F414809

General Info

Members Datasets Scaffolds Average Seq Length
341 210 682 141

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0116269|Ga0373937_0116269_298_792
Length 164
Sequence LQHLIFDVKMEDSMAEPGKSSELPAWIQNHLSRYVATNGEDGYLWDSSVGGGKGMVPTLLLSTRGRKSGNVLTLPLIFGQSGQDYVVVASKGGAPAHPAWYLNLEANPGVEVQVKADKFKARARTATGAERAGLWAKMVDIYPPYADYQTKTDRQIPIVVLQRA

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
126 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
127 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
128 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
139 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
146 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
182 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
201 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
202 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
203 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
204 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
205 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
206 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
209 2582580736 Prauserella sp. Am3 Isolate Unclassified
210 8002775197 Frankia nepalensis CN7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 0.88
Isolates 0.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.64
Nodule 0.29
Rhizoplane 5.87
Rhizosphere 80.65
Stem 0
Stem Tuber 0
Unclassified 12.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0116269 3300036401 Bacteria 2491
2 JGI24737J22298_10177944 3300001990 Unclassified 628
3 JGI24735J21928_10108118 3300002067 Unclassified 799
4 rootL2_10246720 3300003322 Bacteria 1800
5 rootH1_10351094 3300003323 Bacteria 1546
6 JGI25405J52794_10013527 3300003911 Bacteria 1584
7 Ga0065707_10433613 3300005295 Bacteria 817
8 Ga0070683_100146955 3300005329 Bacteria 2234
9 Ga0070680_100203362 3300005336 Unclassified 1670
10 Ga0070682_100773087 3300005337 Bacteria 777
11 Ga0068868_100033798 3300005338 Bacteria 3944
12 Ga0070687_100574194 3300005343 Bacteria 771
13 Ga0070692_10065750 3300005345 Bacteria 1921
14 Ga0070692_10784477 3300005345 Bacteria 649
15 Ga0070668_100995402 3300005347 Bacteria 753
16 Ga0070669_100158927 3300005353 Bacteria 1755
17 Ga0070671_100757063 3300005355 Unclassified 844
18 Ga0070674_100246901 3300005356 Unclassified 1400
19 Ga0070674_100440262 3300005356 Bacteria 1073
20 Ga0070674_101463316 3300005356 Bacteria 613
21 Ga0070667_101073089 3300005367 Bacteria 752
22 Ga0070709_10995506 3300005434 Unclassified 667
23 Ga0070714_100040598 3300005435 Bacteria 3922
24 Ga0070714_100679095 3300005435 Bacteria 993
25 Ga0070710_10160898 3300005437 Bacteria 1392
26 Ga0070710_10499426 3300005437 Bacteria 833
27 Ga0070701_10385564 3300005438 Bacteria 884
28 Ga0070701_11112220 3300005438 Bacteria 557
29 Ga0070711_100139141 3300005439 Bacteria 1818
30 Ga0070705_100012222 3300005440 Bacteria 4359
31 Ga0070705_100524550 3300005440 Bacteria 903
32 Ga0070705_101188296 3300005440 Bacteria 628
33 Ga0070700_100374487 3300005441 Unclassified 1063
34 Ga0070708_100497549 3300005445 Bacteria 1150
35 Ga0070708_100512562 3300005445 Bacteria 1131
36 Ga0070663_100581775 3300005455 Unclassified 939
37 Ga0070678_100835350 3300005456 Unclassified 838
38 Ga0070678_101105403 3300005456 Bacteria 732
39 Ga0068867_100419160 3300005459 Bacteria 1133
40 Ga0070706_100015290 3300005467 Bacteria 7084
41 Ga0070706_100540966 3300005467 Bacteria 1083
42 Ga0070707_100329142 3300005468 Bacteria 1484
43 Ga0070698_100000045 3300005471 Bacteria 87520
44 Ga0070698_100348757 3300005471 Unclassified 1412
45 Ga0070698_100371658 3300005471 Bacteria 1362
46 Ga0070698_100606086 3300005471 Bacteria 1035
47 Ga0070699_101994824 3300005518 Bacteria 530
48 Ga0070679_100078969 3300005530 Bacteria 3280
49 Ga0070679_100089540 3300005530 Bacteria 3064
50 Ga0070697_100521253 3300005536 Bacteria 1040
51 Ga0070697_101122067 3300005536 Unclassified 700
52 Ga0070665_100001473 3300005548 Bacteria 27584
53 Ga0070704_100464719 3300005549 Bacteria 1092
54 Ga0068855_100003133 3300005563 Bacteria 20233
55 Ga0068855_100057727 3300005563 Bacteria 4549
56 Ga0068855_101201564 3300005563 Bacteria 788
57 Ga0068855_101925631 3300005563 Bacteria 598
58 Ga0068857_100124749 3300005577 Bacteria 2320
59 Ga0068856_101495728 3300005614 Bacteria 689
60 Ga0068856_102225105 3300005614 Bacteria 557
61 Ga0070702_101199383 3300005615 Bacteria 612
62 Ga0068852_101342975 3300005616 Bacteria 737
63 Ga0068859_102320792 3300005617 Bacteria 592
64 Ga0068866_10097445 3300005718 Unclassified 1615
65 Ga0068861_100111799 3300005719 Bacteria 2189
66 Ga0068851_10130888 3300005834 Bacteria 1357
67 Ga0068862_101069703 3300005844 Bacteria 801
68 Ga0081455_10000203 3300005937 Bacteria 75878
69 Ga0081455_10277330 3300005937 Bacteria 1213
70 Ga0070717_10449510 3300006028 Bacteria 1161
71 Ga0070717_10476328 3300006028 Unclassified 1127
72 Ga0070717_10578989 3300006028 Bacteria 1018
73 Ga0070717_10656772 3300006028 Bacteria 952
74 Ga0070717_11638136 3300006028 Unclassified 583
75 Ga0070716_100219962 3300006173 Bacteria 1275
76 Ga0070712_100228517 3300006175 Bacteria 1476
77 Ga0075428_100392625 3300006844 Bacteria 1487
78 Ga0075428_101031952 3300006844 Unclassified 870
79 Ga0075428_101481130 3300006844 Bacteria 711
80 Ga0075430_100051779 3300006846 Bacteria 3459
81 Ga0075431_100228198 3300006847 Bacteria 1898
82 Ga0075431_100896182 3300006847 Unclassified 857
83 Ga0075431_101881295 3300006847 Unclassified 554
84 Ga0075433_10011103 3300006852 Bacteria 7243
85 Ga0075433_10011169 3300006852 Bacteria 7224
86 Ga0075434_100001101 3300006871 Bacteria 22162
87 Ga0075434_100006381 3300006871 Bacteria 10810
88 Ga0075434_101596215 3300006871 Bacteria 661
89 Ga0075429_100076937 3300006880 Bacteria 2906
90 Ga0068865_100434330 3300006881 Bacteria 1082
91 Ga0068865_101323683 3300006881 Bacteria 641
92 Ga0097620_102320889 3300006931 Bacteria 592
93 Ga0075435_100240352 3300007076 Bacteria 1540
94 Ga0075435_100958189 3300007076 Bacteria 747
95 Ga0099794_10041799 3300007265 Bacteria 2183
96 Ga0105240_10017434 3300009093 Bacteria 9677
97 Ga0105240_10336618 3300009093 Bacteria 1715
98 Ga0111539_11181922 3300009094 Unclassified 889
99 Ga0105245_10616081 3300009098 Bacteria 1113
100 Ga0114129_10004885 3300009147 Bacteria 18915
101 Ga0114129_10215414 3300009147 Bacteria 2594
102 Ga0114129_12676622 3300009147 Unclassified 594
103 Ga0105243_10476891 3300009148 Bacteria 1176
104 Ga0105243_10956740 3300009148 Unclassified 856
105 Ga0105243_11395555 3300009148 Unclassified 721
106 Ga0105241_11167001 3300009174 Bacteria 728
107 Ga0105242_10240382 3300009176 Bacteria 1627
108 Ga0105242_10279583 3300009176 Bacteria 1516
109 Ga0105237_10013856 3300009545 Bacteria 8437
110 Ga0105237_10148969 3300009545 Bacteria 2336
111 Ga0105237_10751355 3300009545 Unclassified 982
112 Ga0105237_11145900 3300009545 Unclassified 784
113 Ga0105238_10032057 3300009551 Bacteria 5348
114 Ga0105238_10361193 3300009551 Bacteria 1442
115 Ga0105238_12460740 3300009551 Bacteria 556
116 Ga0105249_10490016 3300009553 Bacteria 1273
117 Ga0105239_10096179 3300010375 Bacteria 3272
118 Ga0105239_10174914 3300010375 Bacteria 2401
119 Ga0105239_10238899 3300010375 Bacteria 2039
120 Ga0157370_11273668 3300013104 Bacteria 663
121 Ga0157369_10353583 3300013105 Bacteria 1526
122 Ga0157374_10267585 3300013296 Bacteria 1685
123 Ga0157374_12024318 3300013296 Unclassified 602
124 Ga0157378_10544829 3300013297 Bacteria 1165
125 Ga0163162_10382083 3300013306 Bacteria 1541
126 Ga0157375_10438131 3300013308 Unclassified 1473
127 Ga0157375_11250774 3300013308 Bacteria 872
128 Ga0157377_10157127 3300014745 Bacteria 1411
129 Ga0157377_11060561 3300014745 Unclassified 618
130 Ga0157379_10417939 3300014968 Unclassified 1235
131 Ga0163161_10262068 3300017792 Bacteria 1350
132 Ga0206356_11377717 3300020070 Bacteria 929
133 Ga0206350_10228385 3300020080 Bacteria 903
134 Ga0213876_10011345 3300021384 Bacteria 4760
135 Ga0213876_10015782 3300021384 Bacteria 3998
136 Ga0213876_10040806 3300021384 Bacteria 2452
137 Ga0213875_10004050 3300021388 Bacteria 8156
138 Ga0213875_10027824 3300021388 Bacteria 2689
139 Ga0213875_10458736 3300021388 Bacteria 610
140 Ga0209673_1119137 3300025273 Bacteria 541
141 Ga0209051_1000425 3300025303 Bacteria 57815
142 Ga0207656_10324374 3300025321 Bacteria 765
143 Ga0207692_10498453 3300025898 Bacteria 772
144 Ga0207642_10017489 3300025899 Bacteria 2728
145 Ga0207642_10067118 3300025899 Bacteria 1692
146 Ga0207688_10173675 3300025901 Bacteria 1282
147 Ga0207647_10163756 3300025904 Bacteria 1296
148 Ga0207699_10693185 3300025906 Bacteria 745
149 Ga0207684_10024534 3300025910 Bacteria 5141
150 Ga0207695_10007834 3300025913 Bacteria 13513
151 Ga0207695_10051362 3300025913 Bacteria 4330
152 Ga0207695_10256490 3300025913 Bacteria 1647
153 Ga0207671_10690612 3300025914 Bacteria 812
154 Ga0207671_10725053 3300025914 Unclassified 790
155 Ga0207663_10315141 3300025916 Bacteria 1173
156 Ga0207660_10262708 3300025917 Bacteria 1365
157 Ga0207662_10843153 3300025918 Bacteria 647
158 Ga0207652_10098811 3300025921 Bacteria 2575
159 Ga0207652_10717114 3300025921 Bacteria 892
160 Ga0207681_10503263 3300025923 Bacteria 992
161 Ga0207694_10032319 3300025924 Bacteria 4004
162 Ga0207694_11397539 3300025924 Bacteria 591
163 Ga0207694_11763692 3300025924 Bacteria 520
164 Ga0207687_10122220 3300025927 Bacteria 1949
165 Ga0207687_10499233 3300025927 Bacteria 1015
166 Ga0207700_10250279 3300025928 Bacteria 1514
167 Ga0207700_10684768 3300025928 Bacteria 915
168 Ga0207664_10344151 3300025929 Unclassified 1319
169 Ga0207664_10479260 3300025929 Bacteria 1113
170 Ga0207664_11546185 3300025929 Bacteria 585
171 Ga0207686_10290910 3300025934 Bacteria 1210
172 Ga0207709_10639003 3300025935 Unclassified 846
173 Ga0207669_10323822 3300025937 Bacteria 1181
174 Ga0207669_10836337 3300025937 Bacteria 765
175 Ga0207704_10096508 3300025938 Bacteria 1958
176 Ga0207704_10140459 3300025938 Bacteria 1689
177 Ga0207704_10638445 3300025938 Bacteria 876
178 Ga0207667_10007716 3300025949 Bacteria 12865
179 Ga0207667_10023849 3300025949 Bacteria 6733
180 Ga0207667_10765778 3300025949 Bacteria 964
181 Ga0207667_10920561 3300025949 Bacteria 865
182 Ga0207712_10389473 3300025961 Bacteria 1168
183 Ga0207712_10998622 3300025961 Bacteria 742
184 Ga0207708_10081050 3300026075 Bacteria 2494
185 Ga0207708_10437585 3300026075 Unclassified 1087
186 Ga0207648_10515025 3300026089 Bacteria 1096
187 Ga0207675_100082816 3300026118 Bacteria 3009
188 Ga0207683_10867355 3300026121 Unclassified 838
189 Ga0207698_11226246 3300026142 Bacteria 764
190 Ga0209588_1027679 3300027671 Bacteria 1804
191 Ga0268266_10000957 3300028379 Bacteria 36762
192 Ga0268265_11221430 3300028380 Bacteria 750
193 Ga0268265_11246477 3300028380 Bacteria 742
194 Ga0268264_10238666 3300028381 Bacteria 1683
195 Ga0268264_10438637 3300028381 Bacteria 1263
196 Ga0265318_10009513 3300028577 Bacteria 4271
197 Ga0265318_10364131 3300028577 Bacteria 528
198 Ga0307515_10179830 3300028794 Bacteria 2070
199 Ga0265338_10364076 3300028800 Bacteria 1037
200 Ga0265325_10111732 3300031241 Bacteria 1327
201 Ga0265339_10152999 3300031249 Bacteria 1165
202 Ga0265331_10079322 3300031250 Bacteria 1528
203 Ga0265331_10163780 3300031250 Bacteria 1007
204 Ga0307509_10002247 3300031507 Bacteria 31612
205 Ga0307509_10247275 3300031507 Bacteria 1570
206 Ga0265313_10054486 3300031595 Bacteria 1899
207 Ga0265314_10223870 3300031711 Bacteria 1096
208 Ga0307409_102224201 3300031995 Bacteria 578
209 Ga0307507_10220095 3300033179 Bacteria 1277
210 Ga0373955_0622993 3300035172 Bacteria 661
211 Ga0373937_1964427 3300036401 Bacteria 531
212 Ga0395905_0790694 3300037471 Bacteria 852
213 Ga0436364_0165825 3300037853 Bacteria 2157
214 Ga0436364_0475423 3300037853 Bacteria 649
215 Ga0436364_0727844 3300037853 Bacteria 1941
216 Ga0436364_1088096 3300037853 Bacteria 954
217 Ga0436364_1241929 3300037853 Bacteria 12363
218 Ga0436365_0055676 3300039437 Bacteria 5354
219 Ga0436365_0709029 3300039437 Bacteria 3559
220 Ga0436365_1427838 3300039437 Bacteria 4843
221 Ga0436365_1554174 3300039437 Bacteria 13061
222 Ga0436360_1064902 3300039438 Bacteria 823
223 Ga0436363_0197005 3300039450 Bacteria 765
224 Ga0436363_0435940 3300039450 Bacteria 604
225 Ga0436363_0835991 3300039450 Bacteria 835
226 Ga0436363_1229470 3300039450 Bacteria 673
227 Ga0436363_1467867 3300039450 Bacteria 1588
228 Ga0436363_1595687 3300039450 Bacteria 1466
229 Ga0436363_1664319 3300039450 Bacteria 2581
230 Ga0436362_0338052 3300039453 Unclassified 725
231 Ga0466972_0010904 3300044658 Bacteria 4561
232 Ga0466965_0009426 3300044683 Bacteria 4539
233 Ga0466965_0106027 3300044683 Bacteria 1441
234 Ga0466965_0265226 3300044683 Bacteria 924
235 Ga0466966_0663770 3300044684 Bacteria 628
236 Ga0466961_0031320 3300044693 Bacteria 3419
237 Ga0466963_0053874 3300044694 Bacteria 2672
238 Ga0466963_0539717 3300044694 Bacteria 823
239 Ga0466963_0749487 3300044694 Bacteria 689
240 Ga0466964_0028531 3300044706 Bacteria 2199
241 Ga0466964_0296880 3300044706 Bacteria 813
242 Ga0466971_0004061 3300044719 Bacteria 6297
243 Ga0466971_0073323 3300044719 Bacteria 1556
244 Ga0466968_0045552 3300044735 Bacteria 1862
245 Ga0466970_0014578 3300044765 Bacteria 4037
246 Ga0466957_0038959 3300044842 Bacteria 2866
247 Ga0466957_0084276 3300044842 Bacteria 1984
248 Ga0466957_0322228 3300044842 Bacteria 1043
249 Ga0466959_0015640 3300045049 Bacteria 5532
250 Ga0466959_0035013 3300045049 Bacteria 3714
251 Ga0451576_0299532 3300045051 Bacteria 1681
252 Ga0466958_0019744 3300045836 Bacteria 3923
253 Ga0466958_0078709 3300045836 Bacteria 2026
254 Ga0466958_0373954 3300045836 Bacteria 918
255 Ga0466967_0004057 3300045976 Bacteria 9770
256 Ga0466967_0014023 3300045976 Bacteria 6223
257 Ga0466967_0145301 3300045976 Bacteria 2212
258 Ga0466967_0410420 3300045976 Bacteria 1319
259 Ga0466967_0426467 3300045976 Bacteria 1293
260 Ga0466967_0707156 3300045976 Bacteria 998
261 Ga0466967_0715328 3300045976 Bacteria 992
262 Ga0466967_1652135 3300045976 Bacteria 638
263 Ga0495651_0539022 3300046462 Bacteria 743
264 Ga0495653_0179223 3300046463 Bacteria 1456
265 Ga0495650_0156537 3300046471 Unclassified 815
266 Ga0495580_0008477 3300046472 Bacteria 8177
267 Ga0495628_0570385 3300046516 Bacteria 811
268 Ga0495642_0118086 3300046528 Bacteria 1137
269 Ga0495652_0253151 3300046529 Bacteria 1304
270 Ga0495652_0389581 3300046529 Unclassified 989
271 Ga0495667_0092975 3300046559 Bacteria 1953
272 Ga0495668_0023393 3300046616 Bacteria 3524
273 Ga0495668_0102608 3300046616 Bacteria 1565
274 Ga0495599_0521160 3300046678 Bacteria 698
275 Ga0495623_0346104 3300046679 Unclassified 811
276 Ga0495680_0197649 3300047322 Bacteria 1444
277 Ga0495680_0430589 3300047322 Bacteria 906
278 Ga0495684_0552693 3300047471 Bacteria 784
279 Ga0495602_0298742 3300048088 Unclassified 1179
280 Ga0496100_0014882 3300048903 Bacteria 4529
281 Ga0496100_1050347 3300048903 Bacteria 641
282 Ga0496101_0096086 3300048904 Bacteria 2211
283 Ga0496101_0165936 3300048904 Bacteria 1695
284 Ga0496102_0046684 3300048905 Bacteria 3934
285 Ga0496102_0114255 3300048905 Bacteria 2519
286 Ga0496103_0301238 3300048906 Bacteria 1031
287 Ga0496104_0022882 3300048907 Bacteria 5742
288 Ga0496104_1538497 3300048907 Bacteria 568
289 Ga0496105_0275715 3300048908 Bacteria 1357
290 Ga0496106_0004799 3300048909 Bacteria 10000
291 Ga0496106_1478811 3300048909 Bacteria 523
292 Ga0496107_0021385 3300048910 Bacteria 4572
293 Ga0496110_0019009 3300048913 Bacteria 5775
294 Ga0496113_0856263 3300048916 Bacteria 720
295 Ga0496113_0892168 3300048916 Bacteria 704
296 Ga0496114_0086856 3300048917 Bacteria 2651
297 Ga0496114_0208904 3300048917 Bacteria 1712
298 Ga0496114_0226947 3300048917 Bacteria 1640
299 Ga0496115_0111131 3300048918 Bacteria 2251
300 Ga0496116_0211081 3300048919 Bacteria 1006
301 Ga0496118_0106194 3300048921 Bacteria 1879
302 Ga0496118_0306820 3300048921 Bacteria 868
303 Ga0496119_0001880 3300048922 Bacteria 24224
304 Ga0496119_0463430 3300048922 Bacteria 595
305 Ga0496120_0010016 3300048923 Bacteria 6657
306 Ga0496126_0074768 3300048929 Bacteria 3008
307 Ga0501034_0070039 3300049571 Bacteria 3519
308 Ga0501034_0124775 3300049571 Bacteria 2560
309 Ga0501036_0353205 3300049572 Bacteria 1228
310 Ga0501071_1015618 3300049587 Unclassified 641
311 Ga0501072_0410351 3300049588 Bacteria 1074
312 Ga0501075_0002900 3300049591 Bacteria 11504
313 Ga0501044_0114034 3300049823 Bacteria 2709
314 nmdc:mga05p37_11108_c1 3300050507 Bacteria 10702
315 nmdc:mga05p37_498906_c1 3300050507 Unclassified 1397
316 nmdc:mga09592_64762_c1 3300050508 Bacteria 3095
317 nmdc:mga0qj67_615570_c1 3300050509 Bacteria 868
318 nmdc:mga06r32_694263_c1 3300050510 Unclassified 984
319 nmdc:mga0n895_19189_c1 3300050512 Bacteria 6349
320 nmdc:mga0n895_620506_c1 3300050512 Bacteria 1082
321 nmdc:mga0rr50_525580_c1 3300050513 Bacteria 1007
322 nmdc:mga0a205_22727_c1 3300050515 Bacteria 5945
323 nmdc:mga0a205_898_c1 3300050515 Bacteria 9990
324 Ga0495601_0019124 3300053077 Bacteria 4175
325 Ga0495601_0326335 3300053077 Unclassified 999
326 Ga0495595_0062647 3300053084 Bacteria 1744
327 Ga0495619_0038249 3300053085 Bacteria 3129
328 Ga0500592_005503 3300053116 Unclassified 2017
329 Ga0500595_135255 3300053119 Bacteria 693
330 Ga0500568_0153170 3300053139 Bacteria 852
331 Ga0500616_0000645 3300053153 Bacteria 41735
332 Ga0500616_0001665 3300053153 Bacteria 20493
333 Ga0500627_0174985 3300053158 Bacteria 966
334 Ga0500637_0166430 3300053178 Bacteria 1269
335 Ga0587128_017123 3300059630 Unclassified 1070
336 Ga0501082_0096483 3300060353 Bacteria 2556
337 Ga0501082_0688635 3300060353 Unclassified 895
338 Ga0466962_0128685 3300061719 Bacteria 1223
339 Ga0466962_0351460 3300061719 Bacteria 734
340 2583153159 2582580736 Bacteria 5325865
341 8002777742 8002775197 Bacteria 10728764
342 Ga0373937_0116269
343 JGI24737J22298_10177944
344 JGI24735J21928_10108118
345 rootL2_10246720
346 rootH1_10351094
347 JGI25405J52794_10013527
348 Ga0065707_10433613
349 Ga0070683_100146955
350 Ga0070680_100203362
351 Ga0070682_100773087
352 Ga0068868_100033798
353 Ga0070687_100574194
354 Ga0070692_10065750
355 Ga0070692_10784477
356 Ga0070668_100995402
357 Ga0070669_100158927
358 Ga0070671_100757063
359 Ga0070674_100246901
360 Ga0070674_100440262
361 Ga0070674_101463316
362 Ga0070667_101073089
363 Ga0070709_10995506
364 Ga0070714_100040598
365 Ga0070714_100679095
366 Ga0070710_10160898
367 Ga0070710_10499426
368 Ga0070701_10385564
369 Ga0070701_11112220
370 Ga0070711_100139141
371 Ga0070705_100012222
372 Ga0070705_100524550
373 Ga0070705_101188296
374 Ga0070700_100374487
375 Ga0070708_100497549
376 Ga0070708_100512562
377 Ga0070663_100581775
378 Ga0070678_100835350
379 Ga0070678_101105403
380 Ga0068867_100419160
381 Ga0070706_100015290
382 Ga0070706_100540966
383 Ga0070707_100329142
384 Ga0070698_100000045
385 Ga0070698_100348757
386 Ga0070698_100371658
387 Ga0070698_100606086
388 Ga0070699_101994824
389 Ga0070679_100078969
390 Ga0070679_100089540
391 Ga0070697_100521253
392 Ga0070697_101122067
393 Ga0070665_100001473
394 Ga0070704_100464719
395 Ga0068855_100003133
396 Ga0068855_100057727
397 Ga0068855_101201564
398 Ga0068855_101925631
399 Ga0068857_100124749
400 Ga0068856_101495728
401 Ga0068856_102225105
402 Ga0070702_101199383
403 Ga0068852_101342975
404 Ga0068859_102320792
405 Ga0068866_10097445
406 Ga0068861_100111799
407 Ga0068851_10130888
408 Ga0068862_101069703
409 Ga0081455_10000203
410 Ga0081455_10277330
411 Ga0070717_10449510
412 Ga0070717_10476328
413 Ga0070717_10578989
414 Ga0070717_10656772
415 Ga0070717_11638136
416 Ga0070716_100219962
417 Ga0070712_100228517
418 Ga0075428_100392625
419 Ga0075428_101031952
420 Ga0075428_101481130
421 Ga0075430_100051779
422 Ga0075431_100228198
423 Ga0075431_100896182
424 Ga0075431_101881295
425 Ga0075433_10011103
426 Ga0075433_10011169
427 Ga0075434_100001101
428 Ga0075434_100006381
429 Ga0075434_101596215
430 Ga0075429_100076937
431 Ga0068865_100434330
432 Ga0068865_101323683
433 Ga0097620_102320889
434 Ga0075435_100240352
435 Ga0075435_100958189
436 Ga0099794_10041799
437 Ga0105240_10017434
438 Ga0105240_10336618
439 Ga0111539_11181922
440 Ga0105245_10616081
441 Ga0114129_10004885
442 Ga0114129_10215414
443 Ga0114129_12676622
444 Ga0105243_10476891
445 Ga0105243_10956740
446 Ga0105243_11395555
447 Ga0105241_11167001
448 Ga0105242_10240382
449 Ga0105242_10279583
450 Ga0105237_10013856
451 Ga0105237_10148969
452 Ga0105237_10751355
453 Ga0105237_11145900
454 Ga0105238_10032057
455 Ga0105238_10361193
456 Ga0105238_12460740
457 Ga0105249_10490016
458 Ga0105239_10096179
459 Ga0105239_10174914
460 Ga0105239_10238899
461 Ga0157370_11273668
462 Ga0157369_10353583
463 Ga0157374_10267585
464 Ga0157374_12024318
465 Ga0157378_10544829
466 Ga0163162_10382083
467 Ga0157375_10438131
468 Ga0157375_11250774
469 Ga0157377_10157127
470 Ga0157377_11060561
471 Ga0157379_10417939
472 Ga0163161_10262068
473 Ga0206356_11377717
474 Ga0206350_10228385
475 Ga0213876_10011345
476 Ga0213876_10015782
477 Ga0213876_10040806
478 Ga0213875_10004050
479 Ga0213875_10027824
480 Ga0213875_10458736
481 Ga0209673_1119137
482 Ga0209051_1000425
483 Ga0207656_10324374
484 Ga0207692_10498453
485 Ga0207642_10017489
486 Ga0207642_10067118
487 Ga0207688_10173675
488 Ga0207647_10163756
489 Ga0207699_10693185
490 Ga0207684_10024534
491 Ga0207695_10007834
492 Ga0207695_10051362
493 Ga0207695_10256490
494 Ga0207671_10690612
495 Ga0207671_10725053
496 Ga0207663_10315141
497 Ga0207660_10262708
498 Ga0207662_10843153
499 Ga0207652_10098811
500 Ga0207652_10717114
501 Ga0207681_10503263
502 Ga0207694_10032319
503 Ga0207694_11397539
504 Ga0207694_11763692
505 Ga0207687_10122220
506 Ga0207687_10499233
507 Ga0207700_10250279
508 Ga0207700_10684768
509 Ga0207664_10344151
510 Ga0207664_10479260
511 Ga0207664_11546185
512 Ga0207686_10290910
513 Ga0207709_10639003
514 Ga0207669_10323822
515 Ga0207669_10836337
516 Ga0207704_10096508
517 Ga0207704_10140459
518 Ga0207704_10638445
519 Ga0207667_10007716
520 Ga0207667_10023849
521 Ga0207667_10765778
522 Ga0207667_10920561
523 Ga0207712_10389473
524 Ga0207712_10998622
525 Ga0207708_10081050
526 Ga0207708_10437585
527 Ga0207648_10515025
528 Ga0207675_100082816
529 Ga0207683_10867355
530 Ga0207698_11226246
531 Ga0209588_1027679
532 Ga0268266_10000957
533 Ga0268265_11221430
534 Ga0268265_11246477
535 Ga0268264_10238666
536 Ga0268264_10438637
537 Ga0265318_10009513
538 Ga0265318_10364131
539 Ga0307515_10179830
540 Ga0265338_10364076
541 Ga0265325_10111732
542 Ga0265339_10152999
543 Ga0265331_10079322
544 Ga0265331_10163780
545 Ga0307509_10002247
546 Ga0307509_10247275
547 Ga0265313_10054486
548 Ga0265314_10223870
549 Ga0307409_102224201
550 Ga0307507_10220095
551 Ga0373955_0622993
552 Ga0373937_1964427
553 Ga0395905_0790694
554 Ga0436364_0165825
555 Ga0436364_0475423
556 Ga0436364_0727844
557 Ga0436364_1088096
558 Ga0436364_1241929
559 Ga0436365_0055676
560 Ga0436365_0709029
561 Ga0436365_1427838
562 Ga0436365_1554174
563 Ga0436360_1064902
564 Ga0436363_0197005
565 Ga0436363_0435940
566 Ga0436363_0835991
567 Ga0436363_1229470
568 Ga0436363_1467867
569 Ga0436363_1595687
570 Ga0436363_1664319
571 Ga0436362_0338052
572 Ga0466972_0010904
573 Ga0466965_0009426
574 Ga0466965_0106027
575 Ga0466965_0265226
576 Ga0466966_0663770
577 Ga0466961_0031320
578 Ga0466963_0053874
579 Ga0466963_0539717
580 Ga0466963_0749487
581 Ga0466964_0028531
582 Ga0466964_0296880
583 Ga0466971_0004061
584 Ga0466971_0073323
585 Ga0466968_0045552
586 Ga0466970_0014578
587 Ga0466957_0038959
588 Ga0466957_0084276
589 Ga0466957_0322228
590 Ga0466959_0015640
591 Ga0466959_0035013
592 Ga0451576_0299532
593 Ga0466958_0019744
594 Ga0466958_0078709
595 Ga0466958_0373954
596 Ga0466967_0004057
597 Ga0466967_0014023
598 Ga0466967_0145301
599 Ga0466967_0410420
600 Ga0466967_0426467
601 Ga0466967_0707156
602 Ga0466967_0715328
603 Ga0466967_1652135
604 Ga0495651_0539022
605 Ga0495653_0179223
606 Ga0495650_0156537
607 Ga0495580_0008477
608 Ga0495628_0570385
609 Ga0495642_0118086
610 Ga0495652_0253151
611 Ga0495652_0389581
612 Ga0495667_0092975
613 Ga0495668_0023393
614 Ga0495668_0102608
615 Ga0495599_0521160
616 Ga0495623_0346104
617 Ga0495680_0197649
618 Ga0495680_0430589
619 Ga0495684_0552693
620 Ga0495602_0298742
621 Ga0496100_0014882
622 Ga0496100_1050347
623 Ga0496101_0096086
624 Ga0496101_0165936
625 Ga0496102_0046684
626 Ga0496102_0114255
627 Ga0496103_0301238
628 Ga0496104_0022882
629 Ga0496104_1538497
630 Ga0496105_0275715
631 Ga0496106_0004799
632 Ga0496106_1478811
633 Ga0496107_0021385
634 Ga0496110_0019009
635 Ga0496113_0856263
636 Ga0496113_0892168
637 Ga0496114_0086856
638 Ga0496114_0208904
639 Ga0496114_0226947
640 Ga0496115_0111131
641 Ga0496116_0211081
642 Ga0496118_0106194
643 Ga0496118_0306820
644 Ga0496119_0001880
645 Ga0496119_0463430
646 Ga0496120_0010016
647 Ga0496126_0074768
648 Ga0501034_0070039
649 Ga0501034_0124775
650 Ga0501036_0353205
651 Ga0501071_1015618
652 Ga0501072_0410351
653 Ga0501075_0002900
654 Ga0501044_0114034
655 nmdc:mga05p37_11108_c1
656 nmdc:mga05p37_498906_c1
657 nmdc:mga09592_64762_c1
658 nmdc:mga0qj67_615570_c1
659 nmdc:mga06r32_694263_c1
660 nmdc:mga0n895_19189_c1
661 nmdc:mga0n895_620506_c1
662 nmdc:mga0rr50_525580_c1
663 nmdc:mga0a205_22727_c1
664 nmdc:mga0a205_898_c1
665 Ga0495601_0019124
666 Ga0495601_0326335
667 Ga0495595_0062647
668 Ga0495619_0038249
669 Ga0500592_005503
670 Ga0500595_135255
671 Ga0500568_0153170
672 Ga0500616_0000645
673 Ga0500616_0001665
674 Ga0500627_0174985
675 Ga0500637_0166430
676 Ga0587128_017123
677 Ga0501082_0096483
678 Ga0501082_0688635
679 Ga0466962_0128685
680 Ga0466962_0351460
681 2583153159
682 8002777742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04075

F420H2_quin_red

F420H(2)-dependent quinone reductase

24

163

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.9642 29 117
6xri-assembly4.cif.gz_H msmeg_2027 domain-swapped dimer 0.9354 31 117
4y9i-assembly1.cif.gz_A structure of f420-h2 dependent reductase (fdr-a) msmeg_2027 0.9296 31 117
3r5z-assembly2.cif.gz_B structure of a deazaflavin-dependent reductase from nocardia farcinica, with co-factor f420 0.8831 8 119
7kl8-assembly1.cif.gz_B structure of f420 binding protein rv1558 from mycobacterium tuberculosis with f420 bound 0.88 7 120
ID Description Score Start End Superfamily
af_O53328_2_119_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9734 29 119 2.30.110.10
4y9iA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9298 31 117 2.30.110.10
af_P9WP15_14_151_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8791 8 117 2.30.110.10
3r5yD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8597 3 119 2.30.110.10
3r5pA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8427 29 117 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A7X7HUX8-F1-model_v4 Nitroreductase family deazaflavin-dependent oxidoreductase 0.9902 31 119 GO:0005886
GO:0016491
GO:0070967
AF-A0A355ASN3-F1-model_v4 Nitroreductase family deazaflavin-dependent oxidoreductase 0.9886 41 120 GO:0005886
GO:0016491
GO:0070967
AF-A0A6L8EJY1-F1-model_v4 Nitroreductase family deazaflavin-dependent oxidoreductase 0.9872 41 119 GO:0005886
GO:0016491
GO:0070967
AF-A0A535R8N1-F1-model_v4 Nitroreductase family deazaflavin-dependent oxidoreductase 0.9868 31 120 GO:0005886
GO:0016491
GO:0070967
AF-A0A523HNC3-F1-model_v4 Nitroreductase family deazaflavin-dependent oxidoreductase 0.985 31 120 GO:0005886
GO:0016491
GO:0070967

Map