F414926
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 341 | 195 | 341 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300049589|Ga0501073_0220079|Ga0501073_0220079_320_877 |
| Length | 172 |
| Sequence | LGLFFLLSPKKMAYRIGSGIDFHRLAEGRKLWIGGVEIPHYKGAVGHSDADVLLGDIGLHFPDTSPDFKDIDSKILLKRTFALIREEGYSIVNIDSTLCLDVPKIKPYVEAMRKTIAAILEIAVTDISIKATTTEKMGFAGREEGLVAYATALLQKESCGLSADGSKLKAQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 119 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 120 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 121 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 122 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 123 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 124 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 125 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 127 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 128 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 129 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 130 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 131 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 132 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 133 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 134 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 135 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 136 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 137 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 138 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 139 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 140 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 141 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 142 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 143 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 144 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 145 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 146 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 172 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 179 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 183 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 184 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 185 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 186 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 187 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 188 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 189 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 190 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 191 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 192 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 193 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 194 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.57 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 91.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_9133682 | 2162886011 | Bacteria | 1136 |
| 2 | rootL2_10001282 | 3300003322 | Bacteria | 10645 |
| 3 | rootL2_10026153 | 3300003322 | Bacteria | 1719 |
| 4 | rootH1_10024331 | 3300003323 | Bacteria | 2631 |
| 5 | rootH1_10105911 | 3300003323 | Bacteria | 8604 |
| 6 | Ga0065704_10226489 | 3300005289 | Bacteria | 1057 |
| 7 | Ga0065712_10005542 | 3300005290 | Bacteria | 5301 |
| 8 | Ga0065712_10087624 | 3300005290 | Unclassified | 2563 |
| 9 | Ga0065715_10238529 | 3300005293 | Bacteria | 1208 |
| 10 | Ga0065715_10270355 | 3300005293 | Bacteria | 1100 |
| 11 | Ga0070658_10941252 | 3300005327 | Bacteria | 751 |
| 12 | Ga0070676_10163942 | 3300005328 | Unclassified | 1433 |
| 13 | Ga0070690_100161782 | 3300005330 | Bacteria | 1534 |
| 14 | Ga0070670_100051396 | 3300005331 | Bacteria | 3539 |
| 15 | Ga0070670_100225582 | 3300005331 | Bacteria | 1630 |
| 16 | Ga0070670_100260631 | 3300005331 | Bacteria | 1511 |
| 17 | Ga0070670_100347473 | 3300005331 | Bacteria | 1302 |
| 18 | Ga0070677_10050324 | 3300005333 | Bacteria | 1682 |
| 19 | Ga0068869_100020819 | 3300005334 | Bacteria | 4504 |
| 20 | Ga0068869_100035136 | 3300005334 | Bacteria | 3551 |
| 21 | Ga0068869_100803116 | 3300005334 | Bacteria | 809 |
| 22 | Ga0070682_100681533 | 3300005337 | Bacteria | 822 |
| 23 | Ga0070660_101525978 | 3300005339 | Bacteria | 568 |
| 24 | Ga0070689_100016482 | 3300005340 | Bacteria | 5408 |
| 25 | Ga0070689_100693786 | 3300005340 | Bacteria | 888 |
| 26 | Ga0070687_100008500 | 3300005343 | Bacteria | 4355 |
| 27 | Ga0070668_100113899 | 3300005347 | Bacteria | 2155 |
| 28 | Ga0070668_100141330 | 3300005347 | Unclassified | 1940 |
| 29 | Ga0070669_100339310 | 3300005353 | Bacteria | 1217 |
| 30 | Ga0070669_100825382 | 3300005353 | Unclassified | 789 |
| 31 | Ga0070675_100021615 | 3300005354 | Bacteria | 5141 |
| 32 | Ga0070675_101289451 | 3300005354 | Bacteria | 673 |
| 33 | Ga0070671_100310416 | 3300005355 | Bacteria | 1343 |
| 34 | Ga0070674_101504764 | 3300005356 | Bacteria | 605 |
| 35 | Ga0070673_100075464 | 3300005364 | Bacteria | 2719 |
| 36 | Ga0070688_100284684 | 3300005365 | Unclassified | 1189 |
| 37 | Ga0070688_100545746 | 3300005365 | Bacteria | 880 |
| 38 | Ga0070659_100468711 | 3300005366 | Bacteria | 1070 |
| 39 | Ga0070659_100693729 | 3300005366 | Bacteria | 880 |
| 40 | Ga0070700_100093978 | 3300005441 | Bacteria | 1963 |
| 41 | Ga0070708_100369019 | 3300005445 | Bacteria | 1353 |
| 42 | Ga0070678_100089252 | 3300005456 | Bacteria | 2359 |
| 43 | Ga0070678_100100327 | 3300005456 | Bacteria | 2242 |
| 44 | Ga0068867_100142712 | 3300005459 | Bacteria | 1873 |
| 45 | Ga0068867_100204046 | 3300005459 | Bacteria | 1584 |
| 46 | Ga0068867_100235936 | 3300005459 | Bacteria | 1481 |
| 47 | Ga0068867_101328444 | 3300005459 | Bacteria | 664 |
| 48 | Ga0070685_10124024 | 3300005466 | Bacteria | 1607 |
| 49 | Ga0070685_10235800 | 3300005466 | Bacteria | 1205 |
| 50 | Ga0070707_100156642 | 3300005468 | Bacteria | 2219 |
| 51 | Ga0070707_101797752 | 3300005468 | Bacteria | 580 |
| 52 | Ga0070698_100003140 | 3300005471 | Bacteria | 18206 |
| 53 | Ga0070698_100771586 | 3300005471 | Bacteria | 905 |
| 54 | Ga0070699_100488464 | 3300005518 | Unclassified | 1118 |
| 55 | Ga0070699_100521039 | 3300005518 | Bacteria | 1081 |
| 56 | Ga0068853_100641313 | 3300005539 | Bacteria | 1011 |
