F415228

General Info

Members Datasets Scaffolds Average Seq Length
342 205 684 116

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10616438|Ga0307414_106164382
Length 120
Sequence MTENKRAVDRTPVTSEIVGNVTVFQAMTILNLSEAGIQIETPYKLQNDSLHDFRLSLGDRSVVVKGRIVYCQVGELSEERVIYRSGVEFVTVPPHALAAVREFVAVHNGPPTAILDGEIA

Samples

Sample ID Description Type Environment
1 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
131 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
135 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
136 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
137 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
158 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
159 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
160 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
188 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
189 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
190 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 1.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.75
Rhizosphere 97.08
Stem 0
Stem Tuber 0
Unclassified 33.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307414_10616438 3300032004 Bacteria 975
2 Ga0058863_11876878 3300004799 Unclassified 649
3 Ga0065707_10300605 3300005295 Bacteria 1005
4 Ga0065707_10996529 3300005295 Unclassified 540
5 Ga0070676_10539951 3300005328 Bacteria 833
6 Ga0070676_11096397 3300005328 Unclassified 601
7 Ga0070683_100885921 3300005329 Bacteria 856
8 Ga0070683_101549201 3300005329 Unclassified 637
9 Ga0070690_100188759 3300005330 Unclassified 1428
10 Ga0070690_101628702 3300005330 Unclassified 524
11 Ga0068869_100374855 3300005334 Bacteria 1165
12 Ga0070666_10004379 3300005335 Bacteria 8601
13 Ga0070666_10274740 3300005335 Bacteria 1197
14 Ga0070666_11391626 3300005335 Unclassified 524
15 Ga0070680_101899269 3300005336 Unclassified 516
16 Ga0068868_100188783 3300005338 Bacteria 1713
17 Ga0068868_100240691 3300005338 Bacteria 1520
18 Ga0068868_100857954 3300005338 Unclassified 823
19 Ga0070691_10422002 3300005341 Bacteria 756
20 Ga0070687_100006236 3300005343 Bacteria 4878
21 Ga0070675_100000352 3300005354 Bacteria 31035
22 Ga0070671_101507060 3300005355 Unclassified 595
23 Ga0070671_102096243 3300005355 Bacteria 504
24 Ga0070674_100688564 3300005356 Bacteria 873
25 Ga0070673_100010669 3300005364 Bacteria 6230
26 Ga0070659_100482761 3300005366 Bacteria 1055
27 Ga0070659_100846267 3300005366 Unclassified 797
28 Ga0070713_100157508 3300005436 Bacteria 2025
29 Ga0070713_100672437 3300005436 Unclassified 987
30 Ga0070701_10173578 3300005438 Bacteria 1257
31 Ga0070711_100066441 3300005439 Bacteria 2526
32 Ga0070711_100404589 3300005439 Unclassified 1109
33 Ga0070708_100463803 3300005445 Unclassified 1195
34 Ga0070681_10395536 3300005458 Unclassified 1293
35 Ga0068867_100157538 3300005459 Bacteria 1789
36 Ga0068867_101682291 3300005459 Unclassified 595
37 Ga0070707_102173195 3300005468 Bacteria 522
38 Ga0070699_100083410 3300005518 Unclassified 2788
39 Ga0070699_100190673 3300005518 Bacteria 1821
40 Ga0070699_100349409 3300005518 Unclassified 1332
41 Ga0070679_100952960 3300005530 Unclassified 802
42 Ga0070684_100046368 3300005535 Bacteria 3766
43 Ga0070684_100383814 3300005535 Bacteria 1294
44 Ga0070697_100009648 3300005536 Bacteria 7540
45 Ga0070697_100870309 3300005536 Bacteria 799
46 Ga0070697_101077559 3300005536 Unclassified 715
47 Ga0068853_100439923 3300005539 Bacteria 1225
48 Ga0070672_100972461 3300005543 Unclassified 751
49 Ga0070672_101217861 3300005543 Bacteria 671
50 Ga0070672_101802668 3300005543 Bacteria 550
51 Ga0070686_100001833 3300005544 Bacteria 11855
52 Ga0070686_101209050 3300005544 Bacteria 628
53 Ga0070696_100155424 3300005546 Unclassified 1682
54 Ga0070696_100897074 3300005546 Bacteria 735
55 Ga0070693_100161546 3300005547 Bacteria 1427
56 Ga0070693_100322859 3300005547 Bacteria 1048
57 Ga0070693_100355435 3300005547 Unclassified 1004
58 Ga0070665_100111996 3300005548 Bacteria 2732
59 Ga0070704_100851874 3300005549 Unclassified 817
60 Ga0068855_101848189 3300005563 Bacteria 613
61 Ga0068854_100225020 3300005578 Bacteria 1486
62 Ga0068854_100378633 3300005578 Bacteria 1166
63 Ga0068859_100496410 3300005617 Unclassified 1316
64 Ga0068859_100641917 3300005617 Bacteria 1154
65 Ga0068864_101403801 3300005618 Bacteria 700
66 Ga0068866_10069572 3300005718 Bacteria 1855
67 Ga0068866_10334265 3300005718 Unclassified 957
68 Ga0068861_100390047 3300005719 Bacteria 1233
69 Ga0068861_100762983 3300005719 Bacteria 904
70 Ga0068861_100871494 3300005719 Bacteria 850
71 Ga0068861_102136374 3300005719 Bacteria 560
72 Ga0068870_10954907 3300005840 Unclassified 609
73 Ga0068863_100099237 3300005841 Bacteria 2767
74 Ga0068858_100234833 3300005842 Bacteria 1739
75 Ga0068858_100304481 3300005842 Bacteria 1521
76 Ga0068860_100033129 3300005843 Bacteria 4959
77 Ga0068860_100739896 3300005843 Unclassified 995
78 Ga0068860_101202922 3300005843 Bacteria 778
79 Ga0068862_100753709 3300005844 Unclassified 947
80 Ga0068862_101336331 3300005844 Unclassified 719
81 Ga0081455_10112799 3300005937 Bacteria 2157
82 Ga0070715_10382890 3300006163 Bacteria 777
83 Ga0070715_10517378 3300006163 Bacteria 686
84 Ga0070712_100438688 3300006175 Unclassified 1085
85 Ga0097621_100000075 3300006237 Bacteria 51581
86 Ga0097621_100014802 3300006237 Bacteria 5849
87 Ga0097621_100031344 3300006237 Bacteria 4218
88 Ga0097621_100386009 3300006237 Unclassified 1252
89 Ga0068871_100000117 3300006358 Bacteria 49272
90 Ga0068871_100045208 3300006358 Bacteria 3543
91 Ga0068871_100229188 3300006358 Bacteria 1612
92 Ga0068871_100416857 3300006358 Bacteria 1198
93 Ga0068871_100486985 3300006358 Bacteria 1110
94 Ga0075428_101202124 3300006844 Unclassified 799
95 Ga0075431_100979345 3300006847 Bacteria 813
96 Ga0075433_10003905 3300006852 Bacteria 11538
97 Ga0075433_10073017 3300006852 Bacteria 3017
98 Ga0075433_10129097 3300006852 Bacteria 2246
99 Ga0075433_10390947 3300006852 Unclassified 1227
100 Ga0075434_100083763 3300006871 Bacteria 3187
101 Ga0075434_100238803 3300006871 Bacteria 1837
102 Ga0075434_100444108 3300006871 Unclassified 1318
103 Ga0075434_100546828 3300006871 Bacteria 1178
104 Ga0075434_100666799 3300006871 Bacteria 1058
105 Ga0075434_102481251 3300006871 Unclassified 520
106 Ga0068865_100031934 3300006881 Bacteria 3514
107 Ga0068865_100049584 3300006881 Bacteria 2895
108 Ga0068865_102025264 3300006881 Unclassified 523
109 Ga0075436_100010185 3300006914 Bacteria 6438
110 Ga0075436_100187728 3300006914 Unclassified 1462
111 Ga0075436_101149971 3300006914 Unclassified 585
112 Ga0097620_100496395 3300006931 Unclassified 1316
113 Ga0097620_100641922 3300006931 Bacteria 1154
114 Ga0075435_100025422 3300007076 Unclassified 4610
115 Ga0075435_100145129 3300007076 Bacteria 1993
116 Ga0099794_10295767 3300007265 Unclassified 838
117 Ga0105250_10192519 3300009092 Bacteria 859
118 Ga0105245_10020832 3300009098 Bacteria 5747
119 Ga0105245_10220379 3300009098 Bacteria 1830
120 Ga0105245_11095886 3300009098 Unclassified 842
121 Ga0105247_10829085 3300009101 Unclassified 708
122 Ga0114129_10001252 3300009147 Bacteria 33867
123 Ga0114129_10001613 3300009147 Bacteria 30618
124 Ga0114129_10063576 3300009147 Bacteria 5153
125 Ga0114129_10132718 3300009147 Bacteria 3419
126 Ga0105243_12353281 3300009148 Unclassified 571
127 Ga0105241_10142070 3300009174 Bacteria 1956
128 Ga0105242_10026085 3300009176 Bacteria 4629
129 Ga0105242_10058776 3300009176 Bacteria 3153
130 Ga0105242_10283895 3300009176 Bacteria 1505
131 Ga0105248_10015031 3300009177 Bacteria 8522
132 Ga0105248_10165810 3300009177 Bacteria 2491
133 Ga0105248_10251244 3300009177 Bacteria 1990
134 Ga0105248_10406517 3300009177 Bacteria 1533
135 Ga0105238_11491731 3300009551 Bacteria 705
136 Ga0105246_11401785 3300011119 Bacteria 652
137 Ga0157369_12370746 3300013105 Unclassified 538
138 Ga0157374_10026739 3300013296 Bacteria 5195
139 Ga0157374_10695807 3300013296 Bacteria 1029
140 Ga0157378_11671369 3300013297 Bacteria 683
141 Ga0163162_10085477 3300013306 Bacteria 3232
142 Ga0163162_10565239 3300013306 Bacteria 1265
143 Ga0163162_12433319 3300013306 Bacteria 602
144 Ga0157375_10151016 3300013308 Bacteria 2458
145 Ga0157375_10202814 3300013308 Bacteria 2139
146 Ga0157375_11749426 3300013308 Bacteria 736
147 Ga0157375_11800834 3300013308 Bacteria 726
148 Ga0157375_12336924 3300013308 Bacteria 638
149 Ga0157375_12552363 3300013308 Bacteria 610
150 Ga0163163_10822459 3300014325 Unclassified 992
151 Ga0157380_10107932 3300014326 Bacteria 2332
152 Ga0157380_10324828 3300014326 Bacteria 1428
153 Ga0157380_10638782 3300014326 Unclassified 1060
154 Ga0157380_10814063 3300014326 Bacteria 952
155 Ga0157380_11375977 3300014326 Unclassified 755
156 Ga0157377_10026229 3300014745 Bacteria 3116
157 Ga0157376_10033528 3300014969 Bacteria 4135
158 Ga0157376_10281763 3300014969 Bacteria 1566
159 Ga0157376_12958088 3300014969 Unclassified 514
160 Ga0206352_10993967 3300020078 Unclassified 1068
161 Ga0213876_10110363 3300021384 Bacteria 1460
162 Ga0207692_10348234 3300025898 Bacteria 913
163 Ga0207642_10203039 3300025899 Bacteria 1096
164 Ga0207642_10635234 3300025899 Bacteria 668
165 Ga0207680_10010279 3300025903 Bacteria 4676
166 Ga0207680_10897919 3300025903 Bacteria 635
167 Ga0207685_10516997 3300025905 Bacteria 630
168 Ga0207699_10049026 3300025906 Unclassified 2484
169 Ga0207645_11119653 3300025907 Bacteria 530
170 Ga0207684_10925788 3300025910 Unclassified 732
171 Ga0207654_10085003 3300025911 Bacteria 1914
172 Ga0207693_10799838 3300025915 Unclassified 727
173 Ga0207663_10436827 3300025916 Unclassified 1007
174 Ga0207662_10002965 3300025918 Bacteria 8637
175 Ga0207652_10841969 3300025921 Unclassified 813
176 Ga0207646_10099639 3300025922 Bacteria 2604
177 Ga0207646_10598743 3300025922 Bacteria 990
178 Ga0207646_11783804 3300025922 Bacteria 527
179 Ga0207659_10000348 3300025926 Bacteria 27635
180 Ga0207659_11140739 3300025926 Unclassified 670
181 Ga0207687_10053146 3300025927 Bacteria 2829
182 Ga0207687_10760102 3300025927 Unclassified 825
183 Ga0207700_10345014 3300025928 Bacteria 1295
184 Ga0207690_10381989 3300025932 Bacteria 1120
185 Ga0207706_10397142 3300025933 Bacteria 1196
186 Ga0207686_10011654 3300025934 Bacteria 4821
187 Ga0207686_10042613 3300025934 Bacteria 2776
188 Ga0207670_10949291 3300025936 Unclassified 722
189 Ga0207669_10174413 3300025937 Bacteria 1534
190 Ga0207669_10744406 3300025937 Bacteria 809
191 Ga0207704_10275274 3300025938 Bacteria 1277
192 Ga0207704_11017921 3300025938 Bacteria 701
193 Ga0207665_10215023 3300025939 Bacteria 1406
194 Ga0207665_10529510 3300025939 Bacteria 913
195 Ga0207691_10519239 3300025940 Bacteria 1011
196 Ga0207711_10014346 3300025941 Bacteria 6580
197 Ga0207711_10018268 3300025941 Bacteria 5829
198 Ga0207711_10078749 3300025941 Bacteria 2876
199 Ga0207689_10244588 3300025942 Bacteria 1483
200 Ga0207689_10319703 3300025942 Bacteria 1288
201 Ga0207661_10177757 3300025944 Unclassified 1857
202 Ga0207661_10801128 3300025944 Bacteria 867
203 Ga0207679_10391595 3300025945 Unclassified 1220
204 Ga0207651_10006868 3300025960 Bacteria 6009
205 Ga0207640_10208493 3300025981 Bacteria 1487
206 Ga0207658_11126409 3300025986 Bacteria 717
207 Ga0207677_10038195 3300026023 Bacteria 3146
208 Ga0207677_10645393 3300026023 Bacteria 934
209 Ga0207677_11729062 3300026023 Unclassified 580
210 Ga0207703_10116658 3300026035 Bacteria 2286
211 Ga0207639_11447389 3300026041 Unclassified 645
212 Ga0207708_10009769 3300026075 Bacteria 7119
213 Ga0207708_10009869 3300026075 Bacteria 7088
214 Ga0207702_10759760 3300026078 Unclassified 957
215 Ga0207641_10262837 3300026088 Bacteria 1617
216 Ga0207641_10588025 3300026088 Unclassified 1089
217 Ga0207648_10321488 3300026089 Bacteria 1391
218 Ga0207683_10103081 3300026121 Bacteria 2548
219 Ga0207698_10918181 3300026142 Bacteria 883
220 Ga0207698_11311136 3300026142 Bacteria 739
221 Ga0207698_12290925 3300026142 Bacteria 552
222 Ga0207428_10808513 3300027907 Unclassified 666
223 Ga0207428_11287587 3300027907 Unclassified 507
224 Ga0268266_10062604 3300028379 Bacteria 3212
225 Ga0268265_11532720 3300028380 Unclassified 670
226 Ga0268264_10051152 3300028381 Unclassified 3442
227 Ga0268264_10166674 3300028381 Bacteria 1989
228 Ga0268264_10580108 3300028381 Bacteria 1103
229 Ga0268264_10888353 3300028381 Unclassified 894
230 Ga0265318_10278199 3300028577 Unclassified 610
231 Ga0265336_10156961 3300028666 Unclassified 677
232 Ga0265332_10173563 3300031238 Bacteria 899
233 Ga0307408_102121755 3300031548 Bacteria 542
234 Ga0307408_102263091 3300031548 Unclassified 526
235 Ga0316576_10226420 3300031727 Unclassified 1406
236 Ga0316578_10436104 3300031728 Bacteria 775
237 Ga0307410_10553731 3300031852 Bacteria 953
238 Ga0307416_100239083 3300032002 Bacteria 1758
239 Ga0307416_102967292 3300032002 Bacteria 568
240 Ga0373959_0018119 3300034820 Bacteria 1321
241 Ga0373938_0090391 3300034957 Unclassified 757
242 Ga0373928_0025176 3300035084 Bacteria 1281
243 Ga0373928_0252810 3300035084 Unclassified 525
244 Ga0373929_0005363 3300035085 Bacteria 2306
245 Ga0373929_0236261 3300035085 Bacteria 525
246 Ga0373940_0000174 3300035088 Bacteria 8584
247 Ga0373932_0000650 3300035112 Bacteria 10560
248 Ga0373939_0017974 3300035114 Bacteria 1886
249 Ga0373941_0007372 3300035115 Bacteria 2688
250 Ga0373941_0274837 3300035115 Bacteria 665
251 Ga0373960_0000515 3300035121 Bacteria 7743
252 Ga0373946_0265877 3300035171 Unclassified 840
253 Ga0373962_0001292 3300035242 Bacteria 5879
254 Ga0373924_0009636 3300035410 Bacteria 3546
255 Ga0373931_0001780 3300035691 Bacteria 9363
256 Ga0373931_0501430 3300035691 Unclassified 783
257 Ga0373927_0425288 3300035695 Unclassified 877
258 Ga0373933_0323699 3300035724 Bacteria 1000
259 Ga0373937_0160433 3300036401 Bacteria 2108
260 Ga0373937_0612078 3300036401 Bacteria 1034
261 Ga0373937_1874165 3300036401 Unclassified 546
262 Ga0316584_1037340 3300036712 Bacteria 546
263 Ga0373925_0013851 3300037068 Bacteria 5839
264 Ga0395900_0938989 3300037418 Unclassified 787
265 Ga0395898_1685392 3300037466 Unclassified 557
266 Ga0395901_0717141 3300038443 Bacteria 996
267 Ga0436365_0916689 3300039437 Bacteria 3248
268 Ga0436365_1716339 3300039437 Unclassified 612
269 Ga0436363_0617013 3300039450 Unclassified 708
270 Ga0439453_0173760 3300041408 Unclassified 522
271 Ga0439453_0181221 3300041408 Unclassified 514
272 Ga0439446_0099316 3300042156 Unclassified 919
273 Ga0439435_0093144 3300042436 Unclassified 917
274 Ga0450916_056563 3300042530 Unclassified 629
275 Ga0466963_0075248 3300044694 Unclassified 2278
276 Ga0451576_0125348 3300045051 Bacteria 2676
277 Ga0466967_0234632 3300045976 Bacteria 1748
278 Ga0495582_0024564 3300046473 Bacteria 3299
279 Ga0495584_0496045 3300046491 Unclassified 622
280 Ga0495630_0907722 3300046517 Bacteria 671
281 Ga0495652_0663354 3300046529 Bacteria 705
282 Ga0495598_0399571 3300046537 Unclassified 537
283 Ga0495659_0375152 3300046664 Unclassified 611
284 Ga0495669_0002962 3300046684 Bacteria 6980
285 Ga0495670_0234304 3300046691 Bacteria 977
286 Ga0495600_0217514 3300046809 Unclassified 1223
287 Ga0495674_0658671 3300047319 Bacteria 825
288 Ga0496104_0153526 3300048907 Bacteria 2210
289 Ga0496104_0516945 3300048907 Bacteria 1105
290 Ga0496104_0715235 3300048907 Bacteria 909
291 Ga0496106_0158525 3300048909 Unclassified 1789
292 Ga0496107_0643801 3300048910 Bacteria 782
293 Ga0496114_0106786 3300048917 Bacteria 2396
294 Ga0501040_0451696 3300049576 Bacteria 925
295 Ga0501041_0731770 3300049577 Unclassified 633
296 Ga0501042_0035617 3300049578 Bacteria 3531
297 Ga0501048_0074551 3300049582 Unclassified 2394
298 Ga0501067_0110982 3300049583 Bacteria 1525
299 Ga0501068_0738811 3300049584 Unclassified 644
300 Ga0501071_0016738 3300049587 Bacteria 5043
301 Ga0501074_0206555 3300049590 Bacteria 1399
302 Ga0501077_0282926 3300049593 Unclassified 1056
303 Ga0501077_0577874 3300049593 Unclassified 721
304 Ga0501217_196601 3300049661 Unclassified 626
305 Ga0501223_054813 3300049663 Bacteria 775
306 Ga0501221_164256 3300049704 Bacteria 597
307 Ga0501229_069287 3300049706 Bacteria 550
308 Ga0501079_1174098 3300049741 Bacteria 605
309 Ga0501080_0567900 3300049742 Unclassified 1009
310 Ga0501080_1625669 3300049742 Unclassified 547
311 nmdc:mga05p37_1356_c1 3300050507 Bacteria 28472
312 nmdc:mga05p37_15886_c1 3300050507 Bacteria 9055
313 nmdc:mga05p37_51103_c1 3300050507 Bacteria 5084
314 nmdc:mga05p37_838422_c1 3300050507 Unclassified 1000
315 nmdc:mga05p37_86803_c1 3300050507 Bacteria 3857
316 nmdc:mga06r32_920335_c1 3300050510 Bacteria 830
317 nmdc:mga08y16_53964_c1 3300050511 Bacteria 4201
318 nmdc:mga08y16_851395_c1 3300050511 Unclassified 901
319 nmdc:mga0n895_101212_c1 3300050512 Bacteria 2891
320 nmdc:mga0n895_12509_c1 3300050512 Bacteria 7617
321 nmdc:mga0n895_1700662_c1 3300050512 Unclassified 593
322 nmdc:mga0n895_2028363_c1 3300050512 Unclassified 533
323 nmdc:mga0n895_310428_c1 3300050512 Bacteria 1598
324 nmdc:mga0n895_330372_c1 3300050512 Bacteria 1545
325 nmdc:mga0n895_357814_c1 3300050512 Bacteria 1478
326 nmdc:mga0n895_686134_c1 3300050512 Bacteria 1021
327 nmdc:mga0rr50_444468_c1 3300050513 Bacteria 1099
328 nmdc:mga0rr50_7273_c1 3300050513 Bacteria 6813
329 nmdc:mga08x19_19582_c1 3300050514 Bacteria 4155
330 nmdc:mga08x19_44095_c1 3300050514 Bacteria 2847
331 nmdc:mga0a205_197077_c1 3300050515 Bacteria 1905
332 nmdc:mga0a205_353440_c1 3300050515 Unclassified 1337
333 nmdc:mga0a205_379303_c1 3300050515 Unclassified 1279
334 nmdc:mga0a205_65111_c1 3300050515 Bacteria 3521
335 nmdc:mga0a205_88355_c1 3300050515 Bacteria 2995
336 Ga0495601_0022693 3300053077 Unclassified 3856
337 Ga0495619_0059500 3300053085 Bacteria 2538
338 Ga0501084_0183758 3300054114 Bacteria 1765
339 Ga0501084_1842352 3300054114 Unclassified 505
340 Ga0587073_0085687 3300059492 Bacteria 791
341 Ga0587075_097583 3300059644 Unclassified 582
342 Ga0501082_1874538 3300060353 Unclassified 523
343 Ga0307414_10616438
344 Ga0058863_11876878
345 Ga0065707_10300605
346 Ga0065707_10996529
347 Ga0070676_10539951
348 Ga0070676_11096397
349 Ga0070683_100885921
350 Ga0070683_101549201
351 Ga0070690_100188759
352 Ga0070690_101628702
353 Ga0068869_100374855
354 Ga0070666_10004379
355 Ga0070666_10274740
356 Ga0070666_11391626
357 Ga0070680_101899269
358 Ga0068868_100188783
359 Ga0068868_100240691
360 Ga0068868_100857954
361 Ga0070691_10422002
362 Ga0070687_100006236
363 Ga0070675_100000352
364 Ga0070671_101507060
365 Ga0070671_102096243
366 Ga0070674_100688564
367 Ga0070673_100010669
368 Ga0070659_100482761
369 Ga0070659_100846267
370 Ga0070713_100157508
371 Ga0070713_100672437
372 Ga0070701_10173578
373 Ga0070711_100066441
374 Ga0070711_100404589
375 Ga0070708_100463803
376 Ga0070681_10395536
377 Ga0068867_100157538
378 Ga0068867_101682291
379 Ga0070707_102173195
380 Ga0070699_100083410
381 Ga0070699_100190673
382 Ga0070699_100349409
383 Ga0070679_100952960
384 Ga0070684_100046368
385 Ga0070684_100383814
386 Ga0070697_100009648
387 Ga0070697_100870309
388 Ga0070697_101077559
389 Ga0068853_100439923
390 Ga0070672_100972461
391 Ga0070672_101217861
392 Ga0070672_101802668
393 Ga0070686_100001833
394 Ga0070686_101209050
395 Ga0070696_100155424
396 Ga0070696_100897074
397 Ga0070693_100161546
398 Ga0070693_100322859
399 Ga0070693_100355435
400 Ga0070665_100111996
401 Ga0070704_100851874
402 Ga0068855_101848189
403 Ga0068854_100225020
404 Ga0068854_100378633
405 Ga0068859_100496410
406 Ga0068859_100641917
407 Ga0068864_101403801
408 Ga0068866_10069572
409 Ga0068866_10334265
410 Ga0068861_100390047
411 Ga0068861_100762983
412 Ga0068861_100871494
413 Ga0068861_102136374
414 Ga0068870_10954907
415 Ga0068863_100099237
416 Ga0068858_100234833
417 Ga0068858_100304481
418 Ga0068860_100033129
419 Ga0068860_100739896
420 Ga0068860_101202922
421 Ga0068862_100753709
422 Ga0068862_101336331
423 Ga0081455_10112799
424 Ga0070715_10382890
425 Ga0070715_10517378
426 Ga0070712_100438688
427 Ga0097621_100000075
428 Ga0097621_100014802
429 Ga0097621_100031344
430 Ga0097621_100386009
431 Ga0068871_100000117
432 Ga0068871_100045208
433 Ga0068871_100229188
434 Ga0068871_100416857
435 Ga0068871_100486985
436 Ga0075428_101202124
437 Ga0075431_100979345
438 Ga0075433_10003905
439 Ga0075433_10073017
440 Ga0075433_10129097
441 Ga0075433_10390947
442 Ga0075434_100083763
443 Ga0075434_100238803
444 Ga0075434_100444108
445 Ga0075434_100546828
446 Ga0075434_100666799
447 Ga0075434_102481251
448 Ga0068865_100031934
449 Ga0068865_100049584
450 Ga0068865_102025264
451 Ga0075436_100010185
452 Ga0075436_100187728
453 Ga0075436_101149971
454 Ga0097620_100496395
455 Ga0097620_100641922
456 Ga0075435_100025422
457 Ga0075435_100145129
458 Ga0099794_10295767
459 Ga0105250_10192519
460 Ga0105245_10020832
461 Ga0105245_10220379
462 Ga0105245_11095886
463 Ga0105247_10829085
464 Ga0114129_10001252
465 Ga0114129_10001613
466 Ga0114129_10063576
467 Ga0114129_10132718
468 Ga0105243_12353281
469 Ga0105241_10142070
470 Ga0105242_10026085
471 Ga0105242_10058776
472 Ga0105242_10283895
473 Ga0105248_10015031
474 Ga0105248_10165810
475 Ga0105248_10251244
476 Ga0105248_10406517
477 Ga0105238_11491731
478 Ga0105246_11401785
479 Ga0157369_12370746
480 Ga0157374_10026739
481 Ga0157374_10695807
482 Ga0157378_11671369
483 Ga0163162_10085477
484 Ga0163162_10565239
485 Ga0163162_12433319
486 Ga0157375_10151016
487 Ga0157375_10202814
488 Ga0157375_11749426
489 Ga0157375_11800834
490 Ga0157375_12336924
491 Ga0157375_12552363
492 Ga0163163_10822459
493 Ga0157380_10107932
494 Ga0157380_10324828
495 Ga0157380_10638782
496 Ga0157380_10814063
497 Ga0157380_11375977
498 Ga0157377_10026229
499 Ga0157376_10033528
500 Ga0157376_10281763
501 Ga0157376_12958088
502 Ga0206352_10993967
503 Ga0213876_10110363
504 Ga0207692_10348234
505 Ga0207642_10203039
506 Ga0207642_10635234
507 Ga0207680_10010279
508 Ga0207680_10897919
509 Ga0207685_10516997
510 Ga0207699_10049026
511 Ga0207645_11119653
512 Ga0207684_10925788
513 Ga0207654_10085003
514 Ga0207693_10799838
515 Ga0207663_10436827
516 Ga0207662_10002965
517 Ga0207652_10841969
518 Ga0207646_10099639
519 Ga0207646_10598743
520 Ga0207646_11783804
521 Ga0207659_10000348
522 Ga0207659_11140739
523 Ga0207687_10053146
524 Ga0207687_10760102
525 Ga0207700_10345014
526 Ga0207690_10381989
527 Ga0207706_10397142
528 Ga0207686_10011654
529 Ga0207686_10042613
530 Ga0207670_10949291
531 Ga0207669_10174413
532 Ga0207669_10744406
533 Ga0207704_10275274
534 Ga0207704_11017921
535 Ga0207665_10215023
536 Ga0207665_10529510
537 Ga0207691_10519239
538 Ga0207711_10014346
539 Ga0207711_10018268
540 Ga0207711_10078749
541 Ga0207689_10244588
542 Ga0207689_10319703
543 Ga0207661_10177757
544 Ga0207661_10801128
545 Ga0207679_10391595
546 Ga0207651_10006868
547 Ga0207640_10208493
548 Ga0207658_11126409
549 Ga0207677_10038195
550 Ga0207677_10645393
551 Ga0207677_11729062
552 Ga0207703_10116658
553 Ga0207639_11447389
554 Ga0207708_10009769
555 Ga0207708_10009869
556 Ga0207702_10759760
557 Ga0207641_10262837
558 Ga0207641_10588025
559 Ga0207648_10321488
560 Ga0207683_10103081
561 Ga0207698_10918181
562 Ga0207698_11311136
563 Ga0207698_12290925
564 Ga0207428_10808513
565 Ga0207428_11287587
566 Ga0268266_10062604
567 Ga0268265_11532720
568 Ga0268264_10051152
569 Ga0268264_10166674
570 Ga0268264_10580108
571 Ga0268264_10888353
572 Ga0265318_10278199
573 Ga0265336_10156961
574 Ga0265332_10173563
575 Ga0307408_102121755
576 Ga0307408_102263091
577 Ga0316576_10226420
578 Ga0316578_10436104
579 Ga0307410_10553731
580 Ga0307416_100239083
581 Ga0307416_102967292
582 Ga0373959_0018119
583 Ga0373938_0090391
584 Ga0373928_0025176
585 Ga0373928_0252810
586 Ga0373929_0005363
587 Ga0373929_0236261
588 Ga0373940_0000174
589 Ga0373932_0000650
590 Ga0373939_0017974
591 Ga0373941_0007372
592 Ga0373941_0274837
593 Ga0373960_0000515
594 Ga0373946_0265877
595 Ga0373962_0001292
596 Ga0373924_0009636
597 Ga0373931_0001780
598 Ga0373931_0501430
599 Ga0373927_0425288
600 Ga0373933_0323699
601 Ga0373937_0160433
602 Ga0373937_0612078
603 Ga0373937_1874165
604 Ga0316584_1037340
605 Ga0373925_0013851
606 Ga0395900_0938989
607 Ga0395898_1685392
608 Ga0395901_0717141
609 Ga0436365_0916689
610 Ga0436365_1716339
611 Ga0436363_0617013
612 Ga0439453_0173760
613 Ga0439453_0181221
614 Ga0439446_0099316
615 Ga0439435_0093144
616 Ga0450916_056563
617 Ga0466963_0075248
618 Ga0451576_0125348
619 Ga0466967_0234632
620 Ga0495582_0024564
621 Ga0495584_0496045
622 Ga0495630_0907722
623 Ga0495652_0663354
624 Ga0495598_0399571
625 Ga0495659_0375152
626 Ga0495669_0002962
627 Ga0495670_0234304
628 Ga0495600_0217514
629 Ga0495674_0658671
630 Ga0496104_0153526
631 Ga0496104_0516945
632 Ga0496104_0715235
633 Ga0496106_0158525
634 Ga0496107_0643801
635 Ga0496114_0106786
636 Ga0501040_0451696
637 Ga0501041_0731770
638 Ga0501042_0035617
639 Ga0501048_0074551
640 Ga0501067_0110982
641 Ga0501068_0738811
642 Ga0501071_0016738
643 Ga0501074_0206555
644 Ga0501077_0282926
645 Ga0501077_0577874
646 Ga0501217_196601
647 Ga0501223_054813
648 Ga0501221_164256
649 Ga0501229_069287
650 Ga0501079_1174098
651 Ga0501080_0567900
652 Ga0501080_1625669
653 nmdc:mga05p37_1356_c1
654 nmdc:mga05p37_15886_c1
655 nmdc:mga05p37_51103_c1
656 nmdc:mga05p37_838422_c1
657 nmdc:mga05p37_86803_c1
658 nmdc:mga06r32_920335_c1
659 nmdc:mga08y16_53964_c1
660 nmdc:mga08y16_851395_c1
661 nmdc:mga0n895_101212_c1
662 nmdc:mga0n895_12509_c1
663 nmdc:mga0n895_1700662_c1
664 nmdc:mga0n895_2028363_c1
665 nmdc:mga0n895_310428_c1
666 nmdc:mga0n895_330372_c1
667 nmdc:mga0n895_357814_c1
668 nmdc:mga0n895_686134_c1
669 nmdc:mga0rr50_444468_c1
670 nmdc:mga0rr50_7273_c1
671 nmdc:mga08x19_19582_c1
672 nmdc:mga08x19_44095_c1
673 nmdc:mga0a205_197077_c1
674 nmdc:mga0a205_353440_c1
675 nmdc:mga0a205_379303_c1
676 nmdc:mga0a205_65111_c1
677 nmdc:mga0a205_88355_c1
678 Ga0495601_0022693
679 Ga0495619_0059500
680 Ga0501084_0183758
681 Ga0501084_1842352
682 Ga0587073_0085687
683 Ga0587075_097583
684 Ga0501082_1874538

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07238

PilZ

PilZ domain

3

106

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ejl-assembly1.cif.gz_A mrkh, a novel c-di-gmp dependence transcription regulatory factor. 0.8215 29 111
5kgo-assembly2.cif.gz_A structure of k. pneumonia mrkh-c-di-gmp complex 0.8076 29 114
5vx6-assembly1.cif.gz_A structure of bacillus subtilis inhibitor of motility (moti/dgra) 0.7975 34 114
5ked-assembly1.cif.gz_D structure of the 2.65 angstrom p2(1) crystal of k. pneumonia mrkh 0.7853 29 116
3rqa-assembly1.cif.gz_C the crystal structure of a pathogenic protein from the xanthomonas campestris reveals a new tetrameric pilz domain self-assembled via a unusual helical bundle 0.7822 34 115
ID Description Score Start End Superfamily
af_P76010_114_240_2.40.10.220 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.7951 29 114 2.40.10.220
5kedC02 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.7787 29 116 2.40.10.220
af_A0A0R0H5Q7_191_263_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.7322 49 96 2.30.30.140
3kyfA02 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.7272 29 111 2.40.10.220
af_P37653_690_796_2.40.10.220 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.7119 29 116 2.40.10.220
ID Description Score Start End GO Terms
AF-A0A1Q7N9X6-F1-model_v4 PilZ domain-containing protein 0.9829 24 116 GO:0035438
AF-A0A7Y4TF14-F1-model_v4 PilZ domain-containing protein 0.9729 29 91 GO:0035438
AF-A0A1Q7N9X6-F1-model_v4 PilZ domain-containing protein 0.9726 24 116 GO:0035438
AF-A0A2V7XDY1-F1-model_v4 PilZ domain-containing protein 0.9695 29 108 GO:0035438
AF-A0A1G1HDI0-F1-model_v4 PilZ domain-containing protein 0.9641 29 111 GO:0035438

Map