 JGI25162J39368_100012375 264
24 3300006353 Ga0075370_10145449 Ga0075370_101454492 264
25 3300009545 Ga0105237_10005890 Ga0105237_100058907 264
26 3300010375 Ga0105239_10000759 Ga0105239_100007598 264
27 3300010375 Ga0105239_10001566 Ga0105239_1000156619 264
28 3300025233 Ga0209437_100251 Ga0209437_10025173 264
29 3300025914 Ga0207671_10002987 Ga0207671_1000298712 264
30 3300050489 nmdc:mga03683_898_c1 nmdc:mga03683_898_c1_7279_8079 264
31 3300050493 nmdc:mga0k408_3920_c1 nmdc:mga0k408_3920_c1_5106_5906 264
32 3300050493 nmdc:mga0k408_3984_c1 nmdc:mga0k408_3984_c1_1723_2523 264
33 3300050496 nmdc:mga07m45_20261_c1 nmdc:mga07m45_20261_c1_144_944 264
34 3300053103 Ga0500555_000802 Ga0500555_000802_7597_8397 264
35 3300053104 Ga0500556_0000441 Ga0500556_0000441_2925_3725 264
36 3300053138 Ga0500564_043652 Ga0500564_043652_1107_1964 264
37 3300005327 Ga0070658_10153306 Ga0070658_101533061 266
38 3300005563 Ga0068855_100000098 Ga0068855_10000009879 266
39 3300025909 Ga0207705_10120920 Ga0207705_101209203 266
40 3300025949 Ga0207667_10000014 Ga0207667_10000014184 266
41 3300044712 Ga0453684_0075376 Ga0453684_0075376_916_1794 266
42 3300046460 Ga0495638_0025374 Ga0495638_0025374_613_1428 266
43 3300005355 Ga0070671_100015203 Ga0070671_1000152036 267
44 3300013307 Ga0157372_10027698 Ga0157372_100276983 267
45 3300025904 Ga0207647_10157567 Ga0207647_101575672 267
46 3300025931 Ga0207644_10008407 Ga0207644_100084074 267
47 3300005339 Ga0070660_100124876 Ga0070660_1001248761 268
48 3300005539 Ga0068853_100064233 Ga0068853_1000642331 268
49 3300021361 Ga0213872_10010670 Ga0213872_100106703 268
50 3300025919 Ga0207657_10109050 Ga0207657_101090501 268
51 3300037312 Ga0395899_0000049 Ga0395899_0000049_35237_36085 268
52 3300037418 Ga0395900_0138781 Ga0395900_0138781_143_991 268
53 3300039447 Ga0436361_0033376 Ga0436361_0033376_6776_7639 268
54 3300046513 Ga0495616_0001171 Ga0495616_0001171_1610_2473 268
55 3300046660 Ga0495625_0034846 Ga0495625_0034846_1587_2450 268
56 3300005327 Ga0070658_10000301 Ga0070658_1000030136 269
57 3300005457 Ga0070662_100000273 Ga0070662_10000027324 269
58 3300013296 Ga0157374_10015542 Ga0157374_100155425 269
59 3300013296 Ga0157374_10283320 Ga0157374_102833202 269
60 3300013308 Ga0157375_10196028 Ga0157375_101960282 269
61 3300014745 Ga0157377_10018527 Ga0157377_100185272 269
62 3300025909 Ga0207705_10000336 Ga0207705_100003367 269
63 3300025933 Ga0207706_10000380 Ga0207706_1000038014 269
64 3300046810 Ga0495660_0004838 Ga0495660_0004838_4726_5589 269
65 3300002077 JGI24744J21845_10006775 JGI24744J21845_100067752 270
66 3300005331 Ga0070670_100032995 Ga0070670_1000329952 270
67 3300005336 Ga0070680_100007099 Ga0070680_1000070996 270
68 3300005563 Ga0068855_100000246 Ga0068855_10000024641 270
69 3300005614 Ga0068856_100000006 Ga0068856_100000006132 270
70 3300005614 Ga0068856_100004154 Ga0068856_10000415415 270