| 57 | Ga0068853_100902384 | 3300005539 | Bacteria | 849 |
| 58 | Ga0070672_100014892 | 3300005543 | Bacteria | 5521 |
| 59 | Ga0070672_100033475 | 3300005543 | Bacteria | 3892 |
| 60 | Ga0070672_100226908 | 3300005543 | Bacteria | 1568 |
| 61 | Ga0070672_100524009 | 3300005543 | Unclassified | 1027 |
| 62 | Ga0070672_100727217 | 3300005543 | Unclassified | 870 |
| 63 | Ga0070686_100216706 | 3300005544 | Bacteria | 1381 |
| 64 | Ga0070686_100237747 | 3300005544 | Bacteria | 1325 |
| 65 | Ga0070686_100734578 | 3300005544 | Bacteria | 790 |
| 66 | Ga0068857_100296259 | 3300005577 | Bacteria | 1491 |
| 67 | Ga0068859_100010163 | 3300005617 | Bacteria | 9477 |
| 68 | Ga0068859_100042974 | 3300005617 | Bacteria | 4541 |
| 69 | Ga0068859_100636903 | 3300005617 | Bacteria | 1158 |
| 70 | Ga0068859_100639075 | 3300005617 | Bacteria | 1156 |
| 71 | Ga0068864_100032439 | 3300005618 | Bacteria | 4439 |
| 72 | Ga0068864_100292287 | 3300005618 | Bacteria | 1523 |
| 73 | Ga0068864_100456673 | 3300005618 | Bacteria | 1222 |
| 74 | Ga0068864_100473344 | 3300005618 | Bacteria | 1201 |
| 75 | Ga0068866_10311059 | 3300005718 | Bacteria | 987 |
| 76 | Ga0068861_100017009 | 3300005719 | Bacteria | 5157 |
| 77 | Ga0068861_100405084 | 3300005719 | Bacteria | 1211 |
| 78 | Ga0068861_100586846 | 3300005719 | Bacteria | 1021 |
| 79 | Ga0068861_100714457 | 3300005719 | Unclassified | 932 |
| 80 | Ga0068870_10016861 | 3300005840 | Bacteria | 3501 |
| 81 | Ga0068870_11149594 | 3300005840 | Bacteria | 560 |
| 82 | Ga0068863_100514694 | 3300005841 | Bacteria | 1179 |
| 83 | Ga0068863_101371271 | 3300005841 | Bacteria | 714 |
| 84 | Ga0068858_100067650 | 3300005842 | Bacteria | 3309 |
| 85 | Ga0068860_100036699 | 3300005843 | Bacteria | 4694 |
| 86 | Ga0068860_100236918 | 3300005843 | Bacteria | 1774 |
| 87 | Ga0068860_100271871 | 3300005843 | Bacteria | 1654 |
| 88 | Ga0068860_100280639 | 3300005843 | Unclassified | 1628 |
| 89 | Ga0068860_100587500 | 3300005843 | Bacteria | 1118 |
| 90 | Ga0068862_100049946 | 3300005844 | Bacteria | 3573 |
| 91 | Ga0068862_100071854 | 3300005844 | Bacteria | 2988 |
| 92 | Ga0068862_100079748 | 3300005844 | Bacteria | 2838 |
| 93 | Ga0068862_100398500 | 3300005844 | Bacteria | 1287 |
| 94 | Ga0068862_100421989 | 3300005844 | Unclassified | 1252 |
| 95 | Ga0068862_101267964 | 3300005844 | Unclassified | 737 |
| 96 | Ga0068862_101979288 | 3300005844 | Bacteria | 593 |
| 97 | Ga0070715_10056317 | 3300006163 | Bacteria | 1710 |
| 98 | Ga0075366_10034607 | 3300006195 | Bacteria | 2976 |
| 99 | Ga0097621_100042351 | 3300006237 | Bacteria | 3667 |
| 100 | Ga0097621_101629678 | 3300006237 | Bacteria | 614 |
| 101 | Ga0068871_100036503 | 3300006358 | Bacteria | 3913 |
| 102 | Ga0068871_100112968 | 3300006358 | Bacteria | 2287 |
| 103 | Ga0068871_100205956 | 3300006358 | Bacteria | 1700 |
| 104 | Ga0075428_100097080 | 3300006844 | Bacteria | 3212 |
| 105 | Ga0075430_100122337 | 3300006846 | Bacteria | 2169 |
| 106 | Ga0075431_100027219 | 3300006847 | Bacteria | 5865 |
| 107 | Ga0075429_100284717 | 3300006880 | Unclassified | 1447 |
| 108 | Ga0068865_100028133 | 3300006881 | Bacteria | 3721 |
| 109 | Ga0068865_100114337 | 3300006881 | Bacteria | 1996 |
| 110 | Ga0068865_100569109 | 3300006881 | Bacteria | 954 |
| 111 | Ga0097620_100010163 | 3300006931 | Bacteria | 9477 |
| 112 | Ga0097620_100042973 | 3300006931 | Bacteria | 4541 |
| 113 | Ga0097620_100636897 | 3300006931 | Bacteria | 1158 |
| 114 | Ga0097620_100639095 | 3300006931 | Bacteria | 1156 |
| 115 | Ga0105251_10183396 | 3300009011 | Bacteria | 943 |
| 116 | Ga0105240_10034106 | 3300009093 | Bacteria | 6568 |
| 117 | Ga0111539_10191602 | 3300009094 | Bacteria | 2386 |
| 118 | Ga0111539_10970212 | 3300009094 | Unclassified | 988 |
| 119 | Ga0105245_10404443 | 3300009098 | Bacteria | 1365 |
| 120 | Ga0105247_10000918 | 3300009101 | Bacteria | 22128 |
| 121 | Ga0105247_10325221 | 3300009101 | Bacteria | 1074 |
| 122 | Ga0114129_10005818 | 3300009147 | Bacteria | 17462 |
| 123 | Ga0114129_10578147 | 3300009147 | Unclassified | 1458 |
| 124 | Ga0105243_10426642 | 3300009148 | Bacteria | 1238 |
| 125 | Ga0105241_10046887 | 3300009174 | Bacteria | 3283 |
| 126 | Ga0105242_10042423 | 3300009176 | Bacteria | 3674 |
| 127 | Ga0105242_10205131 | 3300009176 | Bacteria | 1753 |
| 128 | Ga0105242_10612825 | 3300009176 | Unclassified | 1053 |
| 129 | Ga0105237_10131165 | 3300009545 | Bacteria | 2501 |
| 130 | Ga0105237_10492543 | 3300009545 | Bacteria | 1232 |
| 131 | Ga0105249_10002666 | 3300009553 | Bacteria | 15430 |
| 132 | Ga0105249_10026771 | 3300009553 | Bacteria | 5200 |
| 133 | Ga0105249_12604703 | 3300009553 | Bacteria | 578 |
| 134 | Ga0105239_10001102 | 3300010375 | Bacteria | 37330 |
| 135 | Ga0105239_10493551 | 3300010375 | Bacteria | 1392 |
| 136 | Ga0105246_10113927 | 3300011119 | Bacteria | 1991 |
| 137 | Ga0157370_10040656 | 3300013104 | Unclassified | 4489 |
| 138 | Ga0157370_10483703 | 3300013104 | Bacteria | 1137 |
| 139 | Ga0157370_11111512 | 3300013104 | Bacteria | 714 |
| 140 | Ga0157374_10119542 | 3300013296 | Bacteria | 2541 |
| 141 | Ga0157374_10439423 | 3300013296 | Bacteria | 1305 |
| 142 | Ga0157374_10611976 | 3300013296 | Bacteria | 1100 |
| 143 | Ga0157378_10016139 | 3300013297 | Bacteria | 6541 |
| 144 | Ga0157378_10727474 | 3300013297 | Bacteria | 1014 |
| 145 | Ga0157378_11959619 | 3300013297 | Bacteria | 635 |
| 146 | Ga0163162_10027924 | 3300013306 | Bacteria | 5582 |
| 147 | Ga0163162_10469779 | 3300013306 | Unclassified | 1389 |
| 148 | Ga0163162_10677806 | 3300013306 | Bacteria | 1154 |
| 149 | Ga0163162_10980727 | 3300013306 | Bacteria | 955 |
| 150 | Ga0163162_11927733 | 3300013306 | Bacteria | 676 |
| 151 | Ga0157375_10189326 | 3300013308 | Bacteria | 2212 |
| 152 | Ga0157375_10389020 | 3300013308 | Unclassified | 1561 |
| 153 | Ga0157375_10733188 | 3300013308 | Bacteria | 1140 |
| 154 | Ga0163163_10016179 | 3300014325 | Bacteria | 6924 |
| 155 | Ga0157380_10010181 | 3300014326 | Bacteria | 6756 |
| 156 | Ga0157380_10236087 | 3300014326 | Bacteria | 1645 |
| 157 | Ga0157380_10311099 | 3300014326 | Unclassified | 1456 |
| 158 | Ga0157380_10787073 | 3300014326 | Bacteria | 967 |
| 159 | Ga0157380_11672353 | 3300014326 | Bacteria | 693 |
| 160 | Ga0157377_10133660 | 3300014745 | Bacteria | 1518 |
