F414926

General Info

Members Datasets Scaffolds Average Seq Length
341 195 341 159

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0220079|Ga0501073_0220079_320_877
Length 172
Sequence LGLFFLLSPKKMAYRIGSGIDFHRLAEGRKLWIGGVEIPHYKGAVGHSDADVLLGDIGLHFPDTSPDFKDIDSKILLKRTFALIREEGYSIVNIDSTLCLDVPKIKPYVEAMRKTIAAILEIAVTDISIKATTTEKMGFAGREEGLVAYATALLQKESCGLSADGSKLKAQS

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
127 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
128 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
129 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
130 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
131 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
132 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
133 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
134 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
135 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
136 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
139 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
183 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
184 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
185 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
186 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
187 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
188 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
191 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
192 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
193 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.57
Nodule 0
Rhizoplane 0
Rhizosphere 91.2
Stem 0
Stem Tuber 0
Unclassified 3.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_9133682 2162886011 Bacteria 1136
2 rootL2_10001282 3300003322 Bacteria 10645
3 rootL2_10026153 3300003322 Bacteria 1719
4 rootH1_10024331 3300003323 Bacteria 2631
5 rootH1_10105911 3300003323 Bacteria 8604
6 Ga0065704_10226489 3300005289 Bacteria 1057
7 Ga0065712_10005542 3300005290 Bacteria 5301
8 Ga0065712_10087624 3300005290 Unclassified 2563
9 Ga0065715_10238529 3300005293 Bacteria 1208
10 Ga0065715_10270355 3300005293 Bacteria 1100
11 Ga0070658_10941252 3300005327 Bacteria 751
12 Ga0070676_10163942 3300005328 Unclassified 1433
13 Ga0070690_100161782 3300005330 Bacteria 1534
14 Ga0070670_100051396 3300005331 Bacteria 3539
15 Ga0070670_100225582 3300005331 Bacteria 1630
16 Ga0070670_100260631 3300005331 Bacteria 1511
17 Ga0070670_100347473 3300005331 Bacteria 1302
18 Ga0070677_10050324 3300005333 Bacteria 1682
19 Ga0068869_100020819 3300005334 Bacteria 4504
20 Ga0068869_100035136 3300005334 Bacteria 3551
21 Ga0068869_100803116 3300005334 Bacteria 809
22 Ga0070682_100681533 3300005337 Bacteria 822
23 Ga0070660_101525978 3300005339 Bacteria 568
24 Ga0070689_100016482 3300005340 Bacteria 5408
25 Ga0070689_100693786 3300005340 Bacteria 888
26 Ga0070687_100008500 3300005343 Bacteria 4355
27 Ga0070668_100113899 3300005347 Bacteria 2155
28 Ga0070668_100141330 3300005347 Unclassified 1940
29 Ga0070669_100339310 3300005353 Bacteria 1217
30 Ga0070669_100825382 3300005353 Unclassified 789
31 Ga0070675_100021615 3300005354 Bacteria 5141
32 Ga0070675_101289451 3300005354 Bacteria 673
33 Ga0070671_100310416 3300005355 Bacteria 1343
34 Ga0070674_101504764 3300005356 Bacteria 605
35 Ga0070673_100075464 3300005364 Bacteria 2719
36 Ga0070688_100284684 3300005365 Unclassified 1189
37 Ga0070688_100545746 3300005365 Bacteria 880
38 Ga0070659_100468711 3300005366 Bacteria 1070
39 Ga0070659_100693729 3300005366 Bacteria 880
40 Ga0070700_100093978 3300005441 Bacteria 1963
41 Ga0070708_100369019 3300005445 Bacteria 1353
42 Ga0070678_100089252 3300005456 Bacteria 2359
43 Ga0070678_100100327 3300005456 Bacteria 2242
44 Ga0068867_100142712 3300005459 Bacteria 1873
45 Ga0068867_100204046 3300005459 Bacteria 1584
46 Ga0068867_100235936 3300005459 Bacteria 1481
47 Ga0068867_101328444 3300005459 Bacteria 664
48 Ga0070685_10124024 3300005466 Bacteria 1607
49 Ga0070685_10235800 3300005466 Bacteria 1205
50 Ga0070707_100156642 3300005468 Bacteria 2219
51 Ga0070707_101797752 3300005468 Bacteria 580
52 Ga0070698_100003140 3300005471 Bacteria 18206
53 Ga0070698_100771586 3300005471 Bacteria 905
54 Ga0070699_100488464 3300005518 Unclassified 1118
55 Ga0070699_100521039 3300005518 Bacteria 1081
56 Ga0068853_100641313 3300005539 Bacteria 1011
57 Ga0068853_100902384 3300005539 Bacteria 849
58 Ga0070672_100014892 3300005543 Bacteria 5521
59 Ga0070672_100033475 3300005543 Bacteria 3892
60 Ga0070672_100226908 3300005543 Bacteria 1568
61 Ga0070672_100524009 3300005543 Unclassified 1027
62 Ga0070672_100727217 3300005543 Unclassified 870
63 Ga0070686_100216706 3300005544 Bacteria 1381
64 Ga0070686_100237747 3300005544 Bacteria 1325
65 Ga0070686_100734578 3300005544 Bacteria 790
66 Ga0068857_100296259 3300005577 Bacteria 1491
67 Ga0068859_100010163 3300005617 Bacteria 9477
68 Ga0068859_100042974 3300005617 Bacteria 4541
69 Ga0068859_100636903 3300005617 Bacteria 1158
70 Ga0068859_100639075 3300005617 Bacteria 1156
71 Ga0068864_100032439 3300005618 Bacteria 4439
