F414792

General Info

Members Datasets Scaffolds Average Seq Length
341 259 292 176

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10167611|Ga0307508_101676112
Length 197
Sequence VGLIRRFAFRNRQAECAILLLMSNYRRALVQGGCFFFTVNLLERRQTLLVDQIAVLREAVATTRQGHPFTIDAFVVLPDHLHAVWTLPQGDSDFSIRRRLIKNRFAKALPKQERRSAVRKARGERGIWQRRFWEHLIRDEADYARHVEYCYINPLKHRLVARVRDWPYSSFHRDVRAGLFPVDWGGDAETIGEFGER

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
5 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
6 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
7 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
8 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
9 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
10 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
11 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
12 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
13 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
14 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
15 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
16 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
17 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
18 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
19 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
20 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
21 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
22 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
23 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
24 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
25 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
26 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
27 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
28 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
29 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
30 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
31 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
32 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
33 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
34 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
35 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
36 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
37 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
38 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
39 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
40 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
41 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
42 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
87 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
103 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
142 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
143 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
159 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
182 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
183 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
224 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
229 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
235 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
238 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
239 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
240 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
241 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
242 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
243 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
244 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
245 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
246 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
247 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
248 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
249 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
250 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
251 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
252 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
256 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
257 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
258 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
259 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.1
Metatranscriptomes 0.59
Isolates 12.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.66
Nodule 8.5
Rhizoplane 5.28
Rhizosphere 60.7
Stem 0
Stem Tuber 0
Unclassified 10.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10013537 3300001979 Bacteria 3038
2 JGI24735J21928_10021942 3300002067 Bacteria 1947
3 JGI25153J46596_10001936 3300003215 Bacteria 12289
4 JGI25153J46596_10009626 3300003215 Bacteria 4459
5 rootH2_10097366 3300003320 Bacteria 2353
6 rootL2_10011010 3300003322 Bacteria 1152
7 JGI25404J52841_10010010 3300003659 Bacteria 2034
8 JGI25404J52841_10047605 3300003659 Bacteria 903
9 JGI25404J52841_10078106 3300003659 Bacteria 691
10 Ga0055531_10013028 3300003794 Bacteria 3863
11 Ga0065165_1013394 3300005262 Bacteria 3263