| 161 | Ga0157377_10257461 | 3300014745 | Bacteria | 1134 |
| 162 | Ga0157379_10701979 | 3300014968 | Bacteria | 950 |
| 163 | Ga0157376_10030487 | 3300014969 | Bacteria | 4307 |
| 164 | Ga0157376_10086267 | 3300014969 | Bacteria | 2706 |
| 165 | Ga0157376_10643897 | 3300014969 | Unclassified | 1059 |
| 166 | Ga0163161_10027259 | 3300017792 | Unclassified | 4052 |
| 167 | Ga0163161_10114435 | 3300017792 | Unclassified | 2021 |
| 168 | Ga0163161_10361285 | 3300017792 | Unclassified | 1156 |
| 169 | Ga0163161_11494750 | 3300017792 | Unclassified | 593 |
| 170 | Ga0209258_116611 | 3300025242 | Bacteria | 819 |
| 171 | Ga0207682_10015427 | 3300025893 | Bacteria | 2973 |
| 172 | Ga0207682_10042208 | 3300025893 | Bacteria | 1863 |
| 173 | Ga0207710_10000975 | 3300025900 | Bacteria | 15053 |
| 174 | Ga0207645_10027658 | 3300025907 | Bacteria | 3660 |
| 175 | Ga0207643_10002549 | 3300025908 | Bacteria | 9869 |
| 176 | Ga0207705_10583630 | 3300025909 | Bacteria | 869 |
| 177 | Ga0207654_10036722 | 3300025911 | Bacteria | 2739 |
| 178 | Ga0207671_10245335 | 3300025914 | Bacteria | 1407 |
| 179 | Ga0207662_10007225 | 3300025918 | Bacteria | 6041 |
| 180 | Ga0207681_10099828 | 3300025923 | Bacteria | 2091 |
| 181 | Ga0207650_10167270 | 3300025925 | Bacteria | 1745 |
| 182 | Ga0207659_10090572 | 3300025926 | Bacteria | 2283 |
| 183 | Ga0207659_10453448 | 3300025926 | Bacteria | 1080 |
| 184 | Ga0207659_11054833 | 3300025926 | Bacteria | 699 |
| 185 | Ga0207687_10425560 | 3300025927 | Bacteria | 1096 |
| 186 | Ga0207686_10012010 | 3300025934 | Bacteria | 4755 |
| 187 | Ga0207686_10330223 | 3300025934 | Bacteria | 1142 |
| 188 | Ga0207670_10074542 | 3300025936 | Bacteria | 2356 |
| 189 | Ga0207669_10144702 | 3300025937 | Bacteria | 1656 |
| 190 | Ga0207704_10039803 | 3300025938 | Bacteria | 2741 |
| 191 | Ga0207704_10089737 | 3300025938 | Bacteria | 2015 |
| 192 | Ga0207691_10057710 | 3300025940 | Bacteria | 3532 |
| 193 | Ga0207691_10058899 | 3300025940 | Bacteria | 3493 |
| 194 | Ga0207691_11026891 | 3300025940 | Bacteria | 687 |
| 195 | Ga0207689_10122085 | 3300025942 | Bacteria | 2142 |
| 196 | Ga0207667_10004643 | 3300025949 | Bacteria | 16844 |
| 197 | Ga0207651_10314744 | 3300025960 | Bacteria | 1307 |
| 198 | Ga0207651_10377649 | 3300025960 | Bacteria | 1200 |
| 199 | Ga0207712_10003008 | 3300025961 | Bacteria | 10775 |
| 200 | Ga0207712_10374649 | 3300025961 | Bacteria | 1190 |
| 201 | Ga0207668_10032704 | 3300025972 | Bacteria | 3441 |
| 202 | Ga0207668_10396198 | 3300025972 | Bacteria | 1166 |
| 203 | Ga0207658_10756965 | 3300025986 | Bacteria | 880 |
| 204 | Ga0207677_10695443 | 3300026023 | Bacteria | 902 |
| 205 | Ga0207639_10246829 | 3300026041 | Bacteria | 1555 |
| 206 | Ga0207639_10295894 | 3300026041 | Bacteria | 1429 |
| 207 | Ga0207708_10018473 | 3300026075 | Bacteria | 5251 |
| 208 | Ga0207702_10034910 | 3300026078 | Bacteria | 4205 |
| 209 | Ga0207641_10006210 | 3300026088 | Bacteria | 10104 |
| 210 | Ga0207648_10035073 | 3300026089 | Unclassified | 4422 |
| 211 | Ga0207676_10008498 | 3300026095 | Bacteria | 7301 |
| 212 | Ga0207676_10265672 | 3300026095 | Bacteria | 1551 |
| 213 | Ga0207674_10278770 | 3300026116 | Bacteria | 1620 |
| 214 | Ga0207675_100002556 | 3300026118 | Bacteria | 18017 |
| 215 | Ga0207675_100213523 | 3300026118 | Bacteria | 1857 |
| 216 | Ga0207675_100685651 | 3300026118 | Bacteria | 1033 |
| 217 | Ga0207675_100997348 | 3300026118 | Bacteria | 856 |
| 218 | Ga0207683_10128161 | 3300026121 | Bacteria | 2282 |
| 219 | Ga0207683_10134616 | 3300026121 | Bacteria | 2224 |
| 220 | Ga0207683_10264563 | 3300026121 | Bacteria | 1570 |
| 221 | Ga0207683_11210029 | 3300026121 | Bacteria | 700 |
| 222 | Ga0207698_10355931 | 3300026142 | Bacteria | 1384 |
| 223 | Ga0207698_10854713 | 3300026142 | Bacteria | 915 |
| 224 | Ga0268265_10175518 | 3300028380 | Unclassified | 1836 |
| 225 | Ga0268265_10184448 | 3300028380 | Bacteria | 1796 |
| 226 | Ga0268265_10229870 | 3300028380 | Bacteria | 1629 |
| 227 | Ga0268265_10614447 | 3300028380 | Bacteria | 1040 |
| 228 | Ga0268265_10980009 | 3300028380 | Unclassified | 834 |
| 229 | Ga0268264_10004218 | 3300028381 | Bacteria | 12266 |
| 230 | Ga0268264_10163122 | 3300028381 | Bacteria | 2010 |
| 231 | Ga0268264_10464037 | 3300028381 | Bacteria | 1229 |
| 232 | Ga0268264_10480650 | 3300028381 | Bacteria | 1208 |
| 233 | Ga0268264_10945118 | 3300028381 | Bacteria | 867 |
| 234 | Ga0265338_10083042 | 3300028800 | Bacteria | 2681 |
| 235 | Ga0265340_10288280 | 3300031247 | Bacteria | 729 |
| 236 | Ga0265331_10011461 | 3300031250 | Bacteria | 4854 |
| 237 | Ga0265327_10000244 | 3300031251 | Bacteria | 108867 |
| 238 | Ga0265327_10000384 | 3300031251 | Bacteria | 83284 |
| 239 | Ga0307513_10141079 | 3300031456 | Bacteria | 2336 |
| 240 | Ga0307509_10052770 | 3300031507 | Bacteria | 4339 |
| 241 | Ga0307509_10191129 | 3300031507 | Bacteria | 1898 |
| 242 | Ga0307508_10001710 | 3300031616 | Bacteria | 24355 |
| 243 | Ga0307412_10266977 | 3300031911 | Bacteria | 1337 |
| 244 | Ga0373925_0134218 | 3300037068 | Bacteria | 1933 |
| 245 | Ga0439436_0000860 | 3300041404 | Bacteria | 8300 |
| 246 | Ga0439439_0031066 | 3300041406 | Bacteria | 1360 |
| 247 | Ga0439439_0074606 | 3300041406 | Bacteria | 911 |
| 248 | Ga0439453_0098898 | 3300041408 | Unclassified | 648 |
| 249 | Ga0451845_0782425 | 3300041501 | Bacteria | 563 |
| 250 | Ga0451847_0800830 | 3300041503 | Bacteria | 594 |
| 251 | Ga0451851_0225965 | 3300041507 | Bacteria | 655 |
| 252 | Ga0439441_002959 | 3300042001 | Bacteria | 2449 |
| 253 | Ga0439449_0064682 | 3300042007 | Bacteria | 1349 |
| 254 | Ga0439457_000276 | 3300042014 | Bacteria | 14138 |
| 255 | Ga0439462_0005731 | 3300042015 | Bacteria | 3071 |
| 256 | Ga0439460_0144192 | 3300042461 | Bacteria | 791 |
| 257 | Ga0451577_0002869 | 3300042876 | Bacteria | 19808 |
| 258 | Ga0466969_0000152 | 3300044656 | Bacteria | 37627 |
| 259 | Ga0466972_0000104 | 3300044658 | Bacteria | 73886 |
| 260 | Ga0466972_0168304 | 3300044658 | Bacteria | 1029 |
| 261 | Ga0466966_0000193 | 3300044684 | Bacteria | 40730 |
| 262 | Ga0466968_0013340 | 3300044735 | Bacteria | 3231 |
| 263 | Ga0466970_0106868 | 3300044765 | Bacteria | 1527 |
| 264 | Ga0466957_0001820 | 3300044842 | Bacteria | 11235 |