72 Ga0068864_100292287 3300005618 Bacteria 1523
73 Ga0068864_100456673 3300005618 Bacteria 1222
74 Ga0068864_100473344 3300005618 Bacteria 1201
75 Ga0068866_10311059 3300005718 Bacteria 987
76 Ga0068861_100017009 3300005719 Bacteria 5157
77 Ga0068861_100405084 3300005719 Bacteria 1211
78 Ga0068861_100586846 3300005719 Bacteria 1021
79 Ga0068861_100714457 3300005719 Unclassified 932
80 Ga0068870_10016861 3300005840 Bacteria 3501
81 Ga0068870_11149594 3300005840 Bacteria 560
82 Ga0068863_100514694 3300005841 Bacteria 1179
83 Ga0068863_101371271 3300005841 Bacteria 714
84 Ga0068858_100067650 3300005842 Bacteria 3309
85 Ga0068860_100036699 3300005843 Bacteria 4694
86 Ga0068860_100236918 3300005843 Bacteria 1774
87 Ga0068860_100271871 3300005843 Bacteria 1654
88 Ga0068860_100280639 3300005843 Unclassified 1628
89 Ga0068860_100587500 3300005843 Bacteria 1118
90 Ga0068862_100049946 3300005844 Bacteria 3573
91 Ga0068862_100071854 3300005844 Bacteria 2988
92 Ga0068862_100079748 3300005844 Bacteria 2838
93 Ga0068862_100398500 3300005844 Bacteria 1287
94 Ga0068862_100421989 3300005844 Unclassified 1252
95 Ga0068862_101267964 3300005844 Unclassified 737
96 Ga0068862_101979288 3300005844 Bacteria 593
97 Ga0070715_10056317 3300006163 Bacteria 1710
98 Ga0075366_10034607 3300006195 Bacteria 2976
99 Ga0097621_100042351 3300006237 Bacteria 3667
100 Ga0097621_101629678 3300006237 Bacteria 614
101 Ga0068871_100036503 3300006358 Bacteria 3913
102 Ga0068871_100112968 3300006358 Bacteria 2287
103 Ga0068871_100205956 3300006358 Bacteria 1700
104 Ga0075428_100097080 3300006844 Bacteria 3212
105 Ga0075430_100122337 3300006846 Bacteria 2169
106 Ga0075431_100027219 3300006847 Bacteria 5865
107 Ga0075429_100284717 3300006880 Unclassified 1447
108 Ga0068865_100028133 3300006881 Bacteria 3721
109 Ga0068865_100114337 3300006881 Bacteria 1996
110 Ga0068865_100569109 3300006881 Bacteria 954
111 Ga0097620_100010163 3300006931 Bacteria 9477
112 Ga0097620_100042973 3300006931 Bacteria 4541
113 Ga0097620_100636897 3300006931 Bacteria 1158
114 Ga0097620_100639095 3300006931 Bacteria 1156
115 Ga0105251_10183396 3300009011 Bacteria 943
116 Ga0105240_10034106 3300009093 Bacteria 6568
117 Ga0111539_10191602 3300009094 Bacteria 2386
118 Ga0111539_10970212 3300009094 Unclassified 988
119 Ga0105245_10404443 3300009098 Bacteria 1365
120 Ga0105247_10000918 3300009101 Bacteria 22128
121 Ga0105247_10325221 3300009101 Bacteria 1074
122 Ga0114129_10005818 3300009147 Bacteria 17462
123 Ga0114129_10578147 3300009147 Unclassified 1458
124 Ga0105243_10426642 3300009148 Bacteria 1238
125 Ga0105241_10046887 3300009174 Bacteria 3283
126 Ga0105242_10042423 3300009176 Bacteria 3674
127 Ga0105242_10205131 3300009176 Bacteria 1753
128 Ga0105242_10612825 3300009176 Unclassified 1053
129 Ga0105237_10131165 3300009545 Bacteria 2501
130 Ga0105237_10492543 3300009545 Bacteria 1232
131 Ga0105249_10002666 3300009553 Bacteria 15430
132 Ga0105249_10026771 3300009553 Bacteria 5200
133 Ga0105249_12604703 3300009553 Bacteria 578
134 Ga0105239_10001102 3300010375 Bacteria 37330
135 Ga0105239_10493551 3300010375 Bacteria 1392
136 Ga0105246_10113927 3300011119 Bacteria 1991
137 Ga0157370_10040656 3300013104 Unclassified 4489
138 Ga0157370_10483703 3300013104 Bacteria 1137
139 Ga0157370_11111512 3300013104 Bacteria 714
140 Ga0157374_10119542 3300013296 Bacteria 2541
141 Ga0157374_10439423 3300013296 Bacteria 1305
142 Ga0157374_10611976 3300013296 Bacteria 1100
143 Ga0157378_10016139 3300013297 Bacteria 6541
144 Ga0157378_10727474 3300013297 Bacteria 1014
145 Ga0157378_11959619 3300013297 Bacteria 635
146 Ga0163162_10027924 3300013306 Bacteria 5582
147 Ga0163162_10469779 3300013306 Unclassified 1389
148 Ga0163162_10677806 3300013306 Bacteria 1154
149 Ga0163162_10980727 3300013306 Bacteria 955
150 Ga0163162_11927733 3300013306 Bacteria 676
151 Ga0157375_10189326 3300013308 Bacteria 2212
152 Ga0157375_10389020 3300013308 Unclassified 1561
153 Ga0157375_10733188 3300013308 Bacteria 1140
154 Ga0163163_10016179 3300014325 Bacteria 6924
155 Ga0157380_10010181 3300014326 Bacteria 6756
156 Ga0157380_10236087 3300014326 Bacteria 1645
157 Ga0157380_10311099 3300014326 Unclassified 1456
158 Ga0157380_10787073 3300014326 Bacteria 967
159 Ga0157380_11672353 3300014326 Bacteria 693
160 Ga0157377_10133660 3300014745 Bacteria 1518
161 Ga0157377_10257461 3300014745 Bacteria 1134
162 Ga0157379_10701979 3300014968 Bacteria 950
163 Ga0157376_10030487 3300014969 Bacteria 4307
164 Ga0157376_10086267 3300014969 Bacteria 2706
165 Ga0157376_10643897 3300014969 Unclassified 1059
166 Ga0163161_10027259 3300017792 Unclassified 4052
167 Ga0163161_10114435 3300017792 Unclassified 2021
168 Ga0163161_10361285 3300017792 Unclassified 1156
169 Ga0163161_11494750 3300017792 Unclassified 593
170 Ga0209258_116611 3300025242 Bacteria 819
171 Ga0207682_10015427 3300025893 Bacteria 2973
172 Ga0207682_10042208 3300025893 Bacteria 1863
173 Ga0207710_10000975 3300025900 Bacteria 15053
174 Ga0207645_10027658 3300025907 Bacteria 3660
175 Ga0207643_10002549 3300025908 Bacteria 9869