12 Ga0070658_10169068 3300005327 Bacteria 1836
13 Ga0070660_100097363 3300005339 Bacteria 2327
14 Ga0070660_100438539 3300005339 Bacteria 1083
15 Ga0070660_101094621 3300005339 Bacteria 674
16 Ga0070687_100943690 3300005343 Bacteria 621
17 Ga0070668_100096177 3300005347 Bacteria 2340
18 Ga0070671_100043742 3300005355 Bacteria 3722
19 Ga0070709_10057238 3300005434 Bacteria 2469
20 Ga0070711_101197850 3300005439 Bacteria 657
21 Ga0070708_100014002 3300005445 Bacteria 6589
22 Ga0070663_100076664 3300005455 Bacteria 2445
23 Ga0070663_100079290 3300005455 Bacteria 2409
24 Ga0070706_100787539 3300005467 Bacteria 880
25 Ga0070698_100846359 3300005471 Bacteria 859
26 Ga0070679_100713607 3300005530 Bacteria 945
27 Ga0070697_100361528 3300005536 Bacteria 1255
28 Ga0070697_100720965 3300005536 Bacteria 880
29 Ga0068853_100830565 3300005539 Bacteria 886
30 Ga0070665_100913459 3300005548 Bacteria 890
31 Ga0068855_100275906 3300005563 Bacteria 1868
32 Ga0068855_100610172 3300005563 Bacteria 1176
33 Ga0070664_100730035 3300005564 Bacteria 924
34 Ga0068857_100000349 3300005577 Bacteria 31928
35 Ga0068854_100156281 3300005578 Bacteria 1762
36 Ga0068856_101912864 3300005614 Bacteria 604
37 Ga0068852_100194306 3300005616 Bacteria 1917
38 Ga0068859_100536760 3300005617 Bacteria 1264
39 Ga0068851_10070330 3300005834 Bacteria 1810
40 Ga0068851_10104967 3300005834 Unclassified 1503
41 Ga0068863_101748055 3300005841 Bacteria 632
42 Ga0068858_100045210 3300005842 Bacteria 4080
43 Ga0068858_100084060 3300005842 Bacteria 2960
44 Ga0081540_1005547 3300005983 Bacteria 9404
45 Ga0081540_1014974 3300005983 Bacteria 4931
46 Ga0081539_10168167 3300005985 Bacteria 1039
47 Ga0070717_10795110 3300006028 Bacteria 860
48 Ga0070716_100548262 3300006173 Bacteria 862
49 Ga0070712_100666256 3300006175 Bacteria 885
50 Ga0075367_10687191 3300006178 Bacteria 651
51 Ga0075430_100557110 3300006846 Bacteria 945
52 Ga0097620_100536794 3300006931 Bacteria 1264
53 Ga0105240_10014932 3300009093 Bacteria 10581
54 Ga0105240_10215294 3300009093 Unclassified 2242
55 Ga0105240_11322231 3300009093 Bacteria 760
56 Ga0111539_11253113 3300009094 Bacteria 861
57 Ga0105247_10140295 3300009101 Bacteria 1583
58 Ga0114129_10896924 3300009147 Bacteria 1124
59 Ga0105241_10032135 3300009174 Bacteria 3932
60 Ga0105237_10000095 3300009545 Bacteria 121776
61 Ga0105237_10313777 3300009545 Bacteria 1571
62 Ga0105238_10591816 3300009551 Bacteria 1116
63 Ga0105238_10671886 3300009551 Bacteria 1047
64 Ga0105238_12001667 3300009551 Bacteria 613
65 Ga0105239_10181068 3300010375 Bacteria 2358
66 Ga0105239_11037150 3300010375 Bacteria 943
67 Ga0157314_1000008 3300012500 Bacteria 21724
68 Ga0157339_1001997 3300012505 Bacteria 1331
69 Ga0157371_10741435 3300013102 Bacteria 737
70 Ga0157370_10127151 3300013104 Bacteria 2379
71 Ga0157370_10465159 3300013104 Bacteria 1162
72 Ga0157369_10345263 3300013105 Bacteria 1546
73 Ga0157369_10887592 3300013105 Bacteria 914
74 Ga0157378_11154550 3300013297 Bacteria 813
75 Ga0163162_10378374 3300013306 Bacteria 1549
76 Ga0163162_10552777 3300013306 Bacteria 1279
77 Ga0163162_11306035 3300013306 Bacteria 824
78 Ga0157375_10457217 3300013308 Bacteria 1442
79 Ga0157380_10910126 3300014326 Bacteria 906
80 Ga0182008_10087123 3300014497 Bacteria 1538
81 Ga0157379_10533252 3300014968 Bacteria 1091
82 Ga0157376_10299093 3300014969 Bacteria 1522
83 Ga0182007_10043399 3300015262 Bacteria 1494
84 Ga0213876_10108192 3300021384 Bacteria 1475
85 Ga0213875_10001159 3300021388 Bacteria 18080
86 Ga0224712_10476464 3300022467 Bacteria 601
87 Ga0207425_1049641 3300025245 Bacteria 771
88 Ga0209129_1003966 3300025258 Bacteria 6101
89 Ga0209455_1005384 3300025272 Bacteria 3967
90 Ga0209673_1043107 3300025273 Bacteria 1263
91 Ga0209564_1018289 3300025295 Bacteria 2680
92 Ga0209758_1000595 3300025297 Bacteria 56364
93 Ga0209758_1002764 3300025297 Bacteria 17182
94 Ga0209758_1007950 3300025297 Bacteria 7030
95 Ga0209257_1001217 3300025304 Bacteria 32229
96 Ga0207656_10049970 3300025321 Bacteria 1804
97 Ga0207656_10058720 3300025321 Bacteria 1681
98 Ga0207705_10120652 3300025909 Bacteria 1945
99 Ga0207705_10323635 3300025909 Bacteria 1185
100 Ga0207684_10274680 3300025910 Bacteria 1454
101 Ga0207654_10029647 3300025911 Bacteria 2998
102 Ga0207695_10002559 3300025913 Bacteria 26728
103 Ga0207695_10206159 3300025913 Bacteria 1879
104 Ga0207671_10000026 3300025914 Bacteria 268845
105 Ga0207671_10151140 3300025914 Bacteria 1794
106 Ga0207693_10609427 3300025915 Bacteria 850
107 Ga0207660_10010158 3300025917 Bacteria 6099
108 Ga0207657_10223740 3300025919 Unclassified 1507
109 Ga0207652_10090543 3300025921 Bacteria 2688
110 Ga0207694_10540780 3300025924 Bacteria 977
111 Ga0207694_11502548 3300025924 Bacteria 568
112 Ga0207644_10079565 3300025931 Bacteria 2418
113 Ga0207665_10164470 3300025939 Bacteria 1598
114 Ga0207661_10892685 3300025944 Bacteria 819
115 Ga0207661_11250500 3300025944 Bacteria 683
116 Ga0207667_10001181 3300025949 Bacteria 32820
117 Ga0207667_10011354 3300025949 Bacteria 10359