| 265 | Ga0466957_0007969 | 3300044842 | Bacteria | 6010 |
| 266 | Ga0466959_0000016 | 3300045049 | Bacteria | 144600 |
| 267 | Ga0451576_0400491 | 3300045051 | Bacteria | 1439 |
| 268 | Ga0495603_0633646 | 3300046455 | Bacteria | 612 |
| 269 | Ga0495638_0118264 | 3300046460 | Bacteria | 1568 |
| 270 | Ga0495596_0137947 | 3300046500 | Bacteria | 947 |
| 271 | Ga0495668_0005323 | 3300046616 | Bacteria | 8785 |
| 272 | Ga0495635_0309421 | 3300046663 | Bacteria | 1059 |
| 273 | Ga0495658_0108317 | 3300046683 | Bacteria | 1667 |
| 274 | Ga0495672_0153906 | 3300047320 | Unclassified | 1189 |
| 275 | Ga0501032_0025981 | 3300049569 | Bacteria | 4033 |
| 276 | Ga0501032_0078200 | 3300049569 | Bacteria | 2202 |
| 277 | Ga0501034_0005932 | 3300049571 | Bacteria | 13246 |
| 278 | Ga0501034_0006675 | 3300049571 | Bacteria | 12375 |
| 279 | Ga0501036_0002554 | 3300049572 | Bacteria | 14316 |
| 280 | Ga0501037_0024933 | 3300049573 | Bacteria | 4420 |
| 281 | Ga0501037_0187628 | 3300049573 | Unclassified | 1465 |
| 282 | Ga0501038_0025195 | 3300049574 | Bacteria | 5303 |
| 283 | Ga0501038_0211240 | 3300049574 | Bacteria | 1552 |
| 284 | Ga0501039_0094073 | 3300049575 | Bacteria | 2336 |
| 285 | Ga0501042_1177544 | 3300049578 | Bacteria | 559 |
| 286 | Ga0501043_0010490 | 3300049579 | Bacteria | 7255 |
| 287 | Ga0501043_0013511 | 3300049579 | Bacteria | 6389 |
| 288 | Ga0501043_0188745 | 3300049579 | Bacteria | 1603 |
| 289 | Ga0501043_0420362 | 3300049579 | Unclassified | 1008 |
| 290 | Ga0501046_0096769 | 3300049580 | Bacteria | 2268 |
| 291 | Ga0501047_0007092 | 3300049581 | Bacteria | 10523 |
| 292 | Ga0501047_0033433 | 3300049581 | Bacteria | 4964 |
| 293 | Ga0501047_0040734 | 3300049581 | Bacteria | 4492 |
| 294 | Ga0501047_0191350 | 3300049581 | Bacteria | 1909 |
| 295 | Ga0501048_0048076 | 3300049582 | Bacteria | 3043 |
| 296 | Ga0501048_0148506 | 3300049582 | Bacteria | 1658 |
| 297 | Ga0501048_0566957 | 3300049582 | Bacteria | 815 |
| 298 | Ga0501067_0031139 | 3300049583 | Bacteria | 2960 |
| 299 | Ga0501068_0058587 | 3300049584 | Bacteria | 2337 |
| 300 | Ga0501069_0091171 | 3300049585 | Bacteria | 1724 |
| 301 | Ga0501070_0007290 | 3300049586 | Bacteria | 9390 |
| 302 | Ga0501073_0193424 | 3300049589 | Bacteria | 1407 |
| 303 | Ga0501073_0220079 | 3300049589 | Unclassified | 1312 |
| 304 | Ga0501074_0009884 | 3300049590 | Bacteria | 6930 |
| 305 | Ga0501077_0105907 | 3300049593 | Bacteria | 1782 |
| 306 | Ga0501225_0003468 | 3300049705 | Bacteria | 4765 |
| 307 | Ga0501079_0275167 | 3300049741 | Bacteria | 1316 |
| 308 | Ga0501080_0032729 | 3300049742 | Bacteria | 4850 |
| 309 | Ga0501083_0012545 | 3300049744 | Bacteria | 5928 |
| 310 | Ga0501035_0006054 | 3300049822 | Bacteria | 11393 |
| 311 | Ga0501035_0007189 | 3300049822 | Bacteria | 10419 |
| 312 | Ga0501035_0489254 | 3300049822 | Bacteria | 1014 |
| 313 | Ga0501044_0014434 | 3300049823 | Bacteria | 8528 |
| 314 | Ga0501044_0039658 | 3300049823 | Bacteria | 4912 |
| 315 | Ga0501044_0266678 | 3300049823 | Bacteria | 1649 |
| 316 | Ga0501044_0670255 | 3300049823 | Unclassified | 925 |
| 317 | Ga0501045_0271239 | 3300049824 | Bacteria | 1263 |
| 318 | nmdc:mga0k408_153839_c1 | 3300050493 | Bacteria | 1370 |
| 319 | nmdc:mga0k408_747351_c1 | 3300050493 | Unclassified | 571 |
| 320 | nmdc:mga05p37_325059_c1 | 3300050507 | Bacteria | 1819 |
| 321 | nmdc:mga05p37_3872_c1 | 3300050507 | Bacteria | 17505 |
| 322 | nmdc:mga09592_33908_c1 | 3300050508 | Bacteria | 4266 |
| 323 | nmdc:mga09592_54370_c1 | 3300050508 | Bacteria | 3383 |
| 324 | nmdc:mga0qj67_11771_c1 | 3300050509 | Bacteria | 6566 |
| 325 | Ga0500578_0002185 | 3300053086 | Bacteria | 17132 |
| 326 | Ga0500578_0162425 | 3300053086 | Bacteria | 1385 |
| 327 | Ga0500646_0067770 | 3300053090 | Bacteria | 1064 |
| 328 | Ga0500583_0000009 | 3300053092 | Bacteria | 160749 |
| 329 | Ga0500583_0000607 | 3300053092 | Bacteria | 10683 |
| 330 | Ga0500651_0162906 | 3300053093 | Bacteria | 1333 |
| 331 | Ga0500651_0456503 | 3300053093 | Bacteria | 710 |
| 332 | Ga0500650_0312599 | 3300053098 | Bacteria | 693 |
| 333 | Ga0500642_0076940 | 3300053130 | Bacteria | 1527 |
| 334 | Ga0500559_0016707 | 3300053136 | Bacteria | 3100 |
| 335 | Ga0500568_0297067 | 3300053139 | Unclassified | 586 |
| 336 | Ga0500579_226075 | 3300053143 | Bacteria | 644 |
| 337 | Ga0500588_0004478 | 3300053146 | Bacteria | 3034 |
| 338 | Ga0500604_0019982 | 3300053151 | Bacteria | 1880 |
| 339 | Ga0500622_0410602 | 3300053156 | Bacteria | 547 |
| 340 | Ga0501084_0641059 | 3300054114 | Bacteria | 897 |
| 341 | Ga0466962_0310786 | 3300061719 | Bacteria | 781 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026116 | Ga0207674_10278770 | Ga0207674_102787702 | 139 |
| 2 | 3300031251 | Ga0265327_10000244 | Ga0265327_1000024490 | 139 |
| 3 | 3300005577 | Ga0068857_100296259 | Ga0068857_1002962592 | 141 |
| 4 | 3300014326 | Ga0157380_11672353 | Ga0157380_116723531 | 143 |
| 5 | 3300013297 | Ga0157378_11959619 | Ga0157378_119596191 | 144 |
| 6 | 3300006881 | Ga0068865_100114337 | Ga0068865_1001143372 | 145 |
| 7 | 3300014969 | Ga0157376_10086267 | Ga0157376_100862672 | 145 |
| 8 | 3300025900 | Ga0207710_10000975 | Ga0207710_100009753 | 145 |
| 9 | 3300025938 | Ga0207704_10089737 | Ga0207704_100897372 | 145 |
| 10 | 3300013296 | Ga0157374_10439423 | Ga0157374_104394232 | 146 |
| 11 | 3300049573 | Ga0501037_0187628 | Ga0501037_0187628_138_653 | 146 |
| 12 | 3300005330 | Ga0070690_100161782 | Ga0070690_1001617822 | 147 |
| 13 | 3300005331 | Ga0070670_100225582 | Ga0070670_1002255822 | 147 |
| 14 | 3300005334 | Ga0068869_100020819 | Ga0068869_1000208191 | 147 |
| 15 | 3300005466 | Ga0070685_10124024 | Ga0070685_101240242 | 147 |
| 16 | 3300005544 | Ga0070686_100216706 | Ga0070686_1002167061 | 147 |
| 17 | 3300005617 | Ga0068859_100010163 | Ga0068859_1000101632 | 147 |
| 18 | 3300005618 | Ga0068864_100032439 | Ga0068864_1000324393 | 147 |
| 19 | 3300005719 | Ga0068861_100586846 | Ga0068861_1005868462 | 147 |
| 20 | 3300005843 | Ga0068860_100036699 | Ga0068860_1000366993 | 147 |
| 21 | 3300005844 | Ga0068862_100071854 | Ga0068862_1000718541 | 147 |
| 22 | 3300006931 | Ga0097620_100010163 | Ga0097620_1000101632 | 147 |
| 23 | 3300009011 | Ga0105251_10183396 | Ga0105251_101833962 | 147 |