176 Ga0207705_10583630 3300025909 Bacteria 869
177 Ga0207654_10036722 3300025911 Bacteria 2739
178 Ga0207671_10245335 3300025914 Bacteria 1407
179 Ga0207662_10007225 3300025918 Bacteria 6041
180 Ga0207681_10099828 3300025923 Bacteria 2091
181 Ga0207650_10167270 3300025925 Bacteria 1745
182 Ga0207659_10090572 3300025926 Bacteria 2283
183 Ga0207659_10453448 3300025926 Bacteria 1080
184 Ga0207659_11054833 3300025926 Bacteria 699
185 Ga0207687_10425560 3300025927 Bacteria 1096
186 Ga0207686_10012010 3300025934 Bacteria 4755
187 Ga0207686_10330223 3300025934 Bacteria 1142
188 Ga0207670_10074542 3300025936 Bacteria 2356
189 Ga0207669_10144702 3300025937 Bacteria 1656
190 Ga0207704_10039803 3300025938 Bacteria 2741
191 Ga0207704_10089737 3300025938 Bacteria 2015
192 Ga0207691_10057710 3300025940 Bacteria 3532
193 Ga0207691_10058899 3300025940 Bacteria 3493
194 Ga0207691_11026891 3300025940 Bacteria 687
195 Ga0207689_10122085 3300025942 Bacteria 2142
196 Ga0207667_10004643 3300025949 Bacteria 16844
197 Ga0207651_10314744 3300025960 Bacteria 1307
198 Ga0207651_10377649 3300025960 Bacteria 1200
199 Ga0207712_10003008 3300025961 Bacteria 10775
200 Ga0207712_10374649 3300025961 Bacteria 1190
201 Ga0207668_10032704 3300025972 Bacteria 3441
202 Ga0207668_10396198 3300025972 Bacteria 1166
203 Ga0207658_10756965 3300025986 Bacteria 880
204 Ga0207677_10695443 3300026023 Bacteria 902
205 Ga0207639_10246829 3300026041 Bacteria 1555
206 Ga0207639_10295894 3300026041 Bacteria 1429
207 Ga0207708_10018473 3300026075 Bacteria 5251
208 Ga0207702_10034910 3300026078 Bacteria 4205
209 Ga0207641_10006210 3300026088 Bacteria 10104
210 Ga0207648_10035073 3300026089 Unclassified 4422
211 Ga0207676_10008498 3300026095 Bacteria 7301
212 Ga0207676_10265672 3300026095 Bacteria 1551
213 Ga0207674_10278770 3300026116 Bacteria 1620
214 Ga0207675_100002556 3300026118 Bacteria 18017
215 Ga0207675_100213523 3300026118 Bacteria 1857
216 Ga0207675_100685651 3300026118 Bacteria 1033
217 Ga0207675_100997348 3300026118 Bacteria 856
218 Ga0207683_10128161 3300026121 Bacteria 2282
219 Ga0207683_10134616 3300026121 Bacteria 2224
220 Ga0207683_10264563 3300026121 Bacteria 1570
221 Ga0207683_11210029 3300026121 Bacteria 700
222 Ga0207698_10355931 3300026142 Bacteria 1384
223 Ga0207698_10854713 3300026142 Bacteria 915
224 Ga0268265_10175518 3300028380 Unclassified 1836
225 Ga0268265_10184448 3300028380 Bacteria 1796
226 Ga0268265_10229870 3300028380 Bacteria 1629
227 Ga0268265_10614447 3300028380 Bacteria 1040
228 Ga0268265_10980009 3300028380 Unclassified 834
229 Ga0268264_10004218 3300028381 Bacteria 12266
230 Ga0268264_10163122 3300028381 Bacteria 2010
231 Ga0268264_10464037 3300028381 Bacteria 1229
232 Ga0268264_10480650 3300028381 Bacteria 1208
233 Ga0268264_10945118 3300028381 Bacteria 867
234 Ga0265338_10083042 3300028800 Bacteria 2681
235 Ga0265340_10288280 3300031247 Bacteria 729
236 Ga0265331_10011461 3300031250 Bacteria 4854
237 Ga0265327_10000244 3300031251 Bacteria 108867
238 Ga0265327_10000384 3300031251 Bacteria 83284
239 Ga0307513_10141079 3300031456 Bacteria 2336
240 Ga0307509_10052770 3300031507 Bacteria 4339
241 Ga0307509_10191129 3300031507 Bacteria 1898
242 Ga0307508_10001710 3300031616 Bacteria 24355
243 Ga0307412_10266977 3300031911 Bacteria 1337
244 Ga0373925_0134218 3300037068 Bacteria 1933
245 Ga0439436_0000860 3300041404 Bacteria 8300
246 Ga0439439_0031066 3300041406 Bacteria 1360
247 Ga0439439_0074606 3300041406 Bacteria 911
248 Ga0439453_0098898 3300041408 Unclassified 648
249 Ga0451845_0782425 3300041501 Bacteria 563
250 Ga0451847_0800830 3300041503 Bacteria 594
251 Ga0451851_0225965 3300041507 Bacteria 655
252 Ga0439441_002959 3300042001 Bacteria 2449
253 Ga0439449_0064682 3300042007 Bacteria 1349
254 Ga0439457_000276 3300042014 Bacteria 14138
255 Ga0439462_0005731 3300042015 Bacteria 3071
256 Ga0439460_0144192 3300042461 Bacteria 791
257 Ga0451577_0002869 3300042876 Bacteria 19808
258 Ga0466969_0000152 3300044656 Bacteria 37627
259 Ga0466972_0000104 3300044658 Bacteria 73886
260 Ga0466972_0168304 3300044658 Bacteria 1029
261 Ga0466966_0000193 3300044684 Bacteria 40730
262 Ga0466968_0013340 3300044735 Bacteria 3231
263 Ga0466970_0106868 3300044765 Bacteria 1527
264 Ga0466957_0001820 3300044842 Bacteria 11235
265 Ga0466957_0007969 3300044842 Bacteria 6010
266 Ga0466959_0000016 3300045049 Bacteria 144600
267 Ga0451576_0400491 3300045051 Bacteria 1439
268 Ga0495603_0633646 3300046455 Bacteria 612
269 Ga0495638_0118264 3300046460 Bacteria 1568
270 Ga0495596_0137947 3300046500 Bacteria 947
271 Ga0495668_0005323 3300046616 Bacteria 8785
272 Ga0495635_0309421 3300046663 Bacteria 1059
273 Ga0495658_0108317 3300046683 Bacteria 1667
274 Ga0495672_0153906 3300047320 Unclassified 1189
275 Ga0501032_0025981 3300049569 Bacteria 4033
276 Ga0501032_0078200 3300049569 Bacteria 2202
277 Ga0501034_0005932 3300049571 Bacteria 13246
278 Ga0501034_0006675 3300049571 Bacteria 12375
279 Ga0501036_0002554 3300049572 Bacteria 14316
280 Ga0501037_0024933 3300049573 Bacteria 4420
281 Ga0501037_0187628 3300049573 Unclassified 1465