118 Ga0207667_10338877 3300025949 Archaea 1535
119 Ga0207668_10210889 3300025972 Bacteria 1553
120 Ga0207668_10271581 3300025972 Bacteria 1386
121 Ga0207640_10432721 3300025981 Bacteria 1080
122 Ga0207703_10311741 3300026035 Bacteria 1438
123 Ga0207703_11029259 3300026035 Bacteria 790
124 Ga0207639_10151604 3300026041 Bacteria 1942
125 Ga0207678_10031123 3300026067 Bacteria 4656
126 Ga0207678_10037133 3300026067 Bacteria 4239
127 Ga0207678_10091346 3300026067 Bacteria 2602
128 Ga0207674_10000553 3300026116 Bacteria 48913
129 Ga0207674_10044742 3300026116 Bacteria 4559
130 Ga0207698_10085191 3300026142 Bacteria 2565
131 Ga0209974_10061050 3300027876 Bacteria 1276
132 Ga0268266_10188397 3300028379 Bacteria 1882
133 Ga0268266_10676620 3300028379 Bacteria 994
134 Ga0307517_10000495 3300028786 Bacteria 67515
135 Ga0265338_10281409 3300028800 Bacteria 1215
136 Ga0265773_1001606 3300031018 Bacteria 1249
137 Ga0307408_100000173 3300031548 Bacteria 72937
138 Ga0307508_10167611 3300031616 Bacteria 1800
139 Ga0307406_10000603 3300031901 Bacteria 20571
140 Ga0307409_100067714 3300031995 Bacteria 2821
141 Ga0373923_0306169 3300035111 Bacteria 753
142 Ga0373953_0167151 3300035117 Bacteria 946
143 Ga0373956_0022591 3300035119 Bacteria 2693
144 Ga0373957_0015480 3300035120 Bacteria 2626
145 Ga0373935_0779557 3300035692 Bacteria 705
146 Ga0373937_0039116 3300036401 Bacteria 4322
147 Ga0395898_0457601 3300037466 Bacteria 1215
148 Ga0395905_0059812 3300037471 Bacteria 3562
149 Ga0436364_0328145 3300037853 Bacteria 88179
150 Ga0395901_1962709 3300038443 Bacteria 532
151 Ga0400483_141130 3300039062 Bacteria 2326
152 Ga0436365_0265441 3300039437 Bacteria 1829
153 Ga0436365_0728124 3300039437 Bacteria 3187
154 Ga0436361_0786412 3300039447 Bacteria 3331
155 Ga0436363_0307655 3300039450 Bacteria 5498
156 Ga0451791_0873616 3300041451 Bacteria 767
157 Ga0451807_1776840 3300041486 Bacteria 805
158 Ga0451853_1124771 3300041512 Bacteria 1250
159 Ga0451577_0000013 3300042876 Bacteria 550689
160 Ga0466972_0030713 3300044658 Bacteria 2644
161 Ga0453683_0000113 3300044673 Bacteria 121290
162 Ga0453684_0000085 3300044712 Bacteria 397817
163 Ga0466968_0135390 3300044735 Bacteria 1123
164 Ga0466957_0121950 3300044842 Bacteria 1662
165 Ga0466959_0636940 3300045049 Bacteria 716
166 Ga0451576_0000018 3300045051 Bacteria 550689
167 Ga0495592_0100023 3300046454 Bacteria 2068
168 Ga0495592_0326670 3300046454 Bacteria 990
169 Ga0495590_0133346 3300046457 Bacteria 894
170 Ga0495651_0181848 3300046462 Bacteria 1487
171 Ga0495664_0064070 3300046477 Bacteria 2191
172 Ga0495664_0444054 3300046477 Bacteria 777
173 Ga0495585_0380498 3300046492 Bacteria 682
174 Ga0495608_0444767 3300046511 Bacteria 789
175 Ga0495618_0023874 3300046514 Bacteria 3786
176 Ga0495630_0648063 3300046517 Bacteria 809
177 Ga0495648_0198088 3300046524 Bacteria 1008
178 Ga0495652_0135129 3300046529 Bacteria 1947
179 Ga0495640_0134680 3300046533 Bacteria 1596
180 Ga0495645_0373133 3300046543 Bacteria 914
181 Ga0495645_0562139 3300046543 Bacteria 706
182 Ga0495667_0459732 3300046559 Bacteria 799
183 Ga0495634_0198250 3300046642 Bacteria 1248
184 Ga0495635_0343354 3300046663 Bacteria 997
185 Ga0495635_0427413 3300046663 Bacteria 877
186 Ga0495635_0468588 3300046663 Bacteria 831
187 Ga0495661_0162426 3300046665 Bacteria 1198
188 Ga0495588_0384077 3300046674 Bacteria 737
189 Ga0495657_0553432 3300046675 Bacteria 668
190 Ga0495599_0336096 3300046678 Bacteria 907
191 Ga0495623_0229956 3300046679 Bacteria 1052
192 Ga0495623_0370461 3300046679 Bacteria 776
193 Ga0495646_0087128 3300046680 Bacteria 1810
194 Ga0495613_0563995 3300046689 Bacteria 761
195 Ga0495624_0769590 3300046690 Bacteria 570
196 Ga0495600_0153085 3300046809 Bacteria 1492
197 Ga0495604_0147648 3300047317 Bacteria 1674
198 Ga0495604_0402972 3300047317 Bacteria 901
199 Ga0495674_0143172 3300047319 Bacteria 2008
200 Ga0495680_0073681 3300047322 Bacteria 2594
201 Ga0495684_0092399 3300047471 Bacteria 2292
202 Ga0495602_0382793 3300048088 Bacteria 1007
203 Ga0496101_0067317 3300048904 Bacteria 2615
204 Ga0496102_0343161 3300048905 Bacteria 1406
205 Ga0496103_0110987 3300048906 Bacteria 1742
206 Ga0496104_0053049 3300048907 Bacteria 3830
207 Ga0496104_0115398 3300048907 Bacteria 2576
208 Ga0496104_0450067 3300048907 Bacteria 1199
209 Ga0496105_0010626 3300048908 Bacteria 7242
210 Ga0496105_0084355 3300048908 Bacteria 2624
211 Ga0496106_0304653 3300048909 Bacteria 1278
212 Ga0496107_0199507 3300048910 Bacteria 1487
213 Ga0496109_0102301 3300048912 Bacteria 2659
214 Ga0496109_1242210 3300048912 Bacteria 681
215 Ga0496110_0079387 3300048913 Bacteria 2922
216 Ga0496113_0561822 3300048916 Bacteria 915
217 Ga0496115_0048012 3300048918 Bacteria 3415
218 Ga0496115_0048202 3300048918 Bacteria 3407
219 Ga0496117_0092256 3300048920 Bacteria 1946
220 Ga0496119_0135138 3300048922 Bacteria 1338
221 Ga0496120_0026060 3300048923 Bacteria 3618
222 Ga0496120_0063941 3300048923 Bacteria 2045
223 Ga0496121_0032137 3300048924 Bacteria 4777
224 Ga0496121_0053282 3300048924 Bacteria 3390