| 24 | 3300009101 | Ga0105247_10000918 | Ga0105247_1000091821 | 147 |
| 25 | 3300009553 | Ga0105249_10002666 | Ga0105249_100026667 | 147 |
| 26 | 3300013306 | Ga0163162_10677806 | Ga0163162_106778062 | 147 |
| 27 | 3300014325 | Ga0163163_10016179 | Ga0163163_100161793 | 147 |
| 28 | 3300014326 | Ga0157380_10236087 | Ga0157380_102360872 | 147 |
| 29 | 3300014969 | Ga0157376_10643897 | Ga0157376_106438971 | 147 |
| 30 | 3300017792 | Ga0163161_10361285 | Ga0163161_103612852 | 147 |
| 31 | 3300025923 | Ga0207681_10099828 | Ga0207681_100998284 | 147 |
| 32 | 3300025961 | Ga0207712_10003008 | Ga0207712_100030084 | 147 |
| 33 | 3300026095 | Ga0207676_10008498 | Ga0207676_100084983 | 147 |
| 34 | 3300026118 | Ga0207675_100685651 | Ga0207675_1006856512 | 147 |
| 35 | 3300026142 | Ga0207698_10854713 | Ga0207698_108547132 | 147 |
| 36 | 3300028380 | Ga0268265_10229870 | Ga0268265_102298701 | 147 |
| 37 | 3300028381 | Ga0268264_10004218 | Ga0268264_100042184 | 147 |
| 38 | 3300005331 | Ga0070670_100260631 | Ga0070670_1002606312 | 149 |
| 39 | 3300005618 | Ga0068864_100473344 | Ga0068864_1004733441 | 149 |
| 40 | 3300013297 | Ga0157378_10016139 | Ga0157378_100161392 | 149 |
| 41 | 3300013306 | Ga0163162_10980727 | Ga0163162_109807272 | 149 |
| 42 | 3300049571 | Ga0501034_0005932 | Ga0501034_0005932_9425_9949 | 149 |
| 43 | 3300049589 | Ga0501073_0220079 | Ga0501073_0220079_320_877 | 149 |
| 44 | 3300049822 | Ga0501035_0489254 | Ga0501035_0489254_351_908 | 149 |
| 45 | 3300049823 | Ga0501044_0670255 | Ga0501044_0670255_159_683 | 149 |
| 46 | 3300009094 | Ga0111539_10970212 | Ga0111539_109702122 | 155 |
| 47 | 3300009553 | Ga0105249_12604703 | Ga0105249_126047031 | 156 |
| 48 | 3300025242 | Ga0209258_116611 | Ga0209258_1166112 | 156 |
| 49 | 3300050493 | nmdc:mga0k408_747351_c1 | nmdc:mga0k408_747351_c1_44_514 | 156 |
| 50 | 3300053086 | Ga0500578_0002185 | Ga0500578_0002185_6232_6702 | 156 |
| 51 | 3300005328 | Ga0070676_10163942 | Ga0070676_101639421 | 157 |
| 52 | 3300005334 | Ga0068869_100803116 | Ga0068869_1008031161 | 157 |
| 53 | 3300005459 | Ga0068867_100142712 | Ga0068867_1001427122 | 157 |
| 54 | 3300005459 | Ga0068867_101328444 | Ga0068867_1013284441 | 157 |
| 55 | 3300005840 | Ga0068870_11149594 | Ga0068870_111495941 | 157 |
| 56 | 3300005843 | Ga0068860_100280639 | Ga0068860_1002806392 | 157 |
| 57 | 3300005844 | Ga0068862_101979288 | Ga0068862_1019792881 | 157 |
| 58 | 3300006881 | Ga0068865_100569109 | Ga0068865_1005691091 | 157 |
| 59 | 3300009148 | Ga0105243_10426642 | Ga0105243_104266421 | 157 |
| 60 | 3300010375 | Ga0105239_10001102 | Ga0105239_1000110229 | 157 |
| 61 | 3300014745 | Ga0157377_10257461 | Ga0157377_102574611 | 157 |
| 62 | 3300025907 | Ga0207645_10027658 | Ga0207645_100276583 | 157 |
| 63 | 3300026089 | Ga0207648_10035073 | Ga0207648_100350733 | 157 |
| 64 | 3300026118 | Ga0207675_100997348 | Ga0207675_1009973481 | 157 |
| 65 | 3300028381 | Ga0268264_10464037 | Ga0268264_104640372 | 157 |
| 66 | 3300031911 | Ga0307412_10266977 | Ga0307412_102669772 | 157 |
| 67 | 3300044656 | Ga0466969_0000152 | Ga0466969_0000152_9925_10398 | 157 |
| 68 | 3300044684 | Ga0466966_0000193 | Ga0466966_0000193_468_941 | 157 |
| 69 | 3300044765 | Ga0466970_0106868 | Ga0466970_0106868_641_1114 | 157 |
| 70 | 3300044842 | Ga0466957_0007969 | Ga0466957_0007969_4659_5132 | 157 |
| 71 | 3300045049 | Ga0466959_0000016 | Ga0466959_0000016_15905_16378 | 157 |
| 72 | 3300049581 | Ga0501047_0040734 | Ga0501047_0040734_145_618 | 157 |
| 73 | 3300003322 | rootL2_10026153 | rootL2_100261533 | 158 |
| 74 | 3300003323 | rootH1_10105911 | rootH1_101059114 | 158 |
| 75 | 3300005290 | Ga0065712_10005542 | Ga0065712_100055427 | 158 |
| 76 | 3300005290 | Ga0065712_10087624 | Ga0065712_100876241 | 158 |
| 77 | 3300005293 | Ga0065715_10270355 | Ga0065715_102703552 | 158 |
| 78 | 3300005331 | Ga0070670_100051396 | Ga0070670_1000513961 | 158 |
| 79 | 3300005334 | Ga0068869_100035136 | Ga0068869_1000351364 | 158 |
| 80 | 3300005339 | Ga0070660_101525978 | Ga0070660_1015259781 | 158 |
| 81 | 3300005340 | Ga0070689_100016482 | Ga0070689_1000164827 | 158 |
| 82 | 3300005340 | Ga0070689_100693786 | Ga0070689_1006937861 | 158 |
| 83 | 3300005343 | Ga0070687_100008500 | Ga0070687_1000085001 | 158 |
| 84 | 3300005347 | Ga0070668_100141330 | Ga0070668_1001413301 | 158 |
| 85 | 3300005353 | Ga0070669_100339310 | Ga0070669_1003393102 | 158 |
| 86 | 3300005354 | Ga0070675_100021615 | Ga0070675_1000216153 | 158 |
| 87 | 3300005356 | Ga0070674_101504764 | Ga0070674_1015047641 | 158 |
| 88 | 3300005364 | Ga0070673_100075464 | Ga0070673_1000754644 | 158 |
| 89 | 3300005365 | Ga0070688_100284684 | Ga0070688_1002846842 | 158 |
| 90 | 3300005365 | Ga0070688_100545746 | Ga0070688_1005457462 | 158 |
| 91 | 3300005366 | Ga0070659_100468711 | Ga0070659_1004687111 | 158 |
| 92 | 3300005366 | Ga0070659_100693729 | Ga0070659_1006937292 | 158 |
| 93 | 3300005441 | Ga0070700_100093978 | Ga0070700_1000939782 | 158 |
| 94 | 3300005445 | Ga0070708_100369019 | Ga0070708_1003690193 | 158 |
| 95 | 3300005456 | Ga0070678_100100327 | Ga0070678_1001003271 | 158 |
| 96 | 3300005459 | Ga0068867_100235936 | Ga0068867_1002359363 | 158 |
| 97 | 3300005466 | Ga0070685_10235800 | Ga0070685_102358003 | 158 |
| 98 | 3300005468 | Ga0070707_100156642 | Ga0070707_1001566422 | 158 |
| 99 | 3300005468 | Ga0070707_101797752 | Ga0070707_1017977521 | 158 |
| 100 | 3300005471 | Ga0070698_100003140 | Ga0070698_1000031403 | 158 |
| 101 | 3300005471 | Ga0070698_100771586 | Ga0070698_1007715861 | 158 |
| 102 | 3300005518 | Ga0070699_100488464 | Ga0070699_1004884642 | 158 |
| 103 | 3300005518 | Ga0070699_100521039 | Ga0070699_1005210392 | 158 |
| 104 | 3300005539 | Ga0068853_100641313 | Ga0068853_1006413131 | 158 |
| 105 | 3300005543 | Ga0070672_100014892 | Ga0070672_1000148922 | 158 |
| 106 | 3300005544 | Ga0070686_100237747 | Ga0070686_1002377472 | 158 |
| 107 | 3300005544 | Ga0070686_100734578 | Ga0070686_1007345782 | 158 |
| 108 | 3300005617 | Ga0068859_100042974 | Ga0068859_1000429745 | 158 |
| 109 | 3300005617 | Ga0068859_100636903 | Ga0068859_1006369033 | 158 |
| 110 | 3300005617 | Ga0068859_100639075 | Ga0068859_1006390753 | 158 |
| 111 | 3300005618 | Ga0068864_100292287 | Ga0068864_1002922872 | 158 |
| 112 | 3300005618 | Ga0068864_100456673 | Ga0068864_1004566733 | 158 |