282 Ga0501038_0025195 3300049574 Bacteria 5303
283 Ga0501038_0211240 3300049574 Bacteria 1552
284 Ga0501039_0094073 3300049575 Bacteria 2336
285 Ga0501042_1177544 3300049578 Bacteria 559
286 Ga0501043_0010490 3300049579 Bacteria 7255
287 Ga0501043_0013511 3300049579 Bacteria 6389
288 Ga0501043_0188745 3300049579 Bacteria 1603
289 Ga0501043_0420362 3300049579 Unclassified 1008
290 Ga0501046_0096769 3300049580 Bacteria 2268
291 Ga0501047_0007092 3300049581 Bacteria 10523
292 Ga0501047_0033433 3300049581 Bacteria 4964
293 Ga0501047_0040734 3300049581 Bacteria 4492
294 Ga0501047_0191350 3300049581 Bacteria 1909
295 Ga0501048_0048076 3300049582 Bacteria 3043
296 Ga0501048_0148506 3300049582 Bacteria 1658
297 Ga0501048_0566957 3300049582 Bacteria 815
298 Ga0501067_0031139 3300049583 Bacteria 2960
299 Ga0501068_0058587 3300049584 Bacteria 2337
300 Ga0501069_0091171 3300049585 Bacteria 1724
301 Ga0501070_0007290 3300049586 Bacteria 9390
302 Ga0501073_0193424 3300049589 Bacteria 1407
303 Ga0501073_0220079 3300049589 Unclassified 1312
304 Ga0501074_0009884 3300049590 Bacteria 6930
305 Ga0501077_0105907 3300049593 Bacteria 1782
306 Ga0501225_0003468 3300049705 Bacteria 4765
307 Ga0501079_0275167 3300049741 Bacteria 1316
308 Ga0501080_0032729 3300049742 Bacteria 4850
309 Ga0501083_0012545 3300049744 Bacteria 5928
310 Ga0501035_0006054 3300049822 Bacteria 11393
311 Ga0501035_0007189 3300049822 Bacteria 10419
312 Ga0501035_0489254 3300049822 Bacteria 1014
313 Ga0501044_0014434 3300049823 Bacteria 8528
314 Ga0501044_0039658 3300049823 Bacteria 4912
315 Ga0501044_0266678 3300049823 Bacteria 1649
316 Ga0501044_0670255 3300049823 Unclassified 925
317 Ga0501045_0271239 3300049824 Bacteria 1263
318 nmdc:mga0k408_153839_c1 3300050493 Bacteria 1370
319 nmdc:mga0k408_747351_c1 3300050493 Unclassified 571
320 nmdc:mga05p37_325059_c1 3300050507 Bacteria 1819
321 nmdc:mga05p37_3872_c1 3300050507 Bacteria 17505
322 nmdc:mga09592_33908_c1 3300050508 Bacteria 4266
323 nmdc:mga09592_54370_c1 3300050508 Bacteria 3383
324 nmdc:mga0qj67_11771_c1 3300050509 Bacteria 6566
325 Ga0500578_0002185 3300053086 Bacteria 17132
326 Ga0500578_0162425 3300053086 Bacteria 1385
327 Ga0500646_0067770 3300053090 Bacteria 1064
328 Ga0500583_0000009 3300053092 Bacteria 160749
329 Ga0500583_0000607 3300053092 Bacteria 10683
330 Ga0500651_0162906 3300053093 Bacteria 1333
331 Ga0500651_0456503 3300053093 Bacteria 710
332 Ga0500650_0312599 3300053098 Bacteria 693
333 Ga0500642_0076940 3300053130 Bacteria 1527
334 Ga0500559_0016707 3300053136 Bacteria 3100
335 Ga0500568_0297067 3300053139 Unclassified 586
336 Ga0500579_226075 3300053143 Bacteria 644
337 Ga0500588_0004478 3300053146 Bacteria 3034
338 Ga0500604_0019982 3300053151 Bacteria 1880
339 Ga0500622_0410602 3300053156 Bacteria 547
340 Ga0501084_0641059 3300054114 Bacteria 897
341 Ga0466962_0310786 3300061719 Bacteria 781

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10278770 Ga0207674_102787702 139
2 3300031251 Ga0265327_10000244 Ga0265327_1000024490 139
3 3300005577 Ga0068857_100296259 Ga0068857_1002962592 141
4 3300014326 Ga0157380_11672353 Ga0157380_116723531 143
5 3300013297 Ga0157378_11959619 Ga0157378_119596191 144
6 3300006881 Ga0068865_100114337 Ga0068865_1001143372 145
7 3300014969 Ga0157376_10086267 Ga0157376_100862672 145
8 3300025900 Ga0207710_10000975 Ga0207710_100009753 145
9 3300025938 Ga0207704_10089737 Ga0207704_100897372 145
10 3300013296 Ga0157374_10439423 Ga0157374_104394232 146
11 3300049573 Ga0501037_0187628 Ga0501037_0187628_138_653 146
12 3300005330 Ga0070690_100161782 Ga0070690_1001617822 147
13 3300005331 Ga0070670_100225582 Ga0070670_1002255822 147
14 3300005334 Ga0068869_100020819 Ga0068869_1000208191 147
15 3300005466 Ga0070685_10124024 Ga0070685_101240242 147
16 3300005544 Ga0070686_100216706 Ga0070686_1002167061 147
17 3300005617 Ga0068859_100010163 Ga0068859_1000101632 147
18 3300005618 Ga0068864_100032439 Ga0068864_1000324393 147
19 3300005719 Ga0068861_100586846 Ga0068861_1005868462 147
20 3300005843 Ga0068860_100036699 Ga0068860_1000366993 147
21 3300005844 Ga0068862_100071854 Ga0068862_1000718541 147
22 3300006931 Ga0097620_100010163 Ga0097620_1000101632 147
23 3300009011 Ga0105251_10183396 Ga0105251_101833962 147
24 3300009101 Ga0105247_10000918 Ga0105247_1000091821 147
25 3300009553 Ga0105249_10002666 Ga0105249_100026667 147
26 3300013306 Ga0163162_10677806 Ga0163162_106778062 147
27 3300014325 Ga0163163_10016179 Ga0163163_100161793 147
28 3300014326 Ga0157380_10236087 Ga0157380_102360872 147
29 3300014969 Ga0157376_10643897 Ga0157376_106438971 147
30 3300017792 Ga0163161_10361285 Ga0163161_103612852 147
31 3300025923 Ga0207681_10099828 Ga0207681_100998284 147
32 3300025961 Ga0207712_10003008 Ga0207712_100030084 147
33 3300026095 Ga0207676_10008498 Ga0207676_100084983 147
34 3300026118 Ga0207675_100685651 Ga0207675_1006856512 147
35 3300026142 Ga0207698_10854713 Ga0207698_108547132 147
36 3300028380 Ga0268265_10229870 Ga0268265_102298701 147
37 3300028381 Ga0268264_10004218 Ga0268264_100042184 147
38 3300005331 Ga0070670_100260631 Ga0070670_1002606312 149