225 Ga0496121_0177118 3300048924 Bacteria 1543
226 Ga0496122_0117648 3300048925 Bacteria 1725
227 Ga0496126_0020646 3300048929 Bacteria 6452
228 Ga0496126_0057394 3300048929 Bacteria 3515
229 Ga0496126_0220854 3300048929 Bacteria 1592
230 Ga0496126_0362647 3300048929 Bacteria 1183
231 Ga0501031_0282625 3300049568 Bacteria 1076
232 Ga0501032_0102020 3300049569 Bacteria 1901
233 Ga0501032_0621089 3300049569 Unclassified 687
234 Ga0501033_0033897 3300049570 Bacteria 3832
235 Ga0501034_0051907 3300049571 Bacteria 4133
236 Ga0501034_0414064 3300049571 Bacteria 1269
237 Ga0501036_0068612 3300049572 Bacteria 3000
238 Ga0501037_0039989 3300049573 Bacteria 3451
239 Ga0501038_0019027 3300049574 Bacteria 6196
240 Ga0501043_0127282 3300049579 Bacteria 1997
241 Ga0501047_0379425 3300049581 Bacteria 1248
242 Ga0501048_0806288 3300049582 Bacteria 675
243 Ga0501070_0150483 3300049586 Bacteria 1920
244 Ga0501072_0012996 3300049588 Bacteria 6371
245 Ga0501221_129272 3300049704 Bacteria 652
246 Ga0501225_0000648 3300049705 Bacteria 10816
247 Ga0501083_0050827 3300049744 Bacteria 2789
248 Ga0501083_0317878 3300049744 Bacteria 1012
249 Ga0501035_0035833 3300049822 Bacteria 4501
250 Ga0501035_0049930 3300049822 Bacteria 3750
251 Ga0501044_0043461 3300049823 Bacteria 4667
252 Ga0501044_0186380 3300049823 Bacteria 2039
253 nmdc:mga0k408_220276_c1 3300050493 Bacteria 1133
254 nmdc:mga0k408_289725_c1 3300050493 Bacteria 977
255 nmdc:mga06z11_36600_c1 3300050494 Bacteria 2424
256 nmdc:mga06z11_491869_c1 3300050494 Bacteria 743
257 nmdc:mga05p37_258554_c1 3300050507 Bacteria 2085
258 nmdc:mga0qj67_347464_c1 3300050509 Bacteria 1199
259 nmdc:mga08y16_1162224_c1 3300050511 Bacteria 744
260 nmdc:mga08y16_506193_c1 3300050511 Bacteria 1226
261 Ga0495601_0065733 3300053077 Bacteria 2308
262 Ga0495601_0493662 3300053077 Bacteria 790
263 Ga0495612_0384641 3300053078 Bacteria 636
264 Ga0495595_0056020 3300053084 Bacteria 1836
265 Ga0495619_0201284 3300053085 Bacteria 1378
266 Ga0500647_0095572 3300053091 Bacteria 1421
267 Ga0500583_0281204 3300053092 Bacteria 817
268 Ga0500583_0351430 3300053092 Bacteria 714
269 Ga0500566_0004572 3300053094 Bacteria 8253
270 Ga0500640_022404 3300053095 Bacteria 2730
271 Ga0500572_000518 3300053111 Bacteria 13190
272 Ga0500572_017641 3300053111 Bacteria 1836
273 Ga0500608_039784 3300053122 Bacteria 2252
274 Ga0500608_149480 3300053122 Bacteria 1025
275 Ga0500614_000454 3300053123 Bacteria 10610
276 Ga0500642_0081708 3300053130 Bacteria 1485
277 Ga0500559_0000390 3300053136 Bacteria 32086
278 Ga0500559_0005915 3300053136 Bacteria 5568
279 Ga0500559_0310539 3300053136 Bacteria 740
280 Ga0500590_052832 3300053148 Bacteria 2061
281 Ga0500590_204666 3300053148 Bacteria 831
282 Ga0500603_001485 3300053150 Bacteria 5348
283 Ga0500630_007993 3300053159 Bacteria 5180
284 Ga0500638_041334 3300053162 Bacteria 2239
285 Ga0500639_000020 3300053163 Bacteria 102959
286 Ga0500639_051297 3300053163 Bacteria 2148
287 Ga0500596_001016 3300053735 Bacteria 5626
288 Ga0500596_001318 3300053735 Bacteria 5001
289 Ga0500601_015710 3300053737 Bacteria 861
290 Ga0500601_023481 3300053737 Bacteria 716
291 Ga0501084_0250763 3300054114 Bacteria 1494
292 Ga0501082_0000013 3300060353 Bacteria 119623

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2849076700 2849077108 153
2 3300037466 Ga0395898_0457601 Ga0395898_0457601_98_583 155
3 3300037471 Ga0395905_0059812 Ga0395905_0059812_2534_3019 155
4 3300038443 Ga0395901_1962709 Ga0395901_1962709_37_522 155
5 iso_pu_bacteria 8016630954 8016637087 155
6 3300006846 Ga0075430_100557110 Ga0075430_1005571101 157
7 3300050509 nmdc:mga0qj67_347464_c1 nmdc:mga0qj67_347464_c1_702_1181 157
8 3300005343 Ga0070687_100943690 Ga0070687_1009436901 158
9 3300013297 Ga0157378_11154550 Ga0157378_111545501 158
10 3300013308 Ga0157375_10457217 Ga0157375_104572172 158
11 3300014326 Ga0157380_10910126 Ga0157380_109101262 158
12 3300014969 Ga0157376_10299093 Ga0157376_102990932 158
13 3300048916 Ga0496113_0561822 Ga0496113_0561822_255_752 158
14 3300048918 Ga0496115_0048012 Ga0496115_0048012_1966_2463 158
15 3300048922 Ga0496119_0135138 Ga0496119_0135138_197_694 158
16 3300048923 Ga0496120_0063941 Ga0496120_0063941_493_990 158
17 3300048925 Ga0496122_0117648 Ga0496122_0117648_535_1032 158
18 3300048929 Ga0496126_0020646 Ga0496126_0020646_1788_2285 158
19 3300046477 Ga0495664_0064070 Ga0495664_0064070_170_718 159
20 3300046517 Ga0495630_0648063 Ga0495630_0648063_204_752 159
21 3300039062 Ga0400483_141130 Ga0400483_141130_1793_2308 160
22 3300048908 Ga0496105_0010626 Ga0496105_0010626_1202_1738 160
23 3300045049 Ga0466959_0636940 Ga0466959_0636940_80_592 163
24 3300005563 Ga0068855_100610172 Ga0068855_1006101721 165
25 3300013104 Ga0157370_10127151 Ga0157370_101271513 165
26 3300014497 Ga0182008_10087123 Ga0182008_100871232 165
27 3300015262 Ga0182007_10043399 Ga0182007_100433992 165
28 3300025944 Ga0207661_11250500 Ga0207661_112505001 165
29 3300025949 Ga0207667_10338877 Ga0207667_103388771 165
30 3300049569 Ga0501032_0621089 Ga0501032_0621089_41_568 165