| 113 | 3300005718 | Ga0068866_10311059 | Ga0068866_103110592 | 158 |
| 114 | 3300005719 | Ga0068861_100017009 | Ga0068861_1000170095 | 158 |
| 115 | 3300005719 | Ga0068861_100405084 | Ga0068861_1004050843 | 158 |
| 116 | 3300005719 | Ga0068861_100714457 | Ga0068861_1007144572 | 158 |
| 117 | 3300005841 | Ga0068863_100514694 | Ga0068863_1005146943 | 158 |
| 118 | 3300005841 | Ga0068863_101371271 | Ga0068863_1013712711 | 158 |
| 119 | 3300005842 | Ga0068858_100067650 | Ga0068858_1000676502 | 158 |
| 120 | 3300005843 | Ga0068860_100236918 | Ga0068860_1002369183 | 158 |
| 121 | 3300005843 | Ga0068860_100271871 | Ga0068860_1002718713 | 158 |
| 122 | 3300005844 | Ga0068862_100049946 | Ga0068862_1000499462 | 158 |
| 123 | 3300005844 | Ga0068862_100079748 | Ga0068862_1000797482 | 158 |
| 124 | 3300005844 | Ga0068862_100398500 | Ga0068862_1003985002 | 158 |
| 125 | 3300005844 | Ga0068862_100421989 | Ga0068862_1004219892 | 158 |
| 126 | 3300005844 | Ga0068862_101267964 | Ga0068862_1012679642 | 158 |
| 127 | 3300006163 | Ga0070715_10056317 | Ga0070715_100563172 | 158 |
| 128 | 3300006237 | Ga0097621_100042351 | Ga0097621_1000423511 | 158 |
| 129 | 3300006358 | Ga0068871_100036503 | Ga0068871_1000365032 | 158 |
| 130 | 3300006844 | Ga0075428_100097080 | Ga0075428_1000970804 | 158 |
| 131 | 3300006846 | Ga0075430_100122337 | Ga0075430_1001223371 | 158 |
| 132 | 3300006847 | Ga0075431_100027219 | Ga0075431_1000272193 | 158 |
| 133 | 3300006881 | Ga0068865_100028133 | Ga0068865_1000281334 | 158 |
| 134 | 3300006931 | Ga0097620_100042973 | Ga0097620_1000429731 | 158 |
| 135 | 3300006931 | Ga0097620_100636897 | Ga0097620_1006368973 | 158 |
| 136 | 3300006931 | Ga0097620_100639095 | Ga0097620_1006390953 | 158 |
| 137 | 3300009093 | Ga0105240_10034106 | Ga0105240_100341064 | 158 |
| 138 | 3300009094 | Ga0111539_10191602 | Ga0111539_101916023 | 158 |
| 139 | 3300009101 | Ga0105247_10325221 | Ga0105247_103252212 | 158 |
| 140 | 3300009147 | Ga0114129_10578147 | Ga0114129_105781473 | 158 |
| 141 | 3300009174 | Ga0105241_10046887 | Ga0105241_100468873 | 158 |
| 142 | 3300009176 | Ga0105242_10042423 | Ga0105242_100424231 | 158 |
| 143 | 3300009176 | Ga0105242_10205131 | Ga0105242_102051311 | 158 |
| 144 | 3300009176 | Ga0105242_10612825 | Ga0105242_106128252 | 158 |
| 145 | 3300009545 | Ga0105237_10131165 | Ga0105237_101311652 | 158 |
| 146 | 3300009553 | Ga0105249_10026771 | Ga0105249_100267711 | 158 |
| 147 | 3300010375 | Ga0105239_10493551 | Ga0105239_104935512 | 158 |
| 148 | 3300011119 | Ga0105246_10113927 | Ga0105246_101139273 | 158 |
| 149 | 3300013104 | Ga0157370_10483703 | Ga0157370_104837031 | 158 |
| 150 | 3300013296 | Ga0157374_10611976 | Ga0157374_106119761 | 158 |
| 151 | 3300013297 | Ga0157378_10727474 | Ga0157378_107274741 | 158 |
| 152 | 3300013306 | Ga0163162_10469779 | Ga0163162_104697791 | 158 |
| 153 | 3300013306 | Ga0163162_11927733 | Ga0163162_119277331 | 158 |
| 154 | 3300013308 | Ga0157375_10189326 | Ga0157375_101893262 | 158 |
| 155 | 3300013308 | Ga0157375_10389020 | Ga0157375_103890203 | 158 |
| 156 | 3300014326 | Ga0157380_10010181 | Ga0157380_100101816 | 158 |
| 157 | 3300014326 | Ga0157380_10311099 | Ga0157380_103110992 | 158 |
| 158 | 3300014326 | Ga0157380_10787073 | Ga0157380_107870732 | 158 |
| 159 | 3300014745 | Ga0157377_10133660 | Ga0157377_101336602 | 158 |
| 160 | 3300014968 | Ga0157379_10701979 | Ga0157379_107019792 | 158 |
| 161 | 3300014969 | Ga0157376_10030487 | Ga0157376_100304871 | 158 |
| 162 | 3300017792 | Ga0163161_10027259 | Ga0163161_100272593 | 158 |
| 163 | 3300017792 | Ga0163161_10114435 | Ga0163161_101144353 | 158 |
| 164 | 3300025893 | Ga0207682_10015427 | Ga0207682_100154274 | 158 |
| 165 | 3300025908 | Ga0207643_10002549 | Ga0207643_100025494 | 158 |
| 166 | 3300025911 | Ga0207654_10036722 | Ga0207654_100367223 | 158 |
| 167 | 3300025914 | Ga0207671_10245335 | Ga0207671_102453352 | 158 |
| 168 | 3300025918 | Ga0207662_10007225 | Ga0207662_100072255 | 158 |
| 169 | 3300025925 | Ga0207650_10167270 | Ga0207650_101672702 | 158 |
| 170 | 3300025926 | Ga0207659_10090572 | Ga0207659_100905721 | 158 |
| 171 | 3300025934 | Ga0207686_10012010 | Ga0207686_100120102 | 158 |
| 172 | 3300025934 | Ga0207686_10330223 | Ga0207686_103302232 | 158 |
| 173 | 3300025936 | Ga0207670_10074542 | Ga0207670_100745423 | 158 |
| 174 | 3300025937 | Ga0207669_10144702 | Ga0207669_101447023 | 158 |
| 175 | 3300025938 | Ga0207704_10039803 | Ga0207704_100398032 | 158 |
| 176 | 3300025940 | Ga0207691_10057710 | Ga0207691_100577103 | 158 |
| 177 | 3300025942 | Ga0207689_10122085 | Ga0207689_101220852 | 158 |
| 178 | 3300025949 | Ga0207667_10004643 | Ga0207667_100046438 | 158 |
| 179 | 3300025960 | Ga0207651_10377649 | Ga0207651_103776493 | 158 |
| 180 | 3300025961 | Ga0207712_10374649 | Ga0207712_103746491 | 158 |
| 181 | 3300025986 | Ga0207658_10756965 | Ga0207658_107569651 | 158 |
| 182 | 3300026023 | Ga0207677_10695443 | Ga0207677_106954431 | 158 |
| 183 | 3300026041 | Ga0207639_10246829 | Ga0207639_102468292 | 158 |
| 184 | 3300026041 | Ga0207639_10295894 | Ga0207639_102958941 | 158 |
| 185 | 3300026075 | Ga0207708_10018473 | Ga0207708_100184733 | 158 |
| 186 | 3300026078 | Ga0207702_10034910 | Ga0207702_100349102 | 158 |
| 187 | 3300026088 | Ga0207641_10006210 | Ga0207641_100062105 | 158 |
| 188 | 3300026095 | Ga0207676_10265672 | Ga0207676_102656722 | 158 |
| 189 | 3300026118 | Ga0207675_100002556 | Ga0207675_1000025568 | 158 |
| 190 | 3300026118 | Ga0207675_100213523 | Ga0207675_1002135232 | 158 |
| 191 | 3300026121 | Ga0207683_10128161 | Ga0207683_101281613 | 158 |
| 192 | 3300026121 | Ga0207683_11210029 | Ga0207683_112100291 | 158 |
| 193 | 3300026142 | Ga0207698_10355931 | Ga0207698_103559312 | 158 |
| 194 | 3300028380 | Ga0268265_10175518 | Ga0268265_101755182 | 158 |
| 195 | 3300028380 | Ga0268265_10184448 | Ga0268265_101844483 | 158 |
| 196 | 3300028380 | Ga0268265_10614447 | Ga0268265_106144472 | 158 |
| 197 | 3300028380 | Ga0268265_10980009 | Ga0268265_109800091 | 158 |
| 198 | 3300028381 | Ga0268264_10163122 | Ga0268264_101631223 | 158 |
| 199 | 3300028381 | Ga0268264_10945118 | Ga0268264_109451181 | 158 |
| 200 | 3300028800 | Ga0265338_10083042 | Ga0265338_100830422 | 158 |