39 3300005618 Ga0068864_100473344 Ga0068864_1004733441 149
40 3300013297 Ga0157378_10016139 Ga0157378_100161392 149
41 3300013306 Ga0163162_10980727 Ga0163162_109807272 149
42 3300049571 Ga0501034_0005932 Ga0501034_0005932_9425_9949 149
43 3300049589 Ga0501073_0220079 Ga0501073_0220079_320_877 149
44 3300049822 Ga0501035_0489254 Ga0501035_0489254_351_908 149
45 3300049823 Ga0501044_0670255 Ga0501044_0670255_159_683 149
46 3300009094 Ga0111539_10970212 Ga0111539_109702122 155
47 3300009553 Ga0105249_12604703 Ga0105249_126047031 156
48 3300025242 Ga0209258_116611 Ga0209258_1166112 156
49 3300050493 nmdc:mga0k408_747351_c1 nmdc:mga0k408_747351_c1_44_514 156
50 3300053086 Ga0500578_0002185 Ga0500578_0002185_6232_6702 156
51 3300005328 Ga0070676_10163942 Ga0070676_101639421 157
52 3300005334 Ga0068869_100803116 Ga0068869_1008031161 157
53 3300005459 Ga0068867_100142712 Ga0068867_1001427122 157
54 3300005459 Ga0068867_101328444 Ga0068867_1013284441 157
55 3300005840 Ga0068870_11149594 Ga0068870_111495941 157
56 3300005843 Ga0068860_100280639 Ga0068860_1002806392 157
57 3300005844 Ga0068862_101979288 Ga0068862_1019792881 157
58 3300006881 Ga0068865_100569109 Ga0068865_1005691091 157
59 3300009148 Ga0105243_10426642 Ga0105243_104266421 157
60 3300010375 Ga0105239_10001102 Ga0105239_1000110229 157
61 3300014745 Ga0157377_10257461 Ga0157377_102574611 157
62 3300025907 Ga0207645_10027658 Ga0207645_100276583 157
63 3300026089 Ga0207648_10035073 Ga0207648_100350733 157
64 3300026118 Ga0207675_100997348 Ga0207675_1009973481 157
65 3300028381 Ga0268264_10464037 Ga0268264_104640372 157
66 3300031911 Ga0307412_10266977 Ga0307412_102669772 157
67 3300044656 Ga0466969_0000152 Ga0466969_0000152_9925_10398 157
68 3300044684 Ga0466966_0000193 Ga0466966_0000193_468_941 157
69 3300044765 Ga0466970_0106868 Ga0466970_0106868_641_1114 157
70 3300044842 Ga0466957_0007969 Ga0466957_0007969_4659_5132 157
71 3300045049 Ga0466959_0000016 Ga0466959_0000016_15905_16378 157
72 3300049581 Ga0501047_0040734 Ga0501047_0040734_145_618 157
73 3300003322 rootL2_10026153 rootL2_100261533 158
74 3300003323 rootH1_10105911 rootH1_101059114 158
75 3300005290 Ga0065712_10005542 Ga0065712_100055427 158
76 3300005290 Ga0065712_10087624 Ga0065712_100876241 158
77 3300005293 Ga0065715_10270355 Ga0065715_102703552 158
78 3300005331 Ga0070670_100051396 Ga0070670_1000513961 158
79 3300005334 Ga0068869_100035136 Ga0068869_1000351364 158
80 3300005339 Ga0070660_101525978 Ga0070660_1015259781 158
81 3300005340 Ga0070689_100016482 Ga0070689_1000164827 158
82 3300005340 Ga0070689_100693786 Ga0070689_1006937861 158
83 3300005343 Ga0070687_100008500 Ga0070687_1000085001 158
84 3300005347 Ga0070668_100141330 Ga0070668_1001413301 158
85 3300005353 Ga0070669_100339310 Ga0070669_1003393102 158
86 3300005354 Ga0070675_100021615 Ga0070675_1000216153 158
87 3300005356 Ga0070674_101504764 Ga0070674_1015047641 158
88 3300005364 Ga0070673_100075464 Ga0070673_1000754644 158
89 3300005365 Ga0070688_100284684 Ga0070688_1002846842 158
90 3300005365 Ga0070688_100545746 Ga0070688_1005457462 158
91 3300005366 Ga0070659_100468711 Ga0070659_1004687111 158
92 3300005366 Ga0070659_100693729 Ga0070659_1006937292 158
93 3300005441 Ga0070700_100093978 Ga0070700_1000939782 158
94 3300005445 Ga0070708_100369019 Ga0070708_1003690193 158
95 3300005456 Ga0070678_100100327 Ga0070678_1001003271 158
96 3300005459 Ga0068867_100235936 Ga0068867_1002359363 158
97 3300005466 Ga0070685_10235800 Ga0070685_102358003 158
98 3300005468 Ga0070707_100156642 Ga0070707_1001566422 158
99 3300005468 Ga0070707_101797752 Ga0070707_1017977521 158
100 3300005471 Ga0070698_100003140 Ga0070698_1000031403 158
101 3300005471 Ga0070698_100771586 Ga0070698_1007715861 158
102 3300005518 Ga0070699_100488464 Ga0070699_1004884642 158
103 3300005518 Ga0070699_100521039 Ga0070699_1005210392 158
104 3300005539 Ga0068853_100641313 Ga0068853_1006413131 158
105 3300005543 Ga0070672_100014892 Ga0070672_1000148922 158
106 3300005544 Ga0070686_100237747 Ga0070686_1002377472 158
107 3300005544 Ga0070686_100734578 Ga0070686_1007345782 158
108 3300005617 Ga0068859_100042974 Ga0068859_1000429745 158
109 3300005617 Ga0068859_100636903 Ga0068859_1006369033 158
110 3300005617 Ga0068859_100639075 Ga0068859_1006390753 158
111 3300005618 Ga0068864_100292287 Ga0068864_1002922872 158
112 3300005618 Ga0068864_100456673 Ga0068864_1004566733 158
113 3300005718 Ga0068866_10311059 Ga0068866_103110592 158
114 3300005719 Ga0068861_100017009 Ga0068861_1000170095 158
115 3300005719 Ga0068861_100405084 Ga0068861_1004050843 158
116 3300005719 Ga0068861_100714457 Ga0068861_1007144572 158
117 3300005841 Ga0068863_100514694 Ga0068863_1005146943 158
118 3300005841 Ga0068863_101371271 Ga0068863_1013712711 158
119 3300005842 Ga0068858_100067650 Ga0068858_1000676502 158
120 3300005843 Ga0068860_100236918 Ga0068860_1002369183 158
121 3300005843 Ga0068860_100271871 Ga0068860_1002718713 158
122 3300005844 Ga0068862_100049946 Ga0068862_1000499462 158
123 3300005844 Ga0068862_100079748 Ga0068862_1000797482 158
124 3300005844 Ga0068862_100398500 Ga0068862_1003985002 158
125 3300005844 Ga0068862_100421989 Ga0068862_1004219892 158
126 3300005844 Ga0068862_101267964 Ga0068862_1012679642 158
127 3300006163 Ga0070715_10056317 Ga0070715_100563172 158
128 3300006237 Ga0097621_100042351 Ga0097621_1000423511 158
129 3300006358 Ga0068871_100036503 Ga0068871_1000365032 158
130 3300006844 Ga0075428_100097080 Ga0075428_1000970804 158
131 3300006846 Ga0075430_100122337 Ga0075430_1001223371 158
132 3300006847 Ga0075431_100027219 Ga0075431_1000272193 158
133 3300006881 Ga0068865_100028133 Ga0068865_1000281334 158
134 3300006931 Ga0097620_100042973 Ga0097620_1000429731 158
135 3300006931 Ga0097620_100636897 Ga0097620_1006368973 158
136 3300006931 Ga0097620_100639095 Ga0097620_1006390953 158
137 3300009093 Ga0105240_10034106 Ga0105240_100341064 158
138 3300009094 Ga0111539_10191602 Ga0111539_101916023 158
139 3300009101 Ga0105247_10325221 Ga0105247_103252212 158
140 3300009147 Ga0114129_10578147 Ga0114129_105781473 158
141 3300009174 Ga0105241_10046887 Ga0105241_100468873 158
142 3300009176 Ga0105242_10042423 Ga0105242_100424231 158
143 3300009176 Ga0105242_10205131 Ga0105242_102051311 158
144 3300009176 Ga0105242_10612825 Ga0105242_106128252 158
145 3300009545 Ga0105237_10131165 Ga0105237_101311652 158
146 3300009553 Ga0105249_10026771 Ga0105249_100267711 158
147 3300010375 Ga0105239_10493551 Ga0105239_104935512 158
148 3300011119 Ga0105246_10113927 Ga0105246_101139273 158
149 3300013104 Ga0157370_10483703 Ga0157370_104837031 158
150 3300013296 Ga0157374_10611976 Ga0157374_106119761 158
151 3300013297 Ga0157378_10727474 Ga0157378_107274741 158
152 3300013306 Ga0163162_10469779 Ga0163162_104697791 158
153 3300013306 Ga0163162_11927733 Ga0163162_119277331 158
154 3300013308 Ga0157375_10189326 Ga0157375_101893262 158
155 3300013308 Ga0157375_10389020 Ga0157375_103890203 158
156 3300014326 Ga0157380_10010181 Ga0157380_100101816 158
157 3300014326 Ga0157380_10311099 Ga0157380_103110992 158
158 3300014326 Ga0157380_10787073 Ga0157380_107870732 158
159 3300014745 Ga0157377_10133660 Ga0157377_101336602 158
160 3300014968 Ga0157379_10701979 Ga0157379_107019792 158
161 3300014969 Ga0157376_10030487 Ga0157376_100304871 158
162 3300017792 Ga0163161_10027259 Ga0163161_100272593 158
163 3300017792 Ga0163161_10114435 Ga0163161_101144353 158
164 3300025893 Ga0207682_10015427 Ga0207682_100154274 158
165 3300025908 Ga0207643_10002549 Ga0207643_100025494 158
166 3300025911 Ga0207654_10036722 Ga0207654_100367223 158
167 3300025914 Ga0207671_10245335 Ga0207671_102453352 158
168 3300025918 Ga0207662_10007225 Ga0207662_100072255 158
169 3300025925 Ga0207650_10167270 Ga0207650_101672702 158
170 3300025926 Ga0207659_10090572 Ga0207659_100905721 158
171 3300025934 Ga0207686_10012010 Ga0207686_100120102 158
172 3300025934 Ga0207686_10330223 Ga0207686_103302232 158
173 3300025936 Ga0207670_10074542 Ga0207670_100745423 158
174 3300025937 Ga0207669_10144702 Ga0207669_101447023 158
175 3300025938 Ga0207704_10039803 Ga0207704_100398032 158
176 3300025940 Ga0207691_10057710 Ga0207691_100577103 158
177 3300025942 Ga0207689_10122085 Ga0207689_101220852 158
178 3300025949 Ga0207667_10004643 Ga0207667_100046438 158
179 3300025960 Ga0207651_10377649 Ga0207651_103776493 158
180 3300025961 Ga0207712_10374649 Ga0207712_103746491 158
181 3300025986 Ga0207658_10756965 Ga0207658_107569651 158
182 3300026023 Ga0207677_10695443 Ga0207677_106954431 158
183 3300026041 Ga0207639_10246829 Ga0207639_102468292 158
184 3300026041 Ga0207639_10295894 Ga0207639_102958941 158
185 3300026075 Ga0207708_10018473 Ga0207708_100184733 158
186 3300026078 Ga0207702_10034910 Ga0207702_100349102 158
187 3300026088 Ga0207641_10006210 Ga0207641_100062105 158
188 3300026095 Ga0207676_10265672 Ga0207676_102656722 158
189 3300026118 Ga0207675_100002556 Ga0207675_1000025568 158
190 3300026118 Ga0207675_100213523 Ga0207675_1002135232 158
191 3300026121 Ga0207683_10128161 Ga0207683_101281613 158
192 3300026121 Ga0207683_11210029 Ga0207683_112100291 158
193 3300026142 Ga0207698_10355931 Ga0207698_103559312 158
194 3300028380 Ga0268265_10175518 Ga0268265_101755182 158
195 3300028380 Ga0268265_10184448 Ga0268265_101844483 158
196 3300028380 Ga0268265_10614447 Ga0268265_106144472 158
197 3300028380 Ga0268265_10980009 Ga0268265_109800091 158
198 3300028381 Ga0268264_10163122 Ga0268264_101631223 158
199 3300028381 Ga0268264_10945118 Ga0268264_109451181 158
200 3300028800 Ga0265338_10083042 Ga0265338_100830422 158
201 3300031247 Ga0265340_10288280 Ga0265340_102882801 158
202 3300031250 Ga0265331_10011461 Ga0265331_100114614 158
203 3300031251 Ga0265327_10000384 Ga0265327_1000038437 158
204 3300031507 Ga0307509_10052770 Ga0307509_100527703 158
205 3300031507 Ga0307509_10191129 Ga0307509_101911291 158
206 3300031616 Ga0307508_10001710 Ga0307508_1000171024 158
207 3300037068 Ga0373925_0134218 Ga0373925_0134218_1058_1534 158
208 3300041503 Ga0451847_0800830 Ga0451847_0800830_101_577 158
209 3300041507 Ga0451851_0225965 Ga0451851_0225965_133_609 158
210 3300042001 Ga0439441_002959 Ga0439441_002959_696_1175 158
211 3300042461 Ga0439460_0144192 Ga0439460_0144192_127_606 158
212 3300044658 Ga0466972_0168304 Ga0466972_0168304_154_630 158
213 3300044735 Ga0466968_0013340 Ga0466968_0013340_1419_1895 158
214 3300046460 Ga0495638_0118264 Ga0495638_0118264_1069_1545 158
215 3300046616 Ga0495668_0005323 Ga0495668_0005323_3040_3516 158
216 3300046663 Ga0495635_0309421 Ga0495635_0309421_59_538 158
217 3300046683 Ga0495658_0108317 Ga0495658_0108317_677_1156 158
218 3300049705 Ga0501225_0003468 Ga0501225_0003468_3401_3877 158
219 3300050507 nmdc:mga05p37_325059_c1 nmdc:mga05p37_325059_c1_291_770 158
220 3300050508 nmdc:mga09592_54370_c1 nmdc:mga09592_54370_c1_170_649 158
221 3300053086 Ga0500578_0162425 Ga0500578_0162425_463_939 158
222 3300053090 Ga0500646_0067770 Ga0500646_0067770_292_771 158
223 3300053092 Ga0500583_0000009 Ga0500583_0000009_141163_141639 158
224 3300053092 Ga0500583_0000607 Ga0500583_0000607_1294_1770 158
225 3300053093 Ga0500651_0162906 Ga0500651_0162906_756_1232 158
226 3300053093 Ga0500651_0456503 Ga0500651_0456503_100_576 158
227 3300053098 Ga0500650_0312599 Ga0500650_0312599_207_683 158
228 3300053130 Ga0500642_0076940 Ga0500642_0076940_27_503 158
229 3300053143 Ga0500579_226075 Ga0500579_226075_42_518 158
230 3300053151 Ga0500604_0019982 Ga0500604_0019982_57_533 158
231 3300053156 Ga0500622_0410602 Ga0500622_0410602_11_487 158
232 3300061719 Ga0466962_0310786 Ga0466962_0310786_290_766 158
233 3300005289 Ga0065704_10226489 Ga0065704_102264891 159
234 3300005331 Ga0070670_100347473 Ga0070670_1003474731 159
235 3300005337 Ga0070682_100681533 Ga0070682_1006815331 159
236 3300005353 Ga0070669_100825382 Ga0070669_1008253821 159
237 3300005354 Ga0070675_101289451 Ga0070675_1012894511 159
238 3300005539 Ga0068853_100902384 Ga0068853_1009023842 159
239 3300005543 Ga0070672_100226908 Ga0070672_1002269081 159
240 3300005543 Ga0070672_100524009 Ga0070672_1005240091 159
241 3300005543 Ga0070672_100727217 Ga0070672_1007272172 159
242 3300006195 Ga0075366_10034607 Ga0075366_100346073 159
243 3300006237 Ga0097621_101629678 Ga0097621_1016296782 159
244 3300006358 Ga0068871_100112968 Ga0068871_1001129682 159
245 3300006358 Ga0068871_100205956 Ga0068871_1002059563 159
246 3300006880 Ga0075429_100284717 Ga0075429_1002847172 159
247 3300009147 Ga0114129_10005818 Ga0114129_100058187 159
248 3300009545 Ga0105237_10492543 Ga0105237_104925432 159
249 3300013104 Ga0157370_11111512 Ga0157370_111115121 159
250 3300013296 Ga0157374_10119542 Ga0157374_101195423 159
251 3300013306 Ga0163162_10027924 Ga0163162_100279244 159
252 3300013308 Ga0157375_10733188 Ga0157375_107331882 159
253 3300017792 Ga0163161_11494750 Ga0163161_114947501 159
254 3300025926 Ga0207659_11054833 Ga0207659_110548331 159
255 3300025940 Ga0207691_11026891 Ga0207691_110268911 159
256 3300025960 Ga0207651_10314744 Ga0207651_103147442 159
257 3300026121 Ga0207683_10264563 Ga0207683_102645632 159
258 3300031456 Ga0307513_10141079 Ga0307513_101410791 159
259 3300041404 Ga0439436_0000860 Ga0439436_0000860_4373_4852 159
260 3300041406 Ga0439439_0031066 Ga0439439_0031066_481_960 159
261 3300041406 Ga0439439_0074606 Ga0439439_0074606_269_748 159
262 3300041408 Ga0439453_0098898 Ga0439453_0098898_94_576 159
263 3300042007 Ga0439449_0064682 Ga0439449_0064682_705_1184 159
264 3300042014 Ga0439457_000276 Ga0439457_000276_3449_3928 159
265 3300042015 Ga0439462_0005731 Ga0439462_0005731_196_675 159
266 3300042876 Ga0451577_0002869 Ga0451577_0002869_10385_10867 159
267 3300044658 Ga0466972_0000104 Ga0466972_0000104_32451_32984 159
268 3300046500 Ga0495596_0137947 Ga0495596_0137947_232_711 159
269 3300047320 Ga0495672_0153906 Ga0495672_0153906_637_1119 159
270 3300049569 Ga0501032_0078200 Ga0501032_0078200_778_1260 159
271 3300049573 Ga0501037_0024933 Ga0501037_0024933_3578_4060 159
272 3300049574 Ga0501038_0025195 Ga0501038_0025195_1585_2067 159
273 3300049575 Ga0501039_0094073 Ga0501039_0094073_805_1287 159
274 3300049578 Ga0501042_1177544 Ga0501042_1177544_11_493 159
275 3300049579 Ga0501043_0013511 Ga0501043_0013511_1502_1984 159
276 3300049579 Ga0501043_0188745 Ga0501043_0188745_395_877 159
277 3300049579 Ga0501043_0420362 Ga0501043_0420362_383_865 159
278 3300049581 Ga0501047_0033433 Ga0501047_0033433_717_1199 159
279 3300049582 Ga0501048_0566957 Ga0501048_0566957_31_513 159
280 3300049822 Ga0501035_0007189 Ga0501035_0007189_3571_4053 159
281 3300049823 Ga0501044_0266678 Ga0501044_0266678_676_1158 159
282 3300050507 nmdc:mga05p37_3872_c1 nmdc:mga05p37_3872_c1_10009_10488 159
283 3300050508 nmdc:mga09592_33908_c1 nmdc:mga09592_33908_c1_46_528 159
284 3300050509 nmdc:mga0qj67_11771_c1 nmdc:mga0qj67_11771_c1_291_773 159
285 3300053136 Ga0500559_0016707 Ga0500559_0016707_2427_2906 159
286 3300053139 Ga0500568_0297067 Ga0500568_0297067_46_528 159
287 3300053146 Ga0500588_0004478 Ga0500588_0004478_2427_2906 159
288 3300003322 rootL2_10001282 rootL2_100012829 160
289 3300003323 rootH1_10024331 rootH1_100243314 160
290 3300005327 Ga0070658_10941252 Ga0070658_109412521 160
291 3300013104 Ga0157370_10040656 Ga0157370_100406562 160
292 3300025909 Ga0207705_10583630 Ga0207705_105836302 160
293 3300044842 Ga0466957_0001820 Ga0466957_0001820_4287_4928 160
294 3300045051 Ga0451576_0400491 Ga0451576_0400491_914_1405 160
295 3300046455 Ga0495603_0633646 Ga0495603_0633646_116_601 160
296 3300050493 nmdc:mga0k408_153839_c1 nmdc:mga0k408_153839_c1_17_502 160
297 3300005355 Ga0070671_100310416 Ga0070671_1003104162 161
298 3300005843 Ga0068860_100587500 Ga0068860_1005875002 161
299 3300009098 Ga0105245_10404443 Ga0105245_104044432 161
300 3300025927 Ga0207687_10425560 Ga0207687_104255602 161
301 3300028381 Ga0268264_10480650 Ga0268264_104806502 161
302 3300041501 Ga0451845_0782425 Ga0451845_0782425_45_536 161
303 3300049569 Ga0501032_0025981 Ga0501032_0025981_1468_1959 161
304 3300049571 Ga0501034_0006675 Ga0501034_0006675_5294_5785 161
305 3300049572 Ga0501036_0002554 Ga0501036_0002554_8391_8882 161
306 3300049574 Ga0501038_0211240 Ga0501038_0211240_494_985 161
307 3300049579 Ga0501043_0010490 Ga0501043_0010490_6591_7082 161
308 3300049580 Ga0501046_0096769 Ga0501046_0096769_700_1191 161
309 3300049581 Ga0501047_0007092 Ga0501047_0007092_8690_9181 161
310 3300049582 Ga0501048_0048076 Ga0501048_0048076_807_1298 161
311 3300049583 Ga0501067_0031139 Ga0501067_0031139_2150_2641 161
312 3300049584 Ga0501068_0058587 Ga0501068_0058587_599_1090 161
313 3300049585 Ga0501069_0091171 Ga0501069_0091171_807_1298 161
314 3300049586 Ga0501070_0007290 Ga0501070_0007290_1162_1653 161
315 3300049589 Ga0501073_0193424 Ga0501073_0193424_842_1333 161
316 3300049590 Ga0501074_0009884 Ga0501074_0009884_1075_1566 161
317 3300049593 Ga0501077_0105907 Ga0501077_0105907_825_1316 161
318 3300049741 Ga0501079_0275167 Ga0501079_0275167_163_654 161
319 3300049742 Ga0501080_0032729 Ga0501080_0032729_4084_4575 161
320 3300049744 Ga0501083_0012545 Ga0501083_0012545_3678_4169 161
321 3300049822 Ga0501035_0006054 Ga0501035_0006054_1075_1566 161
322 3300049823 Ga0501044_0014434 Ga0501044_0014434_3902_4390 161
323 3300049823 Ga0501044_0039658 Ga0501044_0039658_3384_3875 161
324 3300049824 Ga0501045_0271239 Ga0501045_0271239_640_1131 161
325 3300054114 Ga0501084_0641059 Ga0501084_0641059_215_706 161
326 2162886011 MRS1b_contig_9133682 MRS1b_0594.00000760 162
327 3300005293 Ga0065715_10238529 Ga0065715_102385292 162
328 3300005333 Ga0070677_10050324 Ga0070677_100503242 162
329 3300005347 Ga0070668_100113899 Ga0070668_1001138993 162
330 3300005456 Ga0070678_100089252 Ga0070678_1000892523 162
331 3300005459 Ga0068867_100204046 Ga0068867_1002040461 162
332 3300005543 Ga0070672_100033475 Ga0070672_1000334753 162
333 3300005840 Ga0068870_10016861 Ga0068870_100168612 162
334 3300025893 Ga0207682_10042208 Ga0207682_100422082 162
335 3300025926 Ga0207659_10453448 Ga0207659_104534482 162
336 3300025940 Ga0207691_10058899 Ga0207691_100588992 162
337 3300025972 Ga0207668_10032704 Ga0207668_100327043 162
338 3300025972 Ga0207668_10396198 Ga0207668_103961982 162
339 3300026121 Ga0207683_10134616 Ga0207683_101346162 162
340 3300049581 Ga0501047_0191350 Ga0501047_0191350_165_743 162
341 3300049582 Ga0501048_0148506 Ga0501048_0148506_103_681 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02542

YgbB

YgbB family

14

155

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iwx-assembly1.cif.gz_B crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from bacillus subtitis 0.985 1 157
5iwx-assembly1.cif.gz_B crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from bacillus subtitis 0.9721 1 157
3iew-assembly1.cif.gz_A crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with bound ctp and cdp 0.9557 2 157
3mbm-assembly1.cif.gz_C crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytosine and fol fragment 717, imidazo[2,1-b][1,3]thiazol-6-ylmethanol 0.9556 2 157
5iwx-assembly1.cif.gz_A crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from bacillus subtitis 0.9553 1 157
ID Description Score Start End Superfamily
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9507 2 157 3.30.1330.50
1iv1B00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9422 3 156 3.30.1330.50
1iv1B00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9362 3 156 3.30.1330.50
5b8fC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9296 1 157 3.30.1330.50
1w55A02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9281 1 160 3.30.1330.50
ID Description Score Start End GO Terms
AF-A0A1F2RZ30-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9761 2 155 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A7C3YSD8-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9741 3 158 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A2W0BSF5-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9694 3 157 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A2W0BKH7-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9692 3 157 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-Q1IVA8-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9669 1 157 GO:0008685
GO:0016114
GO:0019288
GO:0046872

Feature Viewer

pLDDT pTM Quality
91.72 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map