F414942

General Info

Members Datasets Scaffolds Average Seq Length
341 154 682 126

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_277895_c1|nmdc:mga0n895_277895_c1_226_663
Length 145
Sequence VARSSNSPRIARRANPVRLVLALSVAAALAIFLLYTSIAGGGNPSIQPSALSGHKGQVQLAGRVVGPVSGDAHAGGLRFALRDVGGTRATEVPVVYTGSVPDLFRAGRDIVLQGRLRQGTFVADPGTMITKCPSKYSPKRSGGSA

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
51 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
52 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
57 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
61 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
70 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
71 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
72 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
73 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
74 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
75 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
76 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
77 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
78 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
79 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
80 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
81 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
85 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
86 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
92 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
93 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
94 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
95 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
96 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
99 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
100 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
125 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
134 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
135 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 4.4
Rhizosphere 94.72
Stem 0
Stem Tuber 0
Unclassified 19.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_277895_c1 3300050512 Unclassified 1698
2 rootH1_10268298 3300003323 Bacteria 1018
3 JGI25407J50210_10008218 3300003373 Bacteria 2630
4 JGI25407J50210_10059077 3300003373 Bacteria 965
5 Ga0068869_100773956 3300005334 Bacteria 823
6 Ga0068868_101466238 3300005338 Unclassified 638
7 Ga0070703_10350063 3300005406 Unclassified 630
8 Ga0070714_101829484 3300005435 Bacteria 593
9 Ga0070700_100405873 3300005441 Unclassified 1026
10 Ga0070700_100510941 3300005441 Unclassified 926
11 Ga0070694_100585418 3300005444 Unclassified 897
12 Ga0070708_100360030 3300005445 Bacteria 1371
13 Ga0070708_100656998 3300005445 Bacteria 988
14 Ga0070681_11347800 3300005458 Unclassified 637
15 Ga0070706_101004940 3300005467 Bacteria 769
16 Ga0070707_100112242 3300005468 Bacteria 2644
17 Ga0070698_100556427 3300005471 Bacteria 1086
18 Ga0070684_100405322 3300005535 Unclassified 1257
19 Ga0070697_100257913 3300005536 Bacteria 1492
20 Ga0070704_100260046 3300005549 Bacteria 1429
21 Ga0068855_100796323 3300005563 Bacteria 1005
22 Ga0081455_10005333 3300005937 Bacteria 14118
23 Ga0081455_10106187 3300005937 Unclassified 2242
24 Ga0081455_10113208 3300005937 Unclassified 2152
25 Ga0081455_10249844 3300005937 Bacteria 1298
26 Ga0081538_10000080 3300005981 Bacteria 92392
27 Ga0081538_10001298 3300005981 Bacteria 25847
28 Ga0081538_10001526 3300005981 Bacteria 23751
29 Ga0081538_10002401 3300005981 Bacteria 18381
30 Ga0081538_10004814 3300005981 Bacteria 12303
31 Ga0081538_10081599 3300005981 Bacteria 1719
32 Ga0081538_10087522 3300005981 Bacteria 1625
33 Ga0081538_10209858 3300005981 Unclassified 787
34 Ga0081539_10004331 3300005985 Bacteria 15828
35 Ga0075432_10189222 3300006058 Unclassified 809
36 Ga0075428_100351598 3300006844 Bacteria 1582
37 Ga0075430_100358856 3300006846 Unclassified 1203
38 Ga0075430_100784603 3300006846 Bacteria 785
39 Ga0075430_101301881 3300006846 Bacteria 598
40 Ga0075433_10531856 3300006852 Bacteria 1034
41 Ga0075433_10900305 3300006852 Unclassified 772
42 Ga0075434_100291713 3300006871 Unclassified 1651
43 Ga0075434_100575556 3300006871 Unclassified 1145
44 Ga0075429_101162330 3300006880 Unclassified 674
45 Ga0068865_101426002 3300006881 Unclassified 619
46 Ga0111539_10048924 3300009094 Bacteria 5046
47 Ga0111539_11012560 3300009094 Bacteria 966
48 Ga0111539_11089218 3300009094 Bacteria 928
49 Ga0105245_10638148 3300009098 Unclassified 1094
50 Ga0105245_10852711 3300009098 Archaea 951
51 Ga0114129_10002148 3300009147 Bacteria 27176
52 Ga0114129_10026620 3300009147 Bacteria 8191
53 Ga0114129_10052081 3300009147 Bacteria 5745
54 Ga0114129_10129390 3300009147 Bacteria 3469
55 Ga0114129_11391545 3300009147 Bacteria 866
56 Ga0105243_10296526 3300009148 Bacteria 1463
57 Ga0105242_11292577 3300009176 Bacteria 753
58 Ga0105248_10528299 3300009177 Bacteria 1331
59 Ga0157369_10041429 3300013105 Bacteria 5027
60 Ga0157379_11363612 3300014968 Bacteria 686
61 Ga0207684_10921765 3300025910 Bacteria 734
62 Ga0207646_10561311 3300025922 Bacteria 1026
63 Ga0207650_10947420 3300025925 Bacteria 732
64 Ga0207687_11289101 3300025927 Bacteria 628
65 Ga0207686_11309519 3300025934 Bacteria 595
66 Ga0207704_10728745 3300025938 Unclassified 823
67 Ga0207711_10441294 3300025941 Bacteria 1211
68 Ga0207661_10233206 3300025944 Bacteria 1631
69 Ga0207667_10739132 3300025949 Bacteria 984
70 Ga0207708_10130941 3300026075 Bacteria 1961
71 Ga0207708_10822322 3300026075 Unclassified 801
72 Ga0209998_10004759 3300027717 Bacteria 2867
73 Ga0207428_10091991 3300027907 Bacteria 2354
74 Ga0265316_10465359 3300031344 Unclassified 906
75 Ga0307408_100118532 3300031548 Bacteria 2047
76 Ga0307408_100165182 3300031548 Bacteria 1762
77 Ga0307408_100801322 3300031548 Bacteria 855
78 Ga0307405_10011112 3300031731 Bacteria 4700
79 Ga0307405_10185822 3300031731 Bacteria 1496
80 Ga0307405_10941665 3300031731 Bacteria 733
81 Ga0307413_10182247 3300031824 Bacteria 1499
82 Ga0307410_10017981 3300031852 Bacteria 4259
83 Ga0307410_10154190 3300031852 Bacteria 1713
84 Ga0307410_10157508 3300031852 Bacteria 1698
85 Ga0326468_10015486 3300031889 Bacteria 845
86 Ga0307406_10080385 3300031901 Bacteria 2164
87 Ga0307406_10210646 3300031901 Bacteria 1437
88 Ga0307407_10047735 3300031903 Bacteria 2432
89 Ga0307407_10055470 3300031903 Bacteria 2290
90 Ga0307407_10725665 3300031903 Unclassified 750
91 Ga0307412_10052502 3300031911 Bacteria 2700
92 Ga0307412_10241219 3300031911 Bacteria 1398
93 Ga0307409_100008905 3300031995 Bacteria 6129
94 Ga0307409_100009794 3300031995 Bacteria 5910
95 Ga0307409_100292622 3300031995 Bacteria 1511
96 Ga0307409_100555416 3300031995 Bacteria 1128
97 Ga0307409_100715791 3300031995 Bacteria 1002
98 Ga0307409_102407436 3300031995 Unclassified 555
99 Ga0307416_100000928 3300032002 Bacteria 15505
100 Ga0307416_100037798 3300032002 Bacteria 3719
101 Ga0307416_100096804 3300032002 Bacteria 2553
102 Ga0307416_100451157 3300032002 Bacteria 1339
103 Ga0307414_10166723 3300032004 Bacteria 1756
104 Ga0307414_10337369 3300032004 Unclassified 1289
105 Ga0307411_10213576 3300032005 Unclassified 1491
106 Ga0307411_10387408 3300032005 Bacteria 1151
107 Ga0307415_100004259 3300032126 Bacteria 7398
108 Ga0307415_100165388 3300032126 Bacteria 1719
109 Ga0373925_0518160 3300037068 Bacteria 980
110 Ga0395899_0164995 3300037312 Bacteria 1563
111 Ga0395900_0382126 3300037418 Unclassified 1376
112 Ga0395900_0422682 3300037418 Bacteria 1293
113 Ga0395900_0720971 3300037418 Bacteria 929
114 Ga0395898_0072520 3300037466 Bacteria 3327
115 Ga0395898_0177168 3300037466 Bacteria 2038
116 Ga0395898_0567613 3300037466 Bacteria 1077
117 Ga0395905_0295724 3300037471 Bacteria 1506
118 Ga0395905_0599624 3300037471 Bacteria 1003
119 Ga0395905_0792247 3300037471 Bacteria 851
120 Ga0395905_0822189 3300037471 Bacteria 832
121 Ga0395901_0013278 3300038443 Bacteria 8366
122 Ga0395901_0159378 3300038443 Bacteria 2370
123 Ga0395901_0211574 3300038443 Bacteria 2029
124 Ga0395901_0560633 3300038443 Unclassified 1157
125 Ga0395901_1128166 3300038443 Bacteria 753
126 Ga0395901_1430964 3300038443 Unclassified 649
127 Ga0436363_1258069 3300039450 Unclassified 671
128 Ga0439438_104345 3300041405 Bacteria 686
129 Ga0439461_0111258 3300041410 Bacteria 676
130 Ga0439445_0012487 3300042004 Unclassified 2043
131 Ga0439452_066742 3300042010 Bacteria 798
132 Ga0450920_093015 3300042122 Unclassified 623
133 Ga0450898_016494 3300042134 Bacteria 1261
134 Ga0450905_036129 3300042142 Bacteria 774
135 Ga0439446_0004129 3300042156 Bacteria 3660
136 Ga0439434_0063821 3300042435 Bacteria 1154
137 Ga0439460_0018165 3300042461 Bacteria 1891
138 Ga0450918_016350 3300042531 Unclassified 1289
139 Ga0439440_0092358 3300042993 Unclassified 814
140 Ga0466963_0238323 3300044694 Bacteria 1275
141 Ga0466967_0674178 3300045976 Unclassified 1023
142 Ga0466967_0674617 3300045976 Unclassified 1023
143 Ga0495582_0464191 3300046473 Bacteria 731
144 Ga0495662_0341222 3300046476 Archaea 736
145 Ga0495618_0178716 3300046514 Bacteria 1349
146 Ga0495618_0839216 3300046514 Bacteria 533
147 Ga0495630_0047879 3300046517 Bacteria 3199
148 Ga0495665_0199500 3300046531 Bacteria 1037
149 Ga0495640_0238809 3300046533 Bacteria 1141
150 Ga0495586_0001519 3300046535 Bacteria 12824
151 Ga0495634_0143529 3300046642 Bacteria 1514
152 Ga0495613_0043042 3300046689 Bacteria 3341
153 Ga0495613_0277244 3300046689 Bacteria 1165
154 Ga0495624_0404858 3300046690 Bacteria 819
155 Ga0495581_0712765 3300047315 Archaea 578
156 Ga0495674_0050430 3300047319 Bacteria 3672
157 Ga0495674_0363935 3300047319 Archaea 1172
158 Ga0495676_0451342 3300047321 Bacteria 848
159 Ga0495680_0229261 3300047322 Unclassified 1323
160 Ga0495680_0312941 3300047322 Bacteria 1100
161 Ga0495593_0576232 3300047673 Bacteria 565
162 Ga0496100_1319287 3300048903 Unclassified 569
163 Ga0496101_0054029 3300048904 Bacteria 2900
164 Ga0496102_0231329 3300048905 Bacteria 1743
165 Ga0496104_0095705 3300048907 Bacteria 2841
166 Ga0496104_0656093 3300048907 Bacteria 958
167 Ga0496106_1198897 3300048909 Unclassified 592
168 Ga0496108_0665566 3300048911 Unclassified 904
169 Ga0496109_0661002 3300048912 Bacteria 982
170 Ga0496111_0353770 3300048914 Unclassified 1087
171 Ga0496111_0393130 3300048914 Unclassified 1025
172 Ga0496111_0591823 3300048914 Unclassified 812
173 Ga0496112_1336067 3300048915 Bacteria 632
174 Ga0496112_1607544 3300048915 Unclassified 563
175 Ga0496113_0341378 3300048916 Bacteria 1201
176 Ga0496113_0659249 3300048916 Bacteria 837
177 Ga0501031_0044840 3300049568 Bacteria 2885
178 Ga0501031_0509675 3300049568 Unclassified 776
179 Ga0501031_0514824 3300049568 Unclassified 771
180 Ga0501031_0558433 3300049568 Bacteria 737
181 Ga0501032_0146246 3300049569 Bacteria 1556
182 Ga0501032_0540814 3300049569 Bacteria 743
183 Ga0501032_0687969 3300049569 Bacteria 648
184 Ga0501033_0165549 3300049570 Bacteria 1590
185 Ga0501033_0280187 3300049570 Bacteria 1177
186 Ga0501033_1195659 3300049570 Unclassified 503
187 Ga0501034_0022438 3300049571 Bacteria 6432
188 Ga0501036_0005203 3300049572 Bacteria 10515
189 Ga0501036_0007002 3300049572 Bacteria 9178
190 Ga0501036_0010372 3300049572 Bacteria 7690
191 Ga0501036_0360418 3300049572 Unclassified 1214
192 Ga0501036_0445832 3300049572 Bacteria 1078
193 Ga0501037_0003886 3300049573 Bacteria 10839
194 Ga0501038_0059781 3300049574 Bacteria 3263
195 Ga0501038_0278203 3300049574 Bacteria 1318
196 Ga0501038_0377347 3300049574 Bacteria 1100
197 Ga0501039_0044514 3300049575 Bacteria 3428
198 Ga0501039_0655782 3300049575 Bacteria 821
199 Ga0501040_0005236 3300049576 Bacteria 8382
200 Ga0501040_0117616 3300049576 Bacteria 1863
201 Ga0501040_0255638 3300049576 Bacteria 1250
202 Ga0501040_0287739 3300049576 Bacteria 1174
203 Ga0501040_0604034 3300049576 Unclassified 792
204 Ga0501040_0727487 3300049576 Bacteria 718
205 Ga0501041_0001056 3300049577 Bacteria 15063
206 Ga0501041_0065515 3300049577 Bacteria 2226
207 Ga0501041_0213084 3300049577 Bacteria 1211
208 Ga0501041_0244502 3300049577 Unclassified 1128
209 Ga0501041_0289778 3300049577 Bacteria 1031
210 Ga0501041_0991197 3300049577 Bacteria 540
211 Ga0501042_0094392 3300049578 Bacteria 2148
212 Ga0501042_0121611 3300049578 Bacteria 1880
213 Ga0501042_0445953 3300049578 Bacteria 938
214 Ga0501042_0500393 3300049578 Bacteria 882
215 Ga0501042_0636332 3300049578 Bacteria 775
216 Ga0501042_0966123 3300049578 Unclassified 621
217 Ga0501043_0054566 3300049579 Bacteria 3138
218 Ga0501043_0067853 3300049579 Bacteria 2801
219 Ga0501043_0097770 3300049579 Bacteria 2307
220 Ga0501043_0371261 3300049579 Bacteria 1084
221 Ga0501046_0022182 3300049580 Bacteria 5232
222 Ga0501046_0183759 3300049580 Bacteria 1562
223 Ga0501046_0362881 3300049580 Bacteria 1050
224 Ga0501047_0058177 3300049581 Bacteria 3734
225 Ga0501048_0022075 3300049582 Bacteria 4657
226 Ga0501048_0046714 3300049582 Bacteria 3090
227 Ga0501048_0274323 3300049582 Bacteria 1199
228 Ga0501048_0461915 3300049582 Archaea 909
229 Ga0501068_0051610 3300049584 Bacteria 2488
230 Ga0501068_0234886 3300049584 Bacteria 1166
231 Ga0501068_0296069 3300049584 Bacteria 1035
232 Ga0501068_0392303 3300049584 Bacteria 894
233 Ga0501068_1112784 3300049584 Bacteria 522
234 Ga0501069_0115402 3300049585 Unclassified 1532
235 Ga0501070_0352174 3300049586 Bacteria 1195
236 Ga0501070_0461092 3300049586 Bacteria 1024
237 Ga0501071_0008081 3300049587 Bacteria 6939
238 Ga0501071_0145985 3300049587 Bacteria 1763
239 Ga0501071_0334476 3300049587 Bacteria 1151
240 Ga0501071_0361809 3300049587 Bacteria 1105
241 Ga0501071_0835446 3300049587 Bacteria 710
242 Ga0501072_0056800 3300049588 Bacteria 3083
243 Ga0501072_0087264 3300049588 Bacteria 2476
244 Ga0501072_0129073 3300049588 Bacteria 2014
245 Ga0501072_0227324 3300049588 Bacteria 1486
246 Ga0501072_0405272 3300049588 Bacteria 1082
247 Ga0501072_0502258 3300049588 Bacteria 959
248 Ga0501072_0759706 3300049588 Bacteria 760
249 Ga0501072_1127548 3300049588 Unclassified 610
250 Ga0501072_1397019 3300049588 Bacteria 541
251 Ga0501073_0711580 3300049589 Unclassified 693
252 Ga0501074_0034829 3300049590 Bacteria 3649
253 Ga0501074_0045873 3300049590 Bacteria 3160
254 Ga0501075_0005139 3300049591 Bacteria 8949
255 Ga0501075_0043656 3300049591 Bacteria 3362
256 Ga0501075_0086281 3300049591 Bacteria 2378
257 Ga0501075_0163718 3300049591 Bacteria 1697
258 Ga0501075_0566933 3300049591 Bacteria 866
259 Ga0501076_0009286 3300049592 Bacteria 7255
260 Ga0501076_0049847 3300049592 Bacteria 3312
261 Ga0501076_0239372 3300049592 Bacteria 1485
262 Ga0501076_0381554 3300049592 Bacteria 1158
263 Ga0501076_0407296 3300049592 Bacteria 1118
264 Ga0501076_0471120 3300049592 Bacteria 1034
265 Ga0501076_0583289 3300049592 Unclassified 922
266 Ga0501076_0644724 3300049592 Bacteria 874
267 Ga0501076_1144895 3300049592 Bacteria 640
268 Ga0501077_0074599 3300049593 Bacteria 2148
269 Ga0501077_0084541 3300049593 Bacteria 2011
270 Ga0501077_0159597 3300049593 Bacteria 1431
271 Ga0501077_0611203 3300049593 Bacteria 700
272 Ga0501077_0670719 3300049593 Bacteria 666
273 Ga0501077_0697322 3300049593 Bacteria 652
274 Ga0501077_0995772 3300049593 Bacteria 539
275 Ga0501077_1005329 3300049593 Bacteria 537
276 Ga0501259_173285 3300049688 Bacteria 544
277 Ga0501261_033226 3300049690 Unclassified 788
278 Ga0501079_0000515 3300049741 Bacteria 25161
279 Ga0501079_0101460 3300049741 Bacteria 2231
280 Ga0501079_0749755 3300049741 Bacteria 768
281 Ga0501079_1108829 3300049741 Unclassified 624
282 Ga0501080_0016662 3300049742 Bacteria 6785
283 Ga0501081_0001918 3300049743 Bacteria 12908
284 Ga0501081_0134237 3300049743 Bacteria 1770
285 Ga0501081_0272018 3300049743 Bacteria 1239
286 Ga0501081_0276033 3300049743 Bacteria 1230
287 Ga0501081_0377943 3300049743 Unclassified 1046
288 Ga0501081_0432290 3300049743 Bacteria 977
289 Ga0501081_0521514 3300049743 Bacteria 886
290 Ga0501081_0889799 3300049743 Unclassified 671
291 Ga0501083_0112080 3300049744 Bacteria 1793
292 Ga0501035_0014173 3300049822 Bacteria 7356
293 Ga0501035_0074417 3300049822 Bacteria 3005
294 Ga0501035_0087731 3300049822 Bacteria 2741
295 Ga0501035_0825444 3300049822 Bacteria 739
296 Ga0501035_1071781 3300049822 Bacteria 631
297 Ga0501044_0207609 3300049823 Bacteria 1914
298 Ga0501044_0608684 3300049823 Bacteria 985
299 Ga0501044_1501395 3300049823 Bacteria 539
300 Ga0501045_0038756 3300049824 Bacteria 3466
301 Ga0501045_0086387 3300049824 Bacteria 2315
302 Ga0501045_0170672 3300049824 Bacteria 1620
303 Ga0501045_0200184 3300049824 Bacteria 1488
304 Ga0501045_0328729 3300049824 Unclassified 1137
305 Ga0501045_0835819 3300049824 Bacteria 677
306 nmdc:mga03683_585541_c1 3300050489 Unclassified 545
307 nmdc:mga05p37_110800_c1 3300050507 Bacteria 3376
308 nmdc:mga05p37_36367_c1 3300050507 Bacteria 6041
309 nmdc:mga05p37_532_c1 3300050507 Bacteria 30177
310 nmdc:mga05p37_931182_c1 3300050507 Bacteria 933
311 nmdc:mga09592_629_c3 3300050508 Bacteria 11653
312 nmdc:mga0qj67_126586_c1 3300050509 Bacteria 2067
313 nmdc:mga0qj67_22187_c1 3300050509 Bacteria 4875
314 nmdc:mga0qj67_42886_c1 3300050509 Bacteria 3562
315 nmdc:mga06r32_1005811_c1 3300050510 Bacteria 786
316 nmdc:mga06r32_436021_c1 3300050510 Bacteria 1291
317 nmdc:mga08y16_1035159_c1 3300050511 Bacteria 799
318 nmdc:mga08y16_111372_c1 3300050511 Bacteria 2850
319 nmdc:mga08y16_1174732_c1 3300050511 Bacteria 739
320 nmdc:mga08y16_96236_c1 3300050511 Bacteria 3083
321 nmdc:mga0n895_327644_c1 3300050512 Bacteria 1552
322 nmdc:mga0a205_907604_c1 3300050515 Unclassified 728
323 Ga0495619_0085958 3300053085 Unclassified 2125
324 Ga0501084_0034478 3300054114 Bacteria 4232
325 Ga0501084_0122808 3300054114 Bacteria 2184
326 Ga0501084_0207966 3300054114 Bacteria 1651
327 Ga0501084_0384154 3300054114 Bacteria 1186
328 Ga0590077_036488 3300059426 Unclassified 1085
329 Ga0501082_0002993 3300060353 Bacteria 14760
330 Ga0501082_0095281 3300060353 Bacteria 2572
331 Ga0501082_0163053 3300060353 Bacteria 1937
332 Ga0501082_0229406 3300060353 Bacteria 1616
333 Ga0501082_0323379 3300060353 Bacteria 1344
334 Ga0501082_0585838 3300060353 Bacteria 976
335 Ga0501082_1176502 3300060353 Unclassified 670
336 Ga0530510_0001039 3300061734 Bacteria 18381
337 Ga0530510_0016537 3300061734 Bacteria 5222
338 Ga0530510_0056161 3300061734 Bacteria 2844
339 Ga0530510_0056511 3300061734 Bacteria 2835
340 Ga0530510_0136062 3300061734 Bacteria 1809
341 Ga0530510_0612991 3300061734 Archaea 828
342 nmdc:mga0n895_277895_c1
343 rootH1_10268298
344 JGI25407J50210_10008218
345 JGI25407J50210_10059077
346 Ga0068869_100773956
347 Ga0068868_101466238
348 Ga0070703_10350063
349 Ga0070714_101829484
350 Ga0070700_100405873
351 Ga0070700_100510941
352 Ga0070694_100585418
353 Ga0070708_100360030
354 Ga0070708_100656998
355 Ga0070681_11347800
356 Ga0070706_101004940
357 Ga0070707_100112242
358 Ga0070698_100556427
359 Ga0070684_100405322
360 Ga0070697_100257913
361 Ga0070704_100260046
362 Ga0068855_100796323
363 Ga0081455_10005333
364 Ga0081455_10106187
365 Ga0081455_10113208
366 Ga0081455_10249844
367 Ga0081538_10000080
368 Ga0081538_10001298
369 Ga0081538_10001526
370 Ga0081538_10002401
371 Ga0081538_10004814
372 Ga0081538_10081599
373 Ga0081538_10087522
374 Ga0081538_10209858
375 Ga0081539_10004331
376 Ga0075432_10189222
377 Ga0075428_100351598
378 Ga0075430_100358856
379 Ga0075430_100784603
380 Ga0075430_101301881
381 Ga0075433_10531856
382 Ga0075433_10900305
383 Ga0075434_100291713
384 Ga0075434_100575556
385 Ga0075429_101162330
386 Ga0068865_101426002
387 Ga0111539_10048924
388 Ga0111539_11012560
389 Ga0111539_11089218
390 Ga0105245_10638148
391 Ga0105245_10852711
392 Ga0114129_10002148
393 Ga0114129_10026620
394 Ga0114129_10052081
395 Ga0114129_10129390
396 Ga0114129_11391545
397 Ga0105243_10296526
398 Ga0105242_11292577
399 Ga0105248_10528299
400 Ga0157369_10041429
401 Ga0157379_11363612
402 Ga0207684_10921765
403 Ga0207646_10561311
404 Ga0207650_10947420
405 Ga0207687_11289101
406 Ga0207686_11309519
407 Ga0207704_10728745
408 Ga0207711_10441294
409 Ga0207661_10233206
410 Ga0207667_10739132
411 Ga0207708_10130941
412 Ga0207708_10822322
413 Ga0209998_10004759
414 Ga0207428_10091991
415 Ga0265316_10465359
416 Ga0307408_100118532
417 Ga0307408_100165182
418 Ga0307408_100801322
419 Ga0307405_10011112
420 Ga0307405_10185822
421 Ga0307405_10941665
422 Ga0307413_10182247
423 Ga0307410_10017981
424 Ga0307410_10154190
425 Ga0307410_10157508
426 Ga0326468_10015486
427 Ga0307406_10080385
428 Ga0307406_10210646
429 Ga0307407_10047735
430 Ga0307407_10055470
431 Ga0307407_10725665
432 Ga0307412_10052502
433 Ga0307412_10241219
434 Ga0307409_100008905
435 Ga0307409_100009794
436 Ga0307409_100292622
437 Ga0307409_100555416
438 Ga0307409_100715791
439 Ga0307409_102407436
440 Ga0307416_100000928
441 Ga0307416_100037798
442 Ga0307416_100096804
443 Ga0307416_100451157
444 Ga0307414_10166723
445 Ga0307414_10337369
446 Ga0307411_10213576
447 Ga0307411_10387408
448 Ga0307415_100004259
449 Ga0307415_100165388
450 Ga0373925_0518160
451 Ga0395899_0164995
452 Ga0395900_0382126
453 Ga0395900_0422682
454 Ga0395900_0720971
455 Ga0395898_0072520
456 Ga0395898_0177168
457 Ga0395898_0567613
458 Ga0395905_0295724
459 Ga0395905_0599624
460 Ga0395905_0792247
461 Ga0395905_0822189
462 Ga0395901_0013278
463 Ga0395901_0159378
464 Ga0395901_0211574
465 Ga0395901_0560633
466 Ga0395901_1128166
467 Ga0395901_1430964
468 Ga0436363_1258069
469 Ga0439438_104345
470 Ga0439461_0111258
471 Ga0439445_0012487
472 Ga0439452_066742
473 Ga0450920_093015
474 Ga0450898_016494
475 Ga0450905_036129
476 Ga0439446_0004129
477 Ga0439434_0063821
478 Ga0439460_0018165
479 Ga0450918_016350
480 Ga0439440_0092358
481 Ga0466963_0238323
482 Ga0466967_0674178
483 Ga0466967_0674617
484 Ga0495582_0464191
485 Ga0495662_0341222
486 Ga0495618_0178716
487 Ga0495618_0839216
488 Ga0495630_0047879
489 Ga0495665_0199500
490 Ga0495640_0238809
491 Ga0495586_0001519
492 Ga0495634_0143529
493 Ga0495613_0043042
494 Ga0495613_0277244
495 Ga0495624_0404858
496 Ga0495581_0712765
497 Ga0495674_0050430
498 Ga0495674_0363935
499 Ga0495676_0451342
500 Ga0495680_0229261
501 Ga0495680_0312941
502 Ga0495593_0576232
503 Ga0496100_1319287
504 Ga0496101_0054029
505 Ga0496102_0231329
506 Ga0496104_0095705
507 Ga0496104_0656093
508 Ga0496106_1198897
509 Ga0496108_0665566
510 Ga0496109_0661002
511 Ga0496111_0353770
512 Ga0496111_0393130
513 Ga0496111_0591823
514 Ga0496112_1336067
515 Ga0496112_1607544
516 Ga0496113_0341378
517 Ga0496113_0659249
518 Ga0501031_0044840
519 Ga0501031_0509675
520 Ga0501031_0514824
521 Ga0501031_0558433
522 Ga0501032_0146246
523 Ga0501032_0540814
524 Ga0501032_0687969
525 Ga0501033_0165549
526 Ga0501033_0280187
527 Ga0501033_1195659
528 Ga0501034_0022438
529 Ga0501036_0005203
530 Ga0501036_0007002
531 Ga0501036_0010372
532 Ga0501036_0360418
533 Ga0501036_0445832
534 Ga0501037_0003886
535 Ga0501038_0059781
536 Ga0501038_0278203
537 Ga0501038_0377347
538 Ga0501039_0044514
539 Ga0501039_0655782
540 Ga0501040_0005236
541 Ga0501040_0117616
542 Ga0501040_0255638
543 Ga0501040_0287739
544 Ga0501040_0604034
545 Ga0501040_0727487
546 Ga0501041_0001056
547 Ga0501041_0065515
548 Ga0501041_0213084
549 Ga0501041_0244502
550 Ga0501041_0289778
551 Ga0501041_0991197
552 Ga0501042_0094392
553 Ga0501042_0121611
554 Ga0501042_0445953
555 Ga0501042_0500393
556 Ga0501042_0636332
557 Ga0501042_0966123
558 Ga0501043_0054566
559 Ga0501043_0067853
560 Ga0501043_0097770
561 Ga0501043_0371261
562 Ga0501046_0022182
563 Ga0501046_0183759
564 Ga0501046_0362881
565 Ga0501047_0058177
566 Ga0501048_0022075
567 Ga0501048_0046714
568 Ga0501048_0274323
569 Ga0501048_0461915
570 Ga0501068_0051610
571 Ga0501068_0234886
572 Ga0501068_0296069
573 Ga0501068_0392303
574 Ga0501068_1112784
575 Ga0501069_0115402
576 Ga0501070_0352174
577 Ga0501070_0461092
578 Ga0501071_0008081
579 Ga0501071_0145985
580 Ga0501071_0334476
581 Ga0501071_0361809
582 Ga0501071_0835446
583 Ga0501072_0056800
584 Ga0501072_0087264
585 Ga0501072_0129073
586 Ga0501072_0227324
587 Ga0501072_0405272
588 Ga0501072_0502258
589 Ga0501072_0759706
590 Ga0501072_1127548
591 Ga0501072_1397019
592 Ga0501073_0711580
593 Ga0501074_0034829
594 Ga0501074_0045873
595 Ga0501075_0005139
596 Ga0501075_0043656
597 Ga0501075_0086281
598 Ga0501075_0163718
599 Ga0501075_0566933
600 Ga0501076_0009286
601 Ga0501076_0049847
602 Ga0501076_0239372
603 Ga0501076_0381554
604 Ga0501076_0407296
605 Ga0501076_0471120
606 Ga0501076_0583289
607 Ga0501076_0644724
608 Ga0501076_1144895
609 Ga0501077_0074599
610 Ga0501077_0084541
611 Ga0501077_0159597
612 Ga0501077_0611203
613 Ga0501077_0670719
614 Ga0501077_0697322
615 Ga0501077_0995772
616 Ga0501077_1005329
617 Ga0501259_173285
618 Ga0501261_033226
619 Ga0501079_0000515
620 Ga0501079_0101460
621 Ga0501079_0749755
622 Ga0501079_1108829
623 Ga0501080_0016662
624 Ga0501081_0001918
625 Ga0501081_0134237
626 Ga0501081_0272018
627 Ga0501081_0276033
628 Ga0501081_0377943
629 Ga0501081_0432290
630 Ga0501081_0521514
631 Ga0501081_0889799
632 Ga0501083_0112080
633 Ga0501035_0014173
634 Ga0501035_0074417
635 Ga0501035_0087731
636 Ga0501035_0825444
637 Ga0501035_1071781
638 Ga0501044_0207609
639 Ga0501044_0608684
640 Ga0501044_1501395
641 Ga0501045_0038756
642 Ga0501045_0086387
643 Ga0501045_0170672
644 Ga0501045_0200184
645 Ga0501045_0328729
646 Ga0501045_0835819
647 nmdc:mga03683_585541_c1
648 nmdc:mga05p37_110800_c1
649 nmdc:mga05p37_36367_c1
650 nmdc:mga05p37_532_c1
651 nmdc:mga05p37_931182_c1
652 nmdc:mga09592_629_c3
653 nmdc:mga0qj67_126586_c1
654 nmdc:mga0qj67_22187_c1
655 nmdc:mga0qj67_42886_c1
656 nmdc:mga06r32_1005811_c1
657 nmdc:mga06r32_436021_c1
658 nmdc:mga08y16_1035159_c1
659 nmdc:mga08y16_111372_c1
660 nmdc:mga08y16_1174732_c1
661 nmdc:mga08y16_96236_c1
662 nmdc:mga0n895_327644_c1
663 nmdc:mga0a205_907604_c1
664 Ga0495619_0085958
665 Ga0501084_0034478
666 Ga0501084_0122808
667 Ga0501084_0207966
668 Ga0501084_0384154
669 Ga0590077_036488
670 Ga0501082_0002993
671 Ga0501082_0095281
672 Ga0501082_0163053
673 Ga0501082_0229406
674 Ga0501082_0323379
675 Ga0501082_0585838
676 Ga0501082_1176502
677 Ga0530510_0001039
678 Ga0530510_0016537
679 Ga0530510_0056161
680 Ga0530510_0056511
681 Ga0530510_0136062
682 Ga0530510_0612991

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03100

CcmE

CcmE

12

139

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f8t-assembly1.cif.gz_A crystal structure analysis of a full-length mcm homolog from methanopyrus kandleri 0.8204 46 120
2pi2-assembly3.cif.gz_C full-length replication protein a subunits rpa14 and rpa32 0.7775 45 118
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.7544 32 119
1sr3-assembly1.cif.gz_A solution structure of the heme chaperone ccme of escherichia coli 0.7503 31 127
8kg8-assembly1.cif.gz_3 yeast replisome in state ii 0.747 34 102
ID Description Score Start End Superfamily
3f8tA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7668 36 119 2.40.50.140
af_Q5APD5_1_109_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7563 29 119 2.40.50.140
af_P9WF31_10_105_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7555 44 116 2.40.50.140
1j6qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7544 32 119 2.40.50.140
af_Q6IGM3_136_223_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7528 46 123 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A538E362-F1-model_v4 Cytochrome c maturation protein CcmE 0.9195 2 125 GO:0005886
GO:0017004
GO:0020037
AF-A0A538E362-F1-model_v4 Cytochrome c maturation protein CcmE 0.8792 2 125 GO:0005886
GO:0017004
GO:0020037
AF-A0A538D7I7-F1-model_v4 Cytochrome c maturation protein CcmE 0.8755 1 129 GO:0005886
GO:0017004
GO:0020037
AF-A0A7W1JIT1-F1-model_v4 Cytochrome c maturation protein CcmE 0.8653 49 128 GO:0005886
GO:0017004
GO:0020037
AF-A0A7W1BRT6-F1-model_v4 Cytochrome c maturation protein CcmE 0.848 24 129 GO:0005886
GO:0017004
GO:0020037

Map