| 201 | 3300031247 | Ga0265340_10288280 | Ga0265340_102882801 | 158 |
| 202 | 3300031250 | Ga0265331_10011461 | Ga0265331_100114614 | 158 |
| 203 | 3300031251 | Ga0265327_10000384 | Ga0265327_1000038437 | 158 |
| 204 | 3300031507 | Ga0307509_10052770 | Ga0307509_100527703 | 158 |
| 205 | 3300031507 | Ga0307509_10191129 | Ga0307509_101911291 | 158 |
| 206 | 3300031616 | Ga0307508_10001710 | Ga0307508_1000171024 | 158 |
| 207 | 3300037068 | Ga0373925_0134218 | Ga0373925_0134218_1058_1534 | 158 |
| 208 | 3300041503 | Ga0451847_0800830 | Ga0451847_0800830_101_577 | 158 |
| 209 | 3300041507 | Ga0451851_0225965 | Ga0451851_0225965_133_609 | 158 |
| 210 | 3300042001 | Ga0439441_002959 | Ga0439441_002959_696_1175 | 158 |
| 211 | 3300042461 | Ga0439460_0144192 | Ga0439460_0144192_127_606 | 158 |
| 212 | 3300044658 | Ga0466972_0168304 | Ga0466972_0168304_154_630 | 158 |
| 213 | 3300044735 | Ga0466968_0013340 | Ga0466968_0013340_1419_1895 | 158 |
| 214 | 3300046460 | Ga0495638_0118264 | Ga0495638_0118264_1069_1545 | 158 |
| 215 | 3300046616 | Ga0495668_0005323 | Ga0495668_0005323_3040_3516 | 158 |
| 216 | 3300046663 | Ga0495635_0309421 | Ga0495635_0309421_59_538 | 158 |
| 217 | 3300046683 | Ga0495658_0108317 | Ga0495658_0108317_677_1156 | 158 |
| 218 | 3300049705 | Ga0501225_0003468 | Ga0501225_0003468_3401_3877 | 158 |
| 219 | 3300050507 | nmdc:mga05p37_325059_c1 | nmdc:mga05p37_325059_c1_291_770 | 158 |
| 220 | 3300050508 | nmdc:mga09592_54370_c1 | nmdc:mga09592_54370_c1_170_649 | 158 |
| 221 | 3300053086 | Ga0500578_0162425 | Ga0500578_0162425_463_939 | 158 |
| 222 | 3300053090 | Ga0500646_0067770 | Ga0500646_0067770_292_771 | 158 |
| 223 | 3300053092 | Ga0500583_0000009 | Ga0500583_0000009_141163_141639 | 158 |
| 224 | 3300053092 | Ga0500583_0000607 | Ga0500583_0000607_1294_1770 | 158 |
| 225 | 3300053093 | Ga0500651_0162906 | Ga0500651_0162906_756_1232 | 158 |
| 226 | 3300053093 | Ga0500651_0456503 | Ga0500651_0456503_100_576 | 158 |
| 227 | 3300053098 | Ga0500650_0312599 | Ga0500650_0312599_207_683 | 158 |
| 228 | 3300053130 | Ga0500642_0076940 | Ga0500642_0076940_27_503 | 158 |
| 229 | 3300053143 | Ga0500579_226075 | Ga0500579_226075_42_518 | 158 |
| 230 | 3300053151 | Ga0500604_0019982 | Ga0500604_0019982_57_533 | 158 |
| 231 | 3300053156 | Ga0500622_0410602 | Ga0500622_0410602_11_487 | 158 |
| 232 | 3300061719 | Ga0466962_0310786 | Ga0466962_0310786_290_766 | 158 |
| 233 | 3300005289 | Ga0065704_10226489 | Ga0065704_102264891 | 159 |
| 234 | 3300005331 | Ga0070670_100347473 | Ga0070670_1003474731 | 159 |
| 235 | 3300005337 | Ga0070682_100681533 | Ga0070682_1006815331 | 159 |
| 236 | 3300005353 | Ga0070669_100825382 | Ga0070669_1008253821 | 159 |
| 237 | 3300005354 | Ga0070675_101289451 | Ga0070675_1012894511 | 159 |
| 238 | 3300005539 | Ga0068853_100902384 | Ga0068853_1009023842 | 159 |
| 239 | 3300005543 | Ga0070672_100226908 | Ga0070672_1002269081 | 159 |
| 240 | 3300005543 | Ga0070672_100524009 | Ga0070672_1005240091 | 159 |
| 241 | 3300005543 | Ga0070672_100727217 | Ga0070672_1007272172 | 159 |
| 242 | 3300006195 | Ga0075366_10034607 | Ga0075366_100346073 | 159 |
| 243 | 3300006237 | Ga0097621_101629678 | Ga0097621_1016296782 | 159 |
| 244 | 3300006358 | Ga0068871_100112968 | Ga0068871_1001129682 | 159 |
| 245 | 3300006358 | Ga0068871_100205956 | Ga0068871_1002059563 | 159 |
| 246 | 3300006880 | Ga0075429_100284717 | Ga0075429_1002847172 | 159 |
| 247 | 3300009147 | Ga0114129_10005818 | Ga0114129_100058187 | 159 |
| 248 | 3300009545 | Ga0105237_10492543 | Ga0105237_104925432 | 159 |
| 249 | 3300013104 | Ga0157370_11111512 | Ga0157370_111115121 | 159 |
| 250 | 3300013296 | Ga0157374_10119542 | Ga0157374_101195423 | 159 |
| 251 | 3300013306 | Ga0163162_10027924 | Ga0163162_100279244 | 159 |
| 252 | 3300013308 | Ga0157375_10733188 | Ga0157375_107331882 | 159 |
| 253 | 3300017792 | Ga0163161_11494750 | Ga0163161_114947501 | 159 |
| 254 | 3300025926 | Ga0207659_11054833 | Ga0207659_110548331 | 159 |
| 255 | 3300025940 | Ga0207691_11026891 | Ga0207691_110268911 | 159 |
| 256 | 3300025960 | Ga0207651_10314744 | Ga0207651_103147442 | 159 |
| 257 | 3300026121 | Ga0207683_10264563 | Ga0207683_102645632 | 159 |
| 258 | 3300031456 | Ga0307513_10141079 | Ga0307513_101410791 | 159 |
| 259 | 3300041404 | Ga0439436_0000860 | Ga0439436_0000860_4373_4852 | 159 |
| 260 | 3300041406 | Ga0439439_0031066 | Ga0439439_0031066_481_960 | 159 |
| 261 | 3300041406 | Ga0439439_0074606 | Ga0439439_0074606_269_748 | 159 |
| 262 | 3300041408 | Ga0439453_0098898 | Ga0439453_0098898_94_576 | 159 |
| 263 | 3300042007 | Ga0439449_0064682 | Ga0439449_0064682_705_1184 | 159 |
| 264 | 3300042014 | Ga0439457_000276 | Ga0439457_000276_3449_3928 | 159 |
| 265 | 3300042015 | Ga0439462_0005731 | Ga0439462_0005731_196_675 | 159 |
| 266 | 3300042876 | Ga0451577_0002869 | Ga0451577_0002869_10385_10867 | 159 |
| 267 | 3300044658 | Ga0466972_0000104 | Ga0466972_0000104_32451_32984 | 159 |
| 268 | 3300046500 | Ga0495596_0137947 | Ga0495596_0137947_232_711 | 159 |
| 269 | 3300047320 | Ga0495672_0153906 | Ga0495672_0153906_637_1119 | 159 |
| 270 | 3300049569 | Ga0501032_0078200 | Ga0501032_0078200_778_1260 | 159 |
| 271 | 3300049573 | Ga0501037_0024933 | Ga0501037_0024933_3578_4060 | 159 |
| 272 | 3300049574 | Ga0501038_0025195 | Ga0501038_0025195_1585_2067 | 159 |
| 273 | 3300049575 | Ga0501039_0094073 | Ga0501039_0094073_805_1287 | 159 |
| 274 | 3300049578 | Ga0501042_1177544 | Ga0501042_1177544_11_493 | 159 |
| 275 | 3300049579 | Ga0501043_0013511 | Ga0501043_0013511_1502_1984 | 159 |
| 276 | 3300049579 | Ga0501043_0188745 | Ga0501043_0188745_395_877 | 159 |
| 277 | 3300049579 | Ga0501043_0420362 | Ga0501043_0420362_383_865 | 159 |
| 278 | 3300049581 | Ga0501047_0033433 | Ga0501047_0033433_717_1199 | 159 |
| 279 | 3300049582 | Ga0501048_0566957 | Ga0501048_0566957_31_513 | 159 |
| 280 | 3300049822 | Ga0501035_0007189 | Ga0501035_0007189_3571_4053 | 159 |
| 281 | 3300049823 | Ga0501044_0266678 | Ga0501044_0266678_676_1158 | 159 |
| 282 | 3300050507 | nmdc:mga05p37_3872_c1 | nmdc:mga05p37_3872_c1_10009_10488 | 159 |
| 283 | 3300050508 | nmdc:mga09592_33908_c1 | nmdc:mga09592_33908_c1_46_528 | 159 |
| 284 | 3300050509 | nmdc:mga0qj67_11771_c1 | nmdc:mga0qj67_11771_c1_291_773 | 159 |
| 285 | 3300053136 | Ga0500559_0016707 | Ga0500559_0016707_2427_2906 | 159 |