31 3300049571 Ga0501034_0051907 Ga0501034_0051907_2596_3123 165
32 3300049573 Ga0501037_0039989 Ga0501037_0039989_2511_3038 165
33 3300049579 Ga0501043_0127282 Ga0501043_0127282_294_821 165
34 3300049822 Ga0501035_0035833 Ga0501035_0035833_2456_2983 165
35 3300049823 Ga0501044_0043461 Ga0501044_0043461_575_1102 165
36 iso_pu_bacteria 2908756301 2908759086 165
37 iso_pu_bacteria 8056681323 8056684922 166
38 3300031548 Ga0307408_100000173 Ga0307408_10000017340 167
39 3300031901 Ga0307406_10000603 Ga0307406_100006034 167
40 3300046663 Ga0495635_0343354 Ga0495635_0343354_352_876 167
41 iso_pu_bacteria 2508501009 2508541834 167
42 iso_pu_bacteria 2513237139 2513872832 167
43 iso_pu_bacteria 2524023205 2524437425 167
44 iso_pu_bacteria 2744054633 2745076584 167
45 iso_pu_bacteria 2791355196 2793062341 167
46 iso_pu_bacteria 2802429603 2805915270 167
47 iso_pu_bacteria 2824600985 2824608037 167
48 iso_pu_bacteria 2824609381 2824616596 167
49 iso_pu_bacteria 2824773399 2824780632 167
50 iso_pu_bacteria 2847939898 2847946629 167
51 iso_pu_bacteria 2881364244 2881368773 167
52 iso_pu_bacteria 2885374607 2885375579 167
53 iso_pu_bacteria 2903727486 2903730991 167
54 iso_pu_bacteria 2932809354 2932810846 167
55 iso_pu_bacteria 2932818245 2932823822 167
56 iso_pu_bacteria 2935694250 2935701143 167
57 iso_pu_bacteria 2935760218 2935766568 167
58 iso_pu_bacteria 2935837841 2935838386 167
59 iso_pu_bacteria 2935908558 2935909038 167
60 iso_pu_bacteria 2935916978 2935919758 167
61 iso_pu_bacteria 2935926038 2935926388 167
62 iso_pu_bacteria 2935934488 2935934838 167
63 iso_pu_bacteria 2935942939 2935943288 167
64 iso_pu_bacteria 2935951376 2935951726 167
65 iso_pu_bacteria 2935967501 2935967851 167
66 iso_pu_bacteria 2941538514 2941538946 167
67 iso_pu_bacteria 3005474847 3005481170 167
68 iso_pu_bacteria 3005587118 3005588560 167
69 iso_pu_bacteria 8006926726 8006927085 167
70 iso_pu_bacteria 8019648815 8019658481 167
71 iso_pu_bacteria 8019687851 8019690145 167
72 3300005842 Ga0068858_100084060 Ga0068858_1000840601 168
73 3300009101 Ga0105247_10140295 Ga0105247_101402951 168
74 3300021384 Ga0213876_10108192 Ga0213876_101081922 168
75 3300026035 Ga0207703_11029259 Ga0207703_110292591 168
76 3300031995 Ga0307409_100067714 Ga0307409_1000677143 168
77 3300039437 Ga0436365_0728124 Ga0436365_0728124_290_817 168
78 3300039450 Ga0436363_0307655 Ga0436363_0307655_4271_4798 168
79 3300049744 Ga0501083_0050827 Ga0501083_0050827_800_1375 168
80 3300050493 nmdc:mga0k408_220276_c1 nmdc:mga0k408_220276_c1_500_1027 168
81 3300060353 Ga0501082_0000013 Ga0501082_0000013_57773_58348 168
82 iso_pu_bacteria 2508501042 2508694450 168
83 iso_pu_bacteria 2513237137 2513856401 168
84 iso_pu_bacteria 2904690495 2904691272 168
85 iso_pu_bacteria 2989392574 2989396170 168
86 iso_pu_bacteria 8016630954 8016640203 168
87 3300005439 Ga0070711_101197850 Ga0070711_1011978501 169
88 3300006175 Ga0070712_100666256 Ga0070712_1006662561 169
89 3300009094 Ga0111539_11253113 Ga0111539_112531131 169
90 3300009147 Ga0114129_10896924 Ga0114129_108969242 169
91 3300021388 Ga0213875_10001159 Ga0213875_1000115911 169
92 3300025915 Ga0207693_10609427 Ga0207693_106094271 169
93 3300028786 Ga0307517_10000495 Ga0307517_1000049541 169
94 3300031616 Ga0307508_10167611 Ga0307508_101676112 169
95 3300035111 Ga0373923_0306169 Ga0373923_0306169_18_548 169
96 3300035117 Ga0373953_0167151 Ga0373953_0167151_380_910 169
97 3300035119 Ga0373956_0022591 Ga0373956_0022591_389_919 169
98 3300035120 Ga0373957_0015480 Ga0373957_0015480_2016_2546 169
99 3300036401 Ga0373937_0039116 Ga0373937_0039116_377_907 169
100 3300037853 Ga0436364_0328145 Ga0436364_0328145_61502_62032 169
101 3300046454 Ga0495592_0326670 Ga0495592_0326670_13_543 169
102 3300046462 Ga0495651_0181848 Ga0495651_0181848_887_1417 169
103 3300046477 Ga0495664_0444054 Ga0495664_0444054_43_606 169
104 3300046514 Ga0495618_0023874 Ga0495618_0023874_3244_3774 169
105 3300046533 Ga0495640_0134680 Ga0495640_0134680_955_1518 169
106 3300046543 Ga0495645_0562139 Ga0495645_0562139_93_623 169
107 3300046559 Ga0495667_0459732 Ga0495667_0459732_182_712 169
108 3300046642 Ga0495634_0198250 Ga0495634_0198250_151_681 169
109 3300046663 Ga0495635_0427413 Ga0495635_0427413_77_607 169
110 3300046679 Ga0495623_0229956 Ga0495623_0229956_149_679 169
111 3300046680 Ga0495646_0087128 Ga0495646_0087128_428_958 169
112 3300046689 Ga0495613_0563995 Ga0495613_0563995_131_661 169
113 3300046809 Ga0495600_0153085 Ga0495600_0153085_903_1433 169
114 3300047317 Ga0495604_0402972 Ga0495604_0402972_319_849 169
115 3300047319 Ga0495674_0143172 Ga0495674_0143172_616_1146 169
116 3300047322 Ga0495680_0073681 Ga0495680_0073681_898_1428 169
117 3300047471 Ga0495684_0092399 Ga0495684_0092399_1037_1567 169
118 3300048088 Ga0495602_0382793 Ga0495602_0382793_387_917 169
119 3300048912 Ga0496109_0102301 Ga0496109_0102301_387_917 169
120 3300048929 Ga0496126_0220854 Ga0496126_0220854_1009_1539 169
121 3300049568 Ga0501031_0282625 Ga0501031_0282625_166_696 169
122 3300049569 Ga0501032_0102020 Ga0501032_0102020_498_1028 169
123 3300049570 Ga0501033_0033897 Ga0501033_0033897_2506_3036 169
124 3300049571 Ga0501034_0414064 Ga0501034_0414064_424_954 169
125 3300049572 Ga0501036_0068612 Ga0501036_0068612_399_929 169
126 3300049574 Ga0501038_0019027 Ga0501038_0019027_1327_1857 169
127 3300049581 Ga0501047_0379425 Ga0501047_0379425_355_885 169
128 3300049586 Ga0501070_0150483 Ga0501070_0150483_173_703 169
129 3300049822 Ga0501035_0049930 Ga0501035_0049930_2000_2530 169
130 3300049823 Ga0501044_0186380 Ga0501044_0186380_565_1095 169
131 3300050507 nmdc:mga05p37_258554_c1 nmdc:mga05p37_258554_c1_1305_1862 169
132 3300050511 nmdc:mga08y16_1162224_c1 nmdc:mga08y16_1162224_c1_158_715 169
133 3300053077 Ga0495601_0065733 Ga0495601_0065733_97_627 169
134 3300053084 Ga0495595_0056020 Ga0495595_0056020_1165_1695 169
135 3300053085 Ga0495619_0201284 Ga0495619_0201284_389_919 169
136 3300053092 Ga0500583_0351430 Ga0500583_0351430_38_568 169
137 iso_pu_bacteria 2824732956 2824739543 169
138 3300003659 JGI25404J52841_10010010 JGI25404J52841_100100102 170
139 3300003659 JGI25404J52841_10078106 JGI25404J52841_100781061 170
140 3300005327 Ga0070658_10169068 Ga0070658_101690681 170
141 3300005339 Ga0070660_100097363 Ga0070660_1000973633 170
142 3300005339 Ga0070660_100438539 Ga0070660_1004385392 170
143 3300005339 Ga0070660_101094621 Ga0070660_1010946211 170
144 3300005347 Ga0070668_100096177 Ga0070668_1000961773 170
145 3300005355 Ga0070671_100043742 Ga0070671_1000437424 170
146 3300005434 Ga0070709_10057238 Ga0070709_100572382 170
147 3300005445 Ga0070708_100014002 Ga0070708_1000140021 170
148 3300005455 Ga0070663_100076664 Ga0070663_1000766643 170
149 3300005467 Ga0070706_100787539 Ga0070706_1007875391 170
150 3300005471 Ga0070698_100846359 Ga0070698_1008463592 170
151 3300005530 Ga0070679_100713607 Ga0070679_1007136071 170
152 3300005536 Ga0070697_100361528 Ga0070697_1003615282 170
153 3300005536 Ga0070697_100720965 Ga0070697_1007209651 170
154 3300005539 Ga0068853_100830565 Ga0068853_1008305651 170
155 3300005548 Ga0070665_100913459 Ga0070665_1009134591 170
156 3300005564 Ga0070664_100730035 Ga0070664_1007300352 170
157 3300005616 Ga0068852_100194306 Ga0068852_1001943062 170
158 3300005834 Ga0068851_10104967 Ga0068851_101049671 170
159 3300005841 Ga0068863_101748055 Ga0068863_1017480551 170
160 3300005983 Ga0081540_1005547 Ga0081540_10055473 170
161 3300005983 Ga0081540_1014974 Ga0081540_10149742 170
162 3300006028 Ga0070717_10795110 Ga0070717_107951101 170
163 3300006173 Ga0070716_100548262 Ga0070716_1005482622 170
164 3300006178 Ga0075367_10687191 Ga0075367_106871911 170
165 3300009093 Ga0105240_10215294 Ga0105240_102152942 170
166 3300009093 Ga0105240_11322231 Ga0105240_113222312 170
167 3300009174 Ga0105241_10032135 Ga0105241_100321353 170
168 3300009545 Ga0105237_10313777 Ga0105237_103137772 170
169 3300009551 Ga0105238_10591816 Ga0105238_105918162 170
170 3300009551 Ga0105238_12001667 Ga0105238_120016671 170
171 3300010375 Ga0105239_10181068 Ga0105239_101810683 170
172 3300010375 Ga0105239_11037150 Ga0105239_110371502 170
173 3300013104 Ga0157370_10465159 Ga0157370_104651592 170
174 3300013105 Ga0157369_10345263 Ga0157369_103452632 170
175 3300013306 Ga0163162_10378374 Ga0163162_103783742 170
176 3300013306 Ga0163162_10552777 Ga0163162_105527772 170
177 3300013306 Ga0163162_11306035 Ga0163162_113060351 170
178 3300014968 Ga0157379_10533252 Ga0157379_105332521 170
179 3300025272 Ga0209455_1005384 Ga0209455_10053842 170
180 3300025273 Ga0209673_1043107 Ga0209673_10431071 170
181 3300025295 Ga0209564_1018289 Ga0209564_10182893 170
182 3300025297 Ga0209758_1007950 Ga0209758_10079503 170
183 3300025321 Ga0207656_10058720 Ga0207656_100587203 170
184 3300025909 Ga0207705_10120652 Ga0207705_101206521 170
185 3300025909 Ga0207705_10323635 Ga0207705_103236352 170
186 3300025910 Ga0207684_10274680 Ga0207684_102746802 170
187 3300025911 Ga0207654_10029647 Ga0207654_100296472 170
188 3300025913 Ga0207695_10206159 Ga0207695_102061593 170
189 3300025914 Ga0207671_10151140 Ga0207671_101511402 170
190 3300025917 Ga0207660_10010158 Ga0207660_100101587 170
191 3300025919 Ga0207657_10223740 Ga0207657_102237402 170
192 3300025921 Ga0207652_10090543 Ga0207652_100905434 170
193 3300025924 Ga0207694_10540780 Ga0207694_105407802 170
194 3300025924 Ga0207694_11502548 Ga0207694_115025481 170
195 3300025931 Ga0207644_10079565 Ga0207644_100795651 170
196 3300025944 Ga0207661_10892685 Ga0207661_108926851 170
197 3300025949 Ga0207667_10011354 Ga0207667_100113544 170
198 3300025972 Ga0207668_10210889 Ga0207668_102108891 170
199 3300025972 Ga0207668_10271581 Ga0207668_102715812 170
200 3300026041 Ga0207639_10151604 Ga0207639_101516042 170
201 3300026067 Ga0207678_10031123 Ga0207678_100311235 170
202 3300026067 Ga0207678_10091346 Ga0207678_100913462 170
203 3300026116 Ga0207674_10044742 Ga0207674_100447425 170
204 3300026142 Ga0207698_10085191 Ga0207698_100851912 170
205 3300028379 Ga0268266_10188397 Ga0268266_101883972 170
206 3300028379 Ga0268266_10676620 Ga0268266_106766201 170
207 3300035692 Ga0373935_0779557 Ga0373935_0779557_93_626 170
208 3300039437 Ga0436365_0265441 Ga0436365_0265441_1089_1622 170
209 3300041451 Ga0451791_0873616 Ga0451791_0873616_81_614 170
210 3300041486 Ga0451807_1776840 Ga0451807_1776840_151_684 170
211 3300041512 Ga0451853_1124771 Ga0451853_1124771_463_996 170
212 3300044658 Ga0466972_0030713 Ga0466972_0030713_1897_2430 170
213 3300044735 Ga0466968_0135390 Ga0466968_0135390_41_574 170
214 3300046454 Ga0495592_0100023 Ga0495592_0100023_120_653 170
215 3300046457 Ga0495590_0133346 Ga0495590_0133346_266_799 170
216 3300046492 Ga0495585_0380498 Ga0495585_0380498_105_638 170
217 3300046511 Ga0495608_0444767 Ga0495608_0444767_222_755 170
218 3300046524 Ga0495648_0198088 Ga0495648_0198088_428_961 170
219 3300046529 Ga0495652_0135129 Ga0495652_0135129_197_730 170
220 3300046543 Ga0495645_0373133 Ga0495645_0373133_161_694 170
221 3300046663 Ga0495635_0468588 Ga0495635_0468588_59_592 170
222 3300046665 Ga0495661_0162426 Ga0495661_0162426_644_1177 170
223 3300046674 Ga0495588_0384077 Ga0495588_0384077_117_650 170
224 3300046675 Ga0495657_0553432 Ga0495657_0553432_48_581 170
225 3300046690 Ga0495624_0769590 Ga0495624_0769590_16_549 170
226 3300047317 Ga0495604_0147648 Ga0495604_0147648_604_1137 170
227 3300048904 Ga0496101_0067317 Ga0496101_0067317_1994_2527 170
228 3300048905 Ga0496102_0343161 Ga0496102_0343161_758_1291 170
229 3300048906 Ga0496103_0110987 Ga0496103_0110987_83_616 170
230 3300048907 Ga0496104_0053049 Ga0496104_0053049_2749_3282 170
231 3300048907 Ga0496104_0115398 Ga0496104_0115398_2005_2538 170
232 3300048907 Ga0496104_0450067 Ga0496104_0450067_206_739 170
233 3300048908 Ga0496105_0084355 Ga0496105_0084355_271_804 170
234 3300048909 Ga0496106_0304653 Ga0496106_0304653_331_864 170
235 3300048910 Ga0496107_0199507 Ga0496107_0199507_874_1407 170
236 3300048912 Ga0496109_1242210 Ga0496109_1242210_47_580 170
237 3300048913 Ga0496110_0079387 Ga0496110_0079387_275_808 170
238 3300048918 Ga0496115_0048202 Ga0496115_0048202_2802_3335 170
239 3300048920 Ga0496117_0092256 Ga0496117_0092256_1383_1916 170
240 3300048924 Ga0496121_0053282 Ga0496121_0053282_1610_2143 170
241 3300048924 Ga0496121_0177118 Ga0496121_0177118_813_1346 170
242 3300048929 Ga0496126_0362647 Ga0496126_0362647_587_1120 170
243 3300049582 Ga0501048_0806288 Ga0501048_0806288_89_628 170
244 3300049588 Ga0501072_0012996 Ga0501072_0012996_4603_5136 170
245 3300049744 Ga0501083_0317878 Ga0501083_0317878_267_800 170
246 3300050494 nmdc:mga06z11_36600_c1 nmdc:mga06z11_36600_c1_944_1477 170
247 3300050494 nmdc:mga06z11_491869_c1 nmdc:mga06z11_491869_c1_148_681 170
248 3300053077 Ga0495601_0493662 Ga0495601_0493662_197_730 170
249 3300053078 Ga0495612_0384641 Ga0495612_0384641_34_567 170
250 3300053091 Ga0500647_0095572 Ga0500647_0095572_562_1095 170
251 3300053094 Ga0500566_0004572 Ga0500566_0004572_1213_1746 170
252 3300053094 Ga0500566_0004572 Ga0500566_0004572_3048_3581 170
253 3300053095 Ga0500640_022404 Ga0500640_022404_548_1081 170
254 3300053111 Ga0500572_000518 Ga0500572_000518_7877_8410 170
255 3300053111 Ga0500572_000518 Ga0500572_000518_9712_10245 170
256 3300053111 Ga0500572_017641 Ga0500572_017641_169_702 170
257 3300053122 Ga0500608_039784 Ga0500608_039784_1152_1685 170
258 3300053122 Ga0500608_149480 Ga0500608_149480_182_715 170
259 3300053123 Ga0500614_000454 Ga0500614_000454_3545_4078 170
260 3300053123 Ga0500614_000454 Ga0500614_000454_5380_5913 170
261 3300053136 Ga0500559_0000390 Ga0500559_0000390_5543_6076 170
262 3300053136 Ga0500559_0005915 Ga0500559_0005915_2659_3192 170
263 3300053136 Ga0500559_0005915 Ga0500559_0005915_4494_5027 170
264 3300053136 Ga0500559_0310539 Ga0500559_0310539_65_598 170
265 3300053148 Ga0500590_052832 Ga0500590_052832_1131_1664 170
266 3300053148 Ga0500590_204666 Ga0500590_204666_103_636 170
267 3300053150 Ga0500603_001485 Ga0500603_001485_2383_2916 170
268 3300053150 Ga0500603_001485 Ga0500603_001485_548_1081 170
269 3300053159 Ga0500630_007993 Ga0500630_007993_2998_3531 170
270 3300053162 Ga0500638_041334 Ga0500638_041334_1299_1832 170
271 3300053163 Ga0500639_000020 Ga0500639_000020_62285_62818 170
272 3300053163 Ga0500639_000020 Ga0500639_000020_64120_64653 170
273 3300053163 Ga0500639_051297 Ga0500639_051297_237_770 170
274 3300053735 Ga0500596_001016 Ga0500596_001016_2383_2916 170
275 3300053735 Ga0500596_001016 Ga0500596_001016_548_1081 170
276 3300053735 Ga0500596_001318 Ga0500596_001318_146_679 170
277 3300053737 Ga0500601_015710 Ga0500601_015710_18_551 170
278 3300053737 Ga0500601_023481 Ga0500601_023481_81_614 170
279 3300054114 Ga0501084_0250763 Ga0501084_0250763_939_1472 170
280 iso_pu_bacteria 2824653114 2824658697 170
281 3300003215 JGI25153J46596_10001936 JGI25153J46596_100019367 171
282 3300003659 JGI25404J52841_10047605 JGI25404J52841_100476052 171
283 3300003794 Ga0055531_10013028 Ga0055531_100130284 171
284 3300009551 Ga0105238_10671886 Ga0105238_106718862 171
285 3300025245 Ga0207425_1049641 Ga0207425_10496411 171
286 3300025297 Ga0209758_1000595 Ga0209758_10005956 171
287 3300025304 Ga0209257_1001217 Ga0209257_100121721 171
288 3300028800 Ga0265338_10281409 Ga0265338_102814092 171
289 3300031018 Ga0265773_1001606 Ga0265773_10016063 171
290 3300039447 Ga0436361_0786412 Ga0436361_0786412_692_1228 171
291 3300042876 Ga0451577_0000013 Ga0451577_0000013_119023_119562 171
292 3300044673 Ga0453683_0000113 Ga0453683_0000113_1729_2268 171
293 3300044712 Ga0453684_0000085 Ga0453684_0000085_278256_278795 171
294 3300044842 Ga0466957_0121950 Ga0466957_0121950_102_638 171
295 3300045051 Ga0451576_0000018 Ga0451576_0000018_431128_431667 171
296 3300046678 Ga0495599_0336096 Ga0495599_0336096_217_753 171
297 3300046679 Ga0495623_0370461 Ga0495623_0370461_219_755 171
298 3300048923 Ga0496120_0026060 Ga0496120_0026060_167_703 171
299 3300049705 Ga0501225_0000648 Ga0501225_0000648_8690_9229 171
300 3300050493 nmdc:mga0k408_289725_c1 nmdc:mga0k408_289725_c1_35_571 171
301 3300050511 nmdc:mga08y16_506193_c1 nmdc:mga08y16_506193_c1_559_1122 171
302 3300053092 Ga0500583_0281204 Ga0500583_0281204_43_579 171
303 3300053130 Ga0500642_0081708 Ga0500642_0081708_672_1208 171
304 3300005985 Ga0081539_10168167 Ga0081539_101681672 172
305 3300025939 Ga0207665_10164470 Ga0207665_101644702 172
306 3300048929 Ga0496126_0057394 Ga0496126_0057394_1155_1709 172
307 3300049704 Ga0501221_129272 Ga0501221_129272_77_616 172
308 3300027876 Ga0209974_10061050 Ga0209974_100610501 173
309 3300001979 JGI24740J21852_10013537 JGI24740J21852_100135371 176
310 3300002067 JGI24735J21928_10021942 JGI24735J21928_100219422 176
311 3300003215 JGI25153J46596_10009626 JGI25153J46596_100096264 176
312 3300003320 rootH2_10097366 rootH2_100973661 176
313 3300003322 rootL2_10011010 rootL2_100110101 176
314 3300005262 Ga0065165_1013394 Ga0065165_10133944 176
315 3300005455 Ga0070663_100079290 Ga0070663_1000792902 176
316 3300005563 Ga0068855_100275906 Ga0068855_1002759062 176
317 3300005577 Ga0068857_100000349 Ga0068857_1000003493 176
318 3300005578 Ga0068854_100156281 Ga0068854_1001562812 176
319 3300005614 Ga0068856_101912864 Ga0068856_1019128641 176
320 3300005617 Ga0068859_100536760 Ga0068859_1005367601 176
321 3300005834 Ga0068851_10070330 Ga0068851_100703302 176
322 3300005842 Ga0068858_100045210 Ga0068858_1000452104 176
323 3300006931 Ga0097620_100536794 Ga0097620_1005367941 176
324 3300009093 Ga0105240_10014932 Ga0105240_100149329 176
325 3300009545 Ga0105237_10000095 Ga0105237_10000095107 176
326 3300012500 Ga0157314_1000008 Ga0157314_100000818 176
327 3300012505 Ga0157339_1001997 Ga0157339_10019973 176
328 3300013102 Ga0157371_10741435 Ga0157371_107414351 176
329 3300013105 Ga0157369_10887592 Ga0157369_108875921 176
330 3300022467 Ga0224712_10476464 Ga0224712_104764641 176
331 3300025258 Ga0209129_1003966 Ga0209129_10039664 176
332 3300025297 Ga0209758_1002764 Ga0209758_100276414 176
333 3300025321 Ga0207656_10049970 Ga0207656_100499702 176
334 3300025913 Ga0207695_10002559 Ga0207695_1000255914 176
335 3300025914 Ga0207671_10000026 Ga0207671_1000002614 176
336 3300025949 Ga0207667_10001181 Ga0207667_100011816 176
337 3300025981 Ga0207640_10432721 Ga0207640_104327211 176
338 3300026035 Ga0207703_10311741 Ga0207703_103117412 176
339 3300026067 Ga0207678_10037133 Ga0207678_100371334 176
340 3300026116 Ga0207674_10000553 Ga0207674_1000055314 176
341 3300048924 Ga0496121_0032137 Ga0496121_0032137_4229_4759 176

Structural Annotation

Top 5 Hits

ID Description Score Start End
4er8-assembly1.cif.gz_A structure of the rep associates tyrosine transposase bound to a rep hairpin 0.8748 1 176
4er8-assembly1.cif.gz_A structure of the rep associates tyrosine transposase bound to a rep hairpin 0.8593 1 176
2a6m-assembly2.cif.gz_A-2 crystal structure of the ishp608 transposase 0.6906 11 127
2a6o-assembly1.cif.gz_A crystal structure of the ishp608 transposase in complex with stem-loop dna 0.6887 11 130
3ab2-assembly3.cif.gz_L crystal structure of aspartate kinase from corynebacterium glutamicum in complex with threonine 0.6884 11 83
ID Description Score Start End Superfamily
4er8A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.8748 1 176 3.30.70.1290
4er8A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.8593 1 176 3.30.70.1290
af_A0A1D6LBY0_366_425_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.7258 14 79 3.30.70.260
af_A0A1D6K384_16_63_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.722 14 63 3.30.70.260
2zhoB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.705 12 64 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A525CVN9-F1-model_v4 Transposase 0.9813 42 163 GO:0004803
GO:0006313
GO:0043565
AF-A0A0E9MJL9-F1-model_v4 Transposase 0.9801 3 151 GO:0004803
GO:0006313
GO:0043565
AF-A0A809R759-F1-model_v4 Transposase IS200-like domain-containing protein 0.9787 29 136 GO:0004803
GO:0006313
GO:0043565
AF-A0A290TI02-F1-model_v4 deleted 0.978 28 163
AF-A0A2S0VXS1-F1-model_v4 Transposase 0.9766 3 163 GO:0004803
GO:0006313
GO:0043565

Feature Viewer

pLDDT pTM Quality
88.58 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map