71 3300009093 Ga0105240_10000047 Ga0105240_1000004746 270
72 3300010375 Ga0105239_10000240 Ga0105239_1000024045 270
73 3300013100 Ga0157373_10107430 Ga0157373_101074302 270
74 3300013104 Ga0157370_10023638 Ga0157370_100236385 270
75 3300013296 Ga0157374_10009787 Ga0157374_100097879 270
76 3300025904 Ga0207647_10026626 Ga0207647_100266263 270
77 3300025913 Ga0207695_10000010 Ga0207695_10000010193 270
78 3300025949 Ga0207667_10000823 Ga0207667_1000082323 270
79 3300026078 Ga0207702_10000023 Ga0207702_10000023116 270
80 3300026078 Ga0207702_10014889 Ga0207702_100148893 270
81 3300028786 Ga0307517_10026155 Ga0307517_100261554 270
82 3300033180 Ga0307510_10001133 Ga0307510_1000113317 270
83 3300046660 Ga0495625_0193322 Ga0495625_0193322_312_1175 270
84 3300053130 Ga0500642_0047502 Ga0500642_0047502_379_1245 270
85 2162886007 SwRhRL2b_contig_503364 SwRhRL2b_0983.00001120 271
86 3300005289 Ga0065704_10070627 Ga0065704_100706275 271
87 3300013307 Ga0157372_10854930 Ga0157372_108549302 271
88 3300025913 Ga0207695_10191219 Ga0207695_101912192 271
89 3300028800 Ga0265338_10015498 Ga0265338_100154986 271
90 3300031249 Ga0265339_10174992 Ga0265339_101749922 271
91 3300046507 Ga0495606_0010107 Ga0495606_0010107_1282_2145 271
92 3300046665 Ga0495661_0001729 Ga0495661_0001729_7365_8222 271
93 3300046684 Ga0495669_0049044 Ga0495669_0049044_595_1458 271
94 3300048925 Ga0496122_0000222 Ga0496122_0000222_76669_77517 271
95 3300048926 Ga0496123_0012316 Ga0496123_0012316_1299_2147 271
96 3300013104 Ga0157370_10005939 Ga0157370_100059399 272
97 3300014325 Ga0163163_10000215 Ga0163163_1000021546 272
98 3300025298 Ga0209050_1000879 Ga0209050_100087924 272
99 3300049572 Ga0501036_0407963 Ga0501036_0407963_115_987 272
100 3300054114 Ga0501084_0195422 Ga0501084_0195422_364_1236 272
101 3300005289 Ga0065704_10155307 Ga0065704_101553071 273
102 3300005563 Ga0068855_100004293 Ga0068855_10000429316 273
103 3300025913 Ga0207695_10100705 Ga0207695_101007053 273
104 3300025949 Ga0207667_10008112 Ga0207667_100081125 273
105 3300004803 Ga0058862_11672467 Ga0058862_116724672 274
106 3300005336 Ga0070680_100002242 Ga0070680_1000022423 274
107 3300005458 Ga0070681_10029020 Ga0070681_100290204 274
108 3300005530 Ga0070679_100005487 Ga0070679_1000054878 274
109 3300025912 Ga0207707_10328831 Ga0207707_103288312 274
110 3300025917 Ga0207660_10002900 Ga0207660_100029001 274
111 3300025921 Ga0207652_10004076 Ga0207652_100040768 274
112 3300053139 Ga0500568_0001850 Ga0500568_0001850_2771_3601 274
113 3300005354 Ga0070675_100025422 Ga0070675_1000254221 275
114 3300009094 Ga0111539_10005994 Ga0111539_100059947 275
115 3300025926 Ga0207659_10034471 Ga0207659_100344713 275
116 3300050511 nmdc:mga08y16_76985_c1 nmdc:mga08y16_76985_c1_201_1061 275
117 iso_pu_bacteria 2738541284 2738760244 275
118 3300039447 Ga0436361_1138820 Ga0436361_1138820_26_1084 276
119 3300044712 Ga0453684_0001748 Ga0453684_0001748_54552_55409 276
120 3300048925 Ga0496122_0009530 Ga0496122_0009530_4680_5528 276
121 3300006847 Ga0075431_100003977 Ga0075431_1000039774 277
122 3300006880 Ga0075429_100107665 Ga0075429_1001076652 277
123 3300009147 Ga0114129_10009167 Ga0114129_1000916714 277
124 3300021384 Ga0213876_10011649 Ga0213876_100116492 277
125 3300039437 Ga0436365_1081099 Ga0436365_1081099_37138_37980 277
126 3300046453 Ga0495627_007455 Ga0495627_007455_2337_3185 277
127 3300047472 Ga0495686_0000069 Ga0495686_0000069_89792_90640 277
128 3300050507 nmdc:mga05p37_72145_c1 nmdc:mga05p37_72145_c1_245_1105 277
129 3300050508 nmdc:mga09592_53168_c1 nmdc:mga09592_53168_c1_1263_2123 277
130 3300050510 nmdc:mga06r32_32403_c1 nmdc:mga06r32_32403_c1_3716_4576 277
131 iso_pu_bacteria 2585428115 2587944699 277
132 iso_pu_bacteria 2842083920 2842087281 277
133 iso_pu_bacteria 2905999023 2905999088 277
134 iso_pu_bacteria 2511231000 2511235059 278
135 iso_pu_bacteria 2523533629 2524004373 278
136 iso_pu_bacteria 2523533629 2524006707 278
137 iso_pu_bacteria 2582581278 2585140986 278
138 iso_pu_bacteria 2582581281 2585159075 278
139 iso_pu_bacteria 2582581282 2585163338 278
140 iso_pu_bacteria 2582581873 2585425994 278
141 iso_pu_bacteria 2585428045 2587677128 278
142 iso_pu_bacteria 2585428060 2587746335 278
143 iso_pu_bacteria 2585428182 2588211393 278
144 iso_pu_bacteria 2585428183 2588215770 278
145 iso_pu_bacteria 2585428184 2588219168 278
146 iso_pu_bacteria 2585428185 2588224669 278
147 iso_pu_bacteria 2588253712 2588447455 278
148 iso_pu_bacteria 2588254255 2590603088 278
149 iso_pu_bacteria 2588254257 2590610091 278
150 iso_pu_bacteria 2728369107 2729200897 278
151 iso_pu_bacteria 2739367874 2740060320 278
152 iso_pu_bacteria 2751185877 2753674102 278
153 iso_pu_bacteria 2765235839 2765575570 278
154 iso_pu_bacteria 2772190705 2772603791 278
155 iso_pu_bacteria 2775506739 2775674421 278
156 iso_pu_bacteria 2816332188 2816875423 278
157 iso_pu_bacteria 2871720351 2871723495 278
158 iso_pu_bacteria 2889290771 2889293919 278
159 iso_pu_bacteria 2919097161 2919098037 278
160 iso_pu_bacteria 2919399522 2919403296 278
161 iso_pu_bacteria 2946019816 2946023979 278
162 iso_pu_bacteria 2977243572 2977243631 278
163 iso_pu_bacteria 2984572630 2984574369 278
164 iso_pu_bacteria 2984606641 2984607819 278
165 iso_pu_bacteria 2993372514 2993375192 278
166 iso_pu_bacteria 2993480792 2993482052 278
167 3300044673 Ga0453683_0295853 Ga0453683_0295853_67_912 279
168 3300045051 Ga0451576_0009348 Ga0451576_0009348_1011_1856 279
169 3300013104 Ga0157370_10094264 Ga0157370_100942642 280
170 3300017792 Ga0163161_10000863 Ga0163161_1000086322 280
171 3300035117 Ga0373953_0053475 Ga0373953_0053475_512_1363 280
172 3300035118 Ga0373954_0038265 Ga0373954_0038265_1038_1889 280
173 3300038726 Ga0400490_48759 Ga0400490_48759_3631_4479 280
174 3300046454 Ga0495592_0139241 Ga0495592_0139241_465_1316 280
175 3300046507 Ga0495606_0072839 Ga0495606_0072839_1011_1862 280
176 3300046529 Ga0495652_0015055 Ga0495652_0015055_2781_3632 280
177 3300046543 Ga0495645_0141111 Ga0495645_0141111_771_1622 280
178 3300046559 Ga0495667_0081676 Ga0495667_0081676_846_1697 280
179 3300046678 Ga0495599_0007660 Ga0495599_0007660_2412_3263 280
180 3300046679 Ga0495623_0058114 Ga0495623_0058114_195_1046 280
181 3300047317 Ga0495604_0040098 Ga0495604_0040098_2573_3424 280
182 3300048088 Ga0495602_0049316 Ga0495602_0049316_2507_3358 280
183 3300049822 Ga0501035_0008102 Ga0501035_0008102_7973_8815 280
184 3300053077 Ga0495601_0023125 Ga0495601_0023125_2627_3478 280
185 3300003322 rootL2_10035342 rootL2_1003534224 281
186 3300003322 rootL2_10209827 rootL2_102098272 281
187 3300005614 Ga0068856_100147328 Ga0068856_1001473282 281
188 3300017792 Ga0163161_10033944 Ga0163161_100339443 281
189 3300031911 Ga0307412_10000027 Ga0307412_1000002720 281
190 3300032002 Ga0307416_100000006 Ga0307416_100000006189 281
191 3300044712 Ga0453684_0001660 Ga0453684_0001660_33811_34656 281
192 3300046453 Ga0495627_000022 Ga0495627_000022_114429_115277 281
193 3300046512 Ga0495610_0000005 Ga0495610_0000005_305372_306217 281
194 3300046530 Ga0495654_0000003 Ga0495654_0000003_605235_606083 281
195 3300050508 nmdc:mga09592_377139_c1 nmdc:mga09592_377139_c1_347_1201 281
196 3300001915 JGI24741J21665_1000053 JGI24741J21665_100005312 282
197 3300003578 Ga0006562J51391_1034006 Ga0006562J51391_10340062 282
198 3300003784 Ga0055534_1010414 Ga0055534_10104142 282
199 3300005288 Ga0065714_10002476 Ga0065714_100024767 282
200 3300005337 Ga0070682_100031492 Ga0070682_1000314923 282
201 3300005339 Ga0070660_100067910 Ga0070660_1000679103 282
202 3300005347 Ga0070668_100005392 Ga0070668_1000053922 282
203 3300005347 Ga0070668_100033889 Ga0070668_1000338893 282
204 3300005436 Ga0070713_100060272 Ga0070713_1000602724 282
205 3300009036 Ga0105244_10000005 Ga0105244_10000005338 282
206 3300009092 Ga0105250_10019213 Ga0105250_100192132 282
207 3300009148 Ga0105243_10000216 Ga0105243_1000021645 282
208 3300013100 Ga0157373_10000032 Ga0157373_1000003255 282
209 3300013104 Ga0157370_10001978 Ga0157370_100019789 282
210 3300013308 Ga0157375_10000141 Ga0157375_100001416 282
211 3300014497 Ga0182008_10000003 Ga0182008_1000000392 282
212 3300025291 Ga0209675_1000066 Ga0209675_1000066152 282
213 3300025711 Ga0207696_1022969 Ga0207696_10229692 282
214 3300025728 Ga0207655_1000016 Ga0207655_1000016337 282
215 3300025919 Ga0207657_10078242 Ga0207657_100782422 282
216 3300025928 Ga0207700_10206768 Ga0207700_102067682 282
217 3300025935 Ga0207709_10000084 Ga0207709_100000844 282
218 3300025972 Ga0207668_10082730 Ga0207668_100827302 282
219 3300025972 Ga0207668_10083586 Ga0207668_100835862 282
220 3300031911 Ga0307412_10008629 Ga0307412_100086292 282
221 3300041413 Ga0439465_0003550 Ga0439465_0003550_3818_4666 282
222 3300042004 Ga0439445_0001701 Ga0439445_0001701_168_1016 282
223 3300046500 Ga0495596_0007137 Ga0495596_0007137_3103_3951 282
224 3300046507 Ga0495606_0029912 Ga0495606_0029912_1050_1898 282
225 3300046525 Ga0495663_0000093 Ga0495663_0000093_21838_22695 282
226 3300046525 Ga0495663_0001020 Ga0495663_0001020_4077_4925 282
227 3300046538 Ga0495609_0000003 Ga0495609_0000003_607706_608563 282
228 3300048905 Ga0496102_0017191 Ga0496102_0017191_3414_4262 282
229 3300048906 Ga0496103_0253459 Ga0496103_0253459_102_950 282
230 3300048908 Ga0496105_0112280 Ga0496105_0112280_1387_2235 282
231 3300048919 Ga0496116_0000029 Ga0496116_0000029_201562_202410 282
232 3300048920 Ga0496117_0000007 Ga0496117_0000007_201380_202228 282
233 3300048921 Ga0496118_0000104 Ga0496118_0000104_124464_125312 282
234 3300048922 Ga0496119_0000007 Ga0496119_0000007_201447_202295 282
235 3300048925 Ga0496122_0000724 Ga0496122_0000724_58367_59215 282
236 3300048925 Ga0496122_0003160 Ga0496122_0003160_10343_11191 282
237 3300048925 Ga0496122_0003562 Ga0496122_0003562_4341_5189 282
238 3300048926 Ga0496123_0000592 Ga0496123_0000592_5806_6654 282
239 3300048926 Ga0496123_0014775 Ga0496123_0014775_3046_3894 282
240 3300048927 Ga0496124_0005164 Ga0496124_0005164_4030_4878 282
241 3300048927 Ga0496124_0267149 Ga0496124_0267149_322_1170 282
242 3300048928 Ga0496125_0000498 Ga0496125_0000498_17014_17862 282
243 3300048928 Ga0496125_0012483 Ga0496125_0012483_4942_5790 282
244 3300048928 Ga0496125_0018950 Ga0496125_0018950_313_1161 282
245 3300048929 Ga0496126_0001962 Ga0496126_0001962_5146_5994 282
246 3300049681 Ga0501251_000464 Ga0501251_000464_2058_2906 282
247 3300049766 Ga0501269_000031 Ga0501269_000031_2277_3125 282
248 3300050496 nmdc:mga07m45_224566_c1 nmdc:mga07m45_224566_c1_190_1044 282
249 iso_pu_bacteria 2585428061 2587752531 282
250 3300003320 rootH2_10291355 rootH2_102913552 283
251 3300003322 rootL2_10108558 rootL2_101085584 283
252 3300005329 Ga0070683_100543008 Ga0070683_1005430081 283
253 3300005338 Ga0068868_100004333 Ga0068868_1000043335 283
254 3300005364 Ga0070673_100159703 Ga0070673_1001597032 283
255 3300005367 Ga0070667_100065126 Ga0070667_1000651263 283
256 3300005614 Ga0068856_100569148 Ga0068856_1005691482 283
257 3300005718 Ga0068866_10049017 Ga0068866_100490172 283
258 3300006237 Ga0097621_100000503 Ga0097621_1000005032 283
259 3300006358 Ga0068871_100009454 Ga0068871_1000094544 283
260 3300006358 Ga0068871_100379568 Ga0068871_1003795682 283
261 3300009174 Ga0105241_10342859 Ga0105241_103428592 283
262 3300009177 Ga0105248_10076681 Ga0105248_100766812 283
263 3300013100 Ga0157373_10008545 Ga0157373_100085458 283
264 3300013102 Ga0157371_10000069 Ga0157371_1000006919 283
265 3300013102 Ga0157371_10000521 Ga0157371_1000052131 283
266 3300013102 Ga0157371_10040730 Ga0157371_100407302 283
267 3300013104 Ga0157370_10027323 Ga0157370_100273236 283
268 3300013105 Ga0157369_10000939 Ga0157369_100009398 283
269 3300013297 Ga0157378_10000370 Ga0157378_1000037018 283
270 3300013297 Ga0157378_10282359 Ga0157378_102823592 283
271 3300013306 Ga0163162_10003569 Ga0163162_1000356912 283
272 3300013307 Ga0157372_10006205 Ga0157372_1000620511 283
273 3300013307 Ga0157372_10006889 Ga0157372_100068897 283
274 3300013308 Ga0157375_10005044 Ga0157375_100050442 283
275 3300014968 Ga0157379_10094971 Ga0157379_100949713 283
276 3300014969 Ga0157376_10000216 Ga0157376_1000021633 283
277 3300017792 Ga0163161_10017377 Ga0163161_100173773 283
278 3300025250 Ga0209026_1008604 Ga0209026_10086042 283
279 3300025960 Ga0207651_10697176 Ga0207651_106971761 283
280 3300025986 Ga0207658_10032346 Ga0207658_100323463 283
281 3300026023 Ga0207677_10013263 Ga0207677_100132631 283
282 3300037312 Ga0395899_0058448 Ga0395899_0058448_212_1063 283
283 3300037418 Ga0395900_0087180 Ga0395900_0087180_1599_2450 283
284 3300044735 Ga0466968_0036692 Ga0466968_0036692_1028_1879 283
285 3300046648 Ga0495611_0000026 Ga0495611_0000026_105310_106167 283
286 3300048908 Ga0496105_0179137 Ga0496105_0179137_539_1399 283
287 iso_pu_bacteria 2881955468 2881958415 283
288 iso_pu_bacteria 2898713307 2898714092 283
289 3300001904 JGI24736J21556_1002406 JGI24736J21556_10024063 284
290 3300001979 JGI24740J21852_10006796 JGI24740J21852_100067962 284
291 3300001990 JGI24737J22298_10001385 JGI24737J22298_100013852 284
292 3300002067 JGI24735J21928_10000905 JGI24735J21928_100009055 284
293 3300003214 JGI25165J46597_1009353 JGI25165J46597_10093532 284
294 3300005331 Ga0070670_100020536 Ga0070670_1000205362 284
295 3300005366 Ga0070659_100002177 Ga0070659_1000021773 284
296 3300005471 Ga0070698_100463356 Ga0070698_1004633561 284
297 3300005563 Ga0068855_100304291 Ga0068855_1003042912 284
298 3300005577 Ga0068857_100057046 Ga0068857_1000570463 284
299 3300005834 Ga0068851_10030675 Ga0068851_100306752 284
300 3300010375 Ga0105239_10000659 Ga0105239_1000065915 284
301 3300013102 Ga0157371_10000257 Ga0157371_1000025746 284
302 3300013104 Ga0157370_10038948 Ga0157370_100389483 284
303 3300013105 Ga0157369_10384626 Ga0157369_103846261 284
304 3300013307 Ga0157372_10000327 Ga0157372_1000032740 284
305 3300025261 Ga0209233_1000478 Ga0209233_100047810 284
306 3300025904 Ga0207647_10000041 Ga0207647_1000004146 284
307 3300025915 Ga0207693_10394890 Ga0207693_103948901 284
308 3300025925 Ga0207650_10030832 Ga0207650_100308322 284
309 3300025932 Ga0207690_10003394 Ga0207690_100033943 284
310 3300025949 Ga0207667_10256749 Ga0207667_102567492 284
311 3300026116 Ga0207674_10018153 Ga0207674_100181532 284
312 3300038443 Ga0395901_0143245 Ga0395901_0143245_985_1857 284
313 3300039438 Ga0436360_1195894 Ga0436360_1195894_25_948 284
314 3300039447 Ga0436361_0295894 Ga0436361_0295894_9619_10533 284
315 3300005289 Ga0065704_10094467 Ga0065704_100944672 285
316 3300005614 Ga0068856_100049263 Ga0068856_1000492632 285
317 3300026078 Ga0207702_10077521 Ga0207702_100775212 285
318 3300049571 Ga0501034_0087055 Ga0501034_0087055_2081_3037 285
319 2162886007 SwRhRL2b_contig_1663050 SwRhRL2b_0644.00006130 286
320 3300005289 Ga0065704_10070140 Ga0065704_10070140328 286
321 3300005719 Ga0068861_100555961 Ga0068861_1005559612 286
322 3300005841 Ga0068863_100087963 Ga0068863_1000879633 286
323 3300006931 Ga0097620_100012023 Ga0097620_1000120237 286
324 3300009545 Ga0105237_10001137 Ga0105237_1000113715 286
325 3300009553 Ga0105249_10002034 Ga0105249_1000203418 286
326 3300013102 Ga0157371_10102261 Ga0157371_101022612 286
327 3300013307 Ga0157372_10184248 Ga0157372_101842482 286
328 3300013307 Ga0157372_10220351 Ga0157372_102203511 286
329 3300013307 Ga0157372_10872556 Ga0157372_108725561 286
330 3300014325 Ga0163163_10170548 Ga0163163_101705483 286
331 3300025961 Ga0207712_10006004 Ga0207712_1000600410 286
332 3300026088 Ga0207641_10073525 Ga0207641_100735253 286
333 3300026118 Ga0207675_100225203 Ga0207675_1002252032 286
334 3300031730 Ga0307516_10042125 Ga0307516_100421252 286
335 3300046524 Ga0495648_0017373 Ga0495648_0017373_674_1549 286
336 3300046558 Ga0495633_0101611 Ga0495633_0101611_262_1128 286
337 3300047318 Ga0495636_0000011 Ga0495636_0000011_63039_63905 286
338 3300048917 Ga0496114_0000603 Ga0496114_0000603_16762_17634 286
339 3300048918 Ga0496115_0005239 Ga0496115_0005239_885_1748 286
340 3300053156 Ga0500622_0002113 Ga0500622_0002113_9532_10407 286
341 iso_pu_bacteria 2786546548 2787507227 286
342 iso_pu_bacteria 2910245624 2910246660 286

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

66

279

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.9002 34 277
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.8836 34 277
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8726 34 277
6m96-assembly1.cif.gz_B-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.8661 34 280
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.8443 34 277
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6371 88 274 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6148 60 274 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5502 80 275 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4907 60 274 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4593 88 274 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A5B5W015-F1-model_v4 deleted 0.9779 52 282
AF-A0A4Q5YB90-F1-model_v4 Transport permease protein 0.9772 49 282 GO:0015920
GO:0043190
GO:0140359
AF-A0A3D3D577-F1-model_v4 deleted 0.9681 38 282
AF-A0A5B5W015-F1-model_v4 deleted 0.9575 52 282
AF-A0A1M7BHU4-F1-model_v4 Transport permease protein 0.9574 48 282 GO:0015920
GO:0043190
GO:0140359

Feature Viewer

pLDDT pTM Quality
83.96 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map