| 286 | 3300053139 | Ga0500568_0297067 | Ga0500568_0297067_46_528 | 159 |
| 287 | 3300053146 | Ga0500588_0004478 | Ga0500588_0004478_2427_2906 | 159 |
| 288 | 3300003322 | rootL2_10001282 | rootL2_100012829 | 160 |
| 289 | 3300003323 | rootH1_10024331 | rootH1_100243314 | 160 |
| 290 | 3300005327 | Ga0070658_10941252 | Ga0070658_109412521 | 160 |
| 291 | 3300013104 | Ga0157370_10040656 | Ga0157370_100406562 | 160 |
| 292 | 3300025909 | Ga0207705_10583630 | Ga0207705_105836302 | 160 |
| 293 | 3300044842 | Ga0466957_0001820 | Ga0466957_0001820_4287_4928 | 160 |
| 294 | 3300045051 | Ga0451576_0400491 | Ga0451576_0400491_914_1405 | 160 |
| 295 | 3300046455 | Ga0495603_0633646 | Ga0495603_0633646_116_601 | 160 |
| 296 | 3300050493 | nmdc:mga0k408_153839_c1 | nmdc:mga0k408_153839_c1_17_502 | 160 |
| 297 | 3300005355 | Ga0070671_100310416 | Ga0070671_1003104162 | 161 |
| 298 | 3300005843 | Ga0068860_100587500 | Ga0068860_1005875002 | 161 |
| 299 | 3300009098 | Ga0105245_10404443 | Ga0105245_104044432 | 161 |
| 300 | 3300025927 | Ga0207687_10425560 | Ga0207687_104255602 | 161 |
| 301 | 3300028381 | Ga0268264_10480650 | Ga0268264_104806502 | 161 |
| 302 | 3300041501 | Ga0451845_0782425 | Ga0451845_0782425_45_536 | 161 |
| 303 | 3300049569 | Ga0501032_0025981 | Ga0501032_0025981_1468_1959 | 161 |
| 304 | 3300049571 | Ga0501034_0006675 | Ga0501034_0006675_5294_5785 | 161 |
| 305 | 3300049572 | Ga0501036_0002554 | Ga0501036_0002554_8391_8882 | 161 |
| 306 | 3300049574 | Ga0501038_0211240 | Ga0501038_0211240_494_985 | 161 |
| 307 | 3300049579 | Ga0501043_0010490 | Ga0501043_0010490_6591_7082 | 161 |
| 308 | 3300049580 | Ga0501046_0096769 | Ga0501046_0096769_700_1191 | 161 |
| 309 | 3300049581 | Ga0501047_0007092 | Ga0501047_0007092_8690_9181 | 161 |
| 310 | 3300049582 | Ga0501048_0048076 | Ga0501048_0048076_807_1298 | 161 |
| 311 | 3300049583 | Ga0501067_0031139 | Ga0501067_0031139_2150_2641 | 161 |
| 312 | 3300049584 | Ga0501068_0058587 | Ga0501068_0058587_599_1090 | 161 |
| 313 | 3300049585 | Ga0501069_0091171 | Ga0501069_0091171_807_1298 | 161 |
| 314 | 3300049586 | Ga0501070_0007290 | Ga0501070_0007290_1162_1653 | 161 |
| 315 | 3300049589 | Ga0501073_0193424 | Ga0501073_0193424_842_1333 | 161 |
| 316 | 3300049590 | Ga0501074_0009884 | Ga0501074_0009884_1075_1566 | 161 |
| 317 | 3300049593 | Ga0501077_0105907 | Ga0501077_0105907_825_1316 | 161 |
| 318 | 3300049741 | Ga0501079_0275167 | Ga0501079_0275167_163_654 | 161 |
| 319 | 3300049742 | Ga0501080_0032729 | Ga0501080_0032729_4084_4575 | 161 |
| 320 | 3300049744 | Ga0501083_0012545 | Ga0501083_0012545_3678_4169 | 161 |
| 321 | 3300049822 | Ga0501035_0006054 | Ga0501035_0006054_1075_1566 | 161 |
| 322 | 3300049823 | Ga0501044_0014434 | Ga0501044_0014434_3902_4390 | 161 |
| 323 | 3300049823 | Ga0501044_0039658 | Ga0501044_0039658_3384_3875 | 161 |
| 324 | 3300049824 | Ga0501045_0271239 | Ga0501045_0271239_640_1131 | 161 |
| 325 | 3300054114 | Ga0501084_0641059 | Ga0501084_0641059_215_706 | 161 |
| 326 | 2162886011 | MRS1b_contig_9133682 | MRS1b_0594.00000760 | 162 |
| 327 | 3300005293 | Ga0065715_10238529 | Ga0065715_102385292 | 162 |
| 328 | 3300005333 | Ga0070677_10050324 | Ga0070677_100503242 | 162 |
| 329 | 3300005347 | Ga0070668_100113899 | Ga0070668_1001138993 | 162 |
| 330 | 3300005456 | Ga0070678_100089252 | Ga0070678_1000892523 | 162 |
| 331 | 3300005459 | Ga0068867_100204046 | Ga0068867_1002040461 | 162 |
| 332 | 3300005543 | Ga0070672_100033475 | Ga0070672_1000334753 | 162 |
| 333 | 3300005840 | Ga0068870_10016861 | Ga0068870_100168612 | 162 |
| 334 | 3300025893 | Ga0207682_10042208 | Ga0207682_100422082 | 162 |
| 335 | 3300025926 | Ga0207659_10453448 | Ga0207659_104534482 | 162 |
| 336 | 3300025940 | Ga0207691_10058899 | Ga0207691_100588992 | 162 |
| 337 | 3300025972 | Ga0207668_10032704 | Ga0207668_100327043 | 162 |
| 338 | 3300025972 | Ga0207668_10396198 | Ga0207668_103961982 | 162 |
| 339 | 3300026121 | Ga0207683_10134616 | Ga0207683_101346162 | 162 |
| 340 | 3300049581 | Ga0501047_0191350 | Ga0501047_0191350_165_743 | 162 |
| 341 | 3300049582 | Ga0501048_0148506 | Ga0501048_0148506_103_681 | 162 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5iwx-assembly1.cif.gz_B | crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from bacillus subtitis | 0.985 | 1 | 157 |
| 5iwx-assembly1.cif.gz_B | crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from bacillus subtitis | 0.9721 | 1 | 157 |
| 3iew-assembly1.cif.gz_A | crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with bound ctp and cdp | 0.9557 | 2 | 157 |
| 3mbm-assembly1.cif.gz_C | crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytosine and fol fragment 717, imidazo[2,1-b][1,3]thiazol-6-ylmethanol | 0.9556 | 2 | 157 |
| 5iwx-assembly1.cif.gz_A | crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from bacillus subtitis | 0.9553 | 1 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B6TL41_66_225_3.30.1330.50 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 0.9507 | 2 | 157 | 3.30.1330.50 |
| 1iv1B00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 0.9422 | 3 | 156 | 3.30.1330.50 |
| 1iv1B00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 0.9362 | 3 | 156 | 3.30.1330.50 |
| 5b8fC00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 0.9296 | 1 | 157 | 3.30.1330.50 |
| 1w55A02 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 0.9281 | 1 | 160 | 3.30.1330.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F2RZ30-F1-model_v4 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) | 0.9761 | 2 | 155 |
GO:0008685
GO:0016114 GO:0019288 GO:0046872 |
| AF-A0A7C3YSD8-F1-model_v4 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) | 0.9741 | 3 | 158 |
GO:0008685
GO:0016114 GO:0019288 GO:0046872 |
| AF-A0A2W0BSF5-F1-model_v4 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) | 0.9694 | 3 | 157 |
GO:0008685
GO:0016114 GO:0019288 GO:0046872 |
| AF-A0A2W0BKH7-F1-model_v4 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) | 0.9692 | 3 | 157 |
GO:0008685
GO:0016114 GO:0019288 GO:0046872 |
| AF-Q1IVA8-F1-model_v4 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) | 0.9669 | 1 | 157 |
GO:0008685
GO:0016114 GO:0019288 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar