F414619

General Info

Members Datasets Scaffolds Average Seq Length
341 206 682 413

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100094663|Ga0070661_1000946632
Length 432
Sequence MTNYEQFLSRAAERMKESAIRRMGTVLASGRDVISFAPGYPAPDTFPWAEFREIAAELLTGADAGVLQYGPTRGYRPLLEVILTILQKRGIAASMEQLLVTTGSQQGLDLVARVLLDPGDVVLVELPTYTGAITAFRNVQAEMIGVPQEADGVDLSALDETLARLRSAGRRVKMLYVVPNFQNPTGLLIGLEKRGKLLEWARRRDMLIVEDDPYRELFFEDSASEADVRPIKVDDAEGRVIYLSSFSKTLAPGYRVAWIAAPPALAAKFEMAKQAEDLLTGSLDQRIIFEACRRGLLDRQLPLLRRHYQHKRDVMARALHRELKDLVSWPEPKGGFFLWLTLPDALDADAMIPRAVQHGVIYVAGEAFFVDAESPTTPGPRANTMRLSFSAPTPERIEDGVRRLAAAMKAELDAITANPRASASPAPSPASR

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
122 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
123 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
178 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
179 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
180 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
183 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
184 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
185 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
186 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
187 2643221731 Bacillus sp. Root147 Isolate Unclassified
188 2643221732 Bacillus sp. Root239 Isolate Unclassified
189 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
190 2791355260 Rhizobium sp. L9 Isolate Nodule
191 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
192 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
193 2842882022 Bacillus sp. R-71893 Isolate Unclassified
194 2857581216 Bacillus sp. R-71922 Isolate Unclassified
195 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
196 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
197 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
198 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
199 2919720352 Priestia megaterium 4340 Isolate Unclassified
200 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
201 2929004312 Priestia megaterium 1104 Isolate Unclassified
202 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
203 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
204 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
205 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
206 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.67
Metatranscriptomes 0.29
Isolates 7.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.23
Nodule 0.59
Rhizoplane 7.92
Rhizosphere 83.28
Stem 0
Stem Tuber 0
Unclassified 6.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_100094663 3300005344 Bacteria 2214
2 JGI25406J46586_10000102 3300003203 Bacteria 37824
3 JGI25406J46586_10001270 3300003203 Bacteria 11843
4 rootH1_10041684 3300003316 Bacteria 4150
5 rootL2_10154213 3300003322 Bacteria 4911
6 Ga0006562J51391_1010506 3300003578 Bacteria 2360
7 Ga0065704_10107293 3300005289 Bacteria 2057
8 Ga0065712_10069327 3300005290 Bacteria 7521
9 Ga0065715_10090455 3300005293 Bacteria 6975
10 Ga0065715_10107492 3300005293 Bacteria 2767
11 Ga0065707_10013433 3300005295 Bacteria 2860
12 Ga0065707_10092434 3300005295 Bacteria 3772
13 Ga0070683_100000817 3300005329 Bacteria 23098
14 Ga0070683_100140610 3300005329 Bacteria 2287
15 Ga0070670_100003221 3300005331 Bacteria 13474
16 Ga0070670_100004878 3300005331 Bacteria 11285
17 Ga0068868_100103161 3300005338 Bacteria 2310
18 Ga0068868_100177623 3300005338 Unclassified 1765
19 Ga0070689_100151179 3300005340 Bacteria 1872
20 Ga0070689_100202583 3300005340 Bacteria 1621
21 Ga0070661_100019804 3300005344 Bacteria 4796
22 Ga0070668_100088812 3300005347 Bacteria 2434
23 Ga0070669_100000133 3300005353 Bacteria 67886
24 Ga0070669_100018314 3300005353 Bacteria 5004
25 Ga0070669_100095227 3300005353 Bacteria 2239
26 Ga0070671_100012705 3300005355 Bacteria 6787
27 Ga0070674_100001657 3300005356 Bacteria 12021
28 Ga0070674_100003721 3300005356 Bacteria 8596
29 Ga0070674_100099428 3300005356 Unclassified 2116
30 Ga0070673_100007783 3300005364 Bacteria 7091
31 Ga0070673_100102202 3300005364 Unclassified 2363
32 Ga0070714_100002687 3300005435 Bacteria 13106
33 Ga0070700_100027049 3300005441 Bacteria 3397
34 Ga0070663_100012727 3300005455 Bacteria 5333
35 Ga0070678_100059183 3300005456 Bacteria 2815
36 Ga0070678_100080039 3300005456 Bacteria 2473
37 Ga0070681_10218575 3300005458 Unclassified 1821
38 Ga0068867_100203181 3300005459 Bacteria 1587
39 Ga0070707_100212692 3300005468 Bacteria 1884
40 Ga0070698_100198918 3300005471 Bacteria 1940
41 Ga0070699_100031317 3300005518 Unclassified 4591
42 Ga0070679_100047837 3300005530 Bacteria 4262
43 Ga0070684_100000538 3300005535 Bacteria 26032
44 Ga0070697_100159674 3300005536 Bacteria 1904
45 Ga0070672_100009593 3300005543 Bacteria 6678
46 Ga0070686_100018833 3300005544 Bacteria 4059
47 Ga0070665_100190836 3300005548 Bacteria 2050
48 Ga0070664_100000055 3300005564 Bacteria 69107
49 Ga0070664_100050765 3300005564 Bacteria 3511
50 Ga0068857_100047006 3300005577 Bacteria 3831
51 Ga0068854_100201306 3300005578 Bacteria 1565
52 Ga0068852_100194231 3300005616 Unclassified 1917
53 Ga0068859_100079421 3300005617 Bacteria 3321
54 Ga0068859_100184206 3300005617 Bacteria 2171
55 Ga0068864_100266360 3300005618 Bacteria 1595
56 Ga0068861_100078011 3300005719 Bacteria 2586
57 Ga0068863_100345102 3300005841 Bacteria 1449
58 Ga0068858_100134340 3300005842 Bacteria 2321
59 Ga0068860_100179166 3300005843 Bacteria 2048
60 Ga0081539_10000056 3300005985 Bacteria 256522
61 Ga0081539_10000460 3300005985 Bacteria 86291
62 Ga0081539_10005019 3300005985 Bacteria 13951
63 Ga0081539_10024647 3300005985 Bacteria 3897
64 Ga0075363_100039007 3300006048 Bacteria 2499
65 Ga0075364_10021813 3300006051 Bacteria 4038
66 Ga0075366_10024554 3300006195 Bacteria 3515
67 Ga0075370_10005192 3300006353 Bacteria 6438
68 Ga0075428_100002058 3300006844 Bacteria 21689
69 Ga0075428_100003760 3300006844 Bacteria 16637
70 Ga0075428_100027456 3300006844 Bacteria 6298
71 Ga0075430_100002788 3300006846 Bacteria 14603
72 Ga0075430_100010719 3300006846 Bacteria 7769
73 Ga0075430_100052113 3300006846 Unclassified 3446
74 Ga0075431_100006847 3300006847 Bacteria 11323
75 Ga0075431_100007559 3300006847 Bacteria 10820
76 Ga0075431_100016286 3300006847 Bacteria 7543
77 Ga0075431_100027535 3300006847 Bacteria 5833
78 Ga0075431_100033052 3300006847 Bacteria 5331
79 Ga0075431_100034677 3300006847 Bacteria 5198
80 Ga0075431_100043795 3300006847 Bacteria 4616
81 Ga0075431_100106404 3300006847 Bacteria 2894
82 Ga0075433_10008360 3300006852 Bacteria 8256
83 Ga0075433_10024449 3300006852 Bacteria 5099
84 Ga0075433_10082340 3300006852 Bacteria 2838
85 Ga0075429_100085680 3300006880 Unclassified 2746
86 Ga0075429_100194023 3300006880 Unclassified 1779
87 Ga0097620_100079417 3300006931 Bacteria 3321
88 Ga0097620_100184203 3300006931 Bacteria 2171
89 Ga0075435_100012392 3300007076 Bacteria 6310
90 Ga0075435_100034993 3300007076 Bacteria 3984
91 Ga0111539_10000859 3300009094 Bacteria 39627
92 Ga0111539_10001246 3300009094 Bacteria 33877
93 Ga0111539_10003020 3300009094 Bacteria 22300
94 Ga0111539_10028859 3300009094 Bacteria 6766
95 Ga0111539_10050204 3300009094 Bacteria 4970
96 Ga0111539_10093806 3300009094 Bacteria 3526
97 Ga0111539_10241654 3300009094 Bacteria 2102
98 Ga0111539_10416804 3300009094 Unclassified 1564
99 Ga0105245_10070713 3300009098 Bacteria 3168
100 Ga0114129_10000802 3300009147 Bacteria 40299
101 Ga0114129_10004303 3300009147 Bacteria 20120
102 Ga0114129_10010905 3300009147 Bacteria 12946
103 Ga0114129_10044617 3300009147 Bacteria 6236
104 Ga0114129_10046303 3300009147 Bacteria 6113
105 Ga0114129_10049543 3300009147 Bacteria 5901
106 Ga0114129_10091747 3300009147 Bacteria 4208
107 Ga0114129_10110807 3300009147 Bacteria 3788
108 Ga0105243_10194275 3300009148 Bacteria 1775
109 Ga0105242_10015999 3300009176 Bacteria 5829
110 Ga0105242_10119832 3300009176 Bacteria 2256
111 Ga0105248_10031753 3300009177 Bacteria 5900
112 Ga0105248_10079318 3300009177 Bacteria 3690
113 Ga0105249_10009355 3300009553 Bacteria 8572
114 Ga0105249_10097948 3300009553 Unclassified 2754
115 Ga0105249_10101143 3300009553 Bacteria 2711
116 Ga0105249_10456874 3300009553 Bacteria 1317
117 Ga0105246_10166544 3300011119 Bacteria 1684
118 Ga0105246_10201518 3300011119 Bacteria 1547
119 Ga0157374_10019323 3300013296 Bacteria 6030
120 Ga0157372_10031496 3300013307 Bacteria 5806
121 Ga0157380_10016948 3300014326 Bacteria 5382
122 Ga0157380_10028629 3300014326 Bacteria 4250
123 Ga0157380_10054153 3300014326 Bacteria 3183
124 Ga0157379_10159165 3300014968 Bacteria 2038
125 Ga0157376_10039625 3300014969 Bacteria 3845
126 Ga0163161_10094249 3300017792 Bacteria 2219
127 Ga0209025_1002323 3300025294 Bacteria 20551
128 Ga0209025_1029420 3300025294 Bacteria 2657
129 Ga0207697_10002262 3300025315 Bacteria 10067
130 Ga0207697_10041877 3300025315 Unclassified 1881
131 Ga0207697_10068838 3300025315 Bacteria 1481
132 Ga0207696_1018090 3300025711 Bacteria 2320
133 Ga0207655_1011500 3300025728 Bacteria 5262
134 Ga0207688_10004743 3300025901 Bacteria 7402
135 Ga0207680_10156679 3300025903 Bacteria 1523
136 Ga0207707_10171676 3300025912 Unclassified 1895
137 Ga0207662_10001608 3300025918 Bacteria 11059
138 Ga0207649_10009593 3300025920 Bacteria 5301
139 Ga0207652_10109870 3300025921 Unclassified 2445
140 Ga0207681_10008219 3300025923 Bacteria 6383
141 Ga0207681_10076632 3300025923 Bacteria 2349
142 Ga0207681_10213736 3300025923 Bacteria 1488
143 Ga0207650_10008128 3300025925 Bacteria 7150
144 Ga0207650_10048843 3300025925 Bacteria 3122
145 Ga0207659_10208011 3300025926 Bacteria 1567
146 Ga0207670_10050467 3300025936 Bacteria 2788
147 Ga0207669_10003329 3300025937 Bacteria 6952
148 Ga0207669_10005286 3300025937 Bacteria 5775
149 Ga0207669_10063040 3300025937 Bacteria 2286
150 Ga0207704_10202853 3300025938 Bacteria 1453
151 Ga0207691_10005745 3300025940 Bacteria 12003
152 Ga0207691_10029885 3300025940 Bacteria 5097
153 Ga0207711_10103973 3300025941 Bacteria 2516
154 Ga0207711_10116957 3300025941 Bacteria 2377
155 Ga0207661_10001501 3300025944 Bacteria 15811
156 Ga0207661_10123947 3300025944 Bacteria 2204
157 Ga0207661_10203575 3300025944 Unclassified 1741
158 Ga0207679_10001458 3300025945 Bacteria 14838
159 Ga0207679_10036574 3300025945 Bacteria 3483
160 Ga0207667_10152025 3300025949 Bacteria 2382
161 Ga0207651_10005716 3300025960 Bacteria 6420
162 Ga0207712_10026518 3300025961 Bacteria 3862
163 Ga0207712_10033673 3300025961 Bacteria 3466
164 Ga0207677_10061262 3300026023 Bacteria 2605
165 Ga0207678_10041715 3300026067 Bacteria 3978
166 Ga0207708_10019159 3300026075 Bacteria 5154
167 Ga0207708_10071874 3300026075 Unclassified 2650
168 Ga0207648_10032316 3300026089 Bacteria 4621
169 Ga0207648_10071523 3300026089 Bacteria 3023
170 Ga0207676_10021946 3300026095 Bacteria 4690
171 Ga0207674_10028123 3300026116 Bacteria 5938
172 Ga0207675_100034588 3300026118 Bacteria 4712
173 Ga0207683_10048653 3300026121 Bacteria 3712
174 Ga0207683_10143898 3300026121 Bacteria 2149
175 Ga0207428_10001731 3300027907 Bacteria 22364
176 Ga0207428_10005503 3300027907 Bacteria 11801
177 Ga0207428_10019004 3300027907 Bacteria 5860
178 Ga0268265_10035948 3300028380 Bacteria 3624
179 Ga0307408_100002442 3300031548 Bacteria 13056
180 Ga0307408_100011481 3300031548 Bacteria 5852
181 Ga0307408_100054145 3300031548 Bacteria 2900
182 Ga0307405_10173064 3300031731 Bacteria 1542
183 Ga0307410_10183950 3300031852 Bacteria 1584
184 Ga0307410_10292689 3300031852 Bacteria 1282
185 Ga0307406_10012673 3300031901 Bacteria 4808
186 Ga0307406_10176366 3300031901 Bacteria 1552
187 Ga0307412_10062577 3300031911 Bacteria 2506
188 Ga0307409_100014897 3300031995 Bacteria 5079
189 Ga0307409_100085580 3300031995 Bacteria 2563
190 Ga0307416_100019660 3300032002 Bacteria 4795
191 Ga0307416_100209188 3300032002 Bacteria 1859
192 Ga0307414_10052853 3300032004 Bacteria 2830
193 Ga0307411_10011537 3300032005 Bacteria 4776
194 Ga0307415_100053039 3300032126 Bacteria 2761
195 Ga0307415_100135285 3300032126 Bacteria 1873
196 Ga0373951_0000043 3300035091 Bacteria 49665
197 Ga0373956_0029591 3300035119 Unclassified 2389
198 Ga0373957_0059642 3300035120 Bacteria 1476
199 Ga0373955_0015352 3300035172 Bacteria 3748
200 Ga0373947_0041206 3300035725 Bacteria 2753
201 Ga0373937_0000262 3300036401 Bacteria 50726
202 Ga0373925_0016046 3300037068 Bacteria 5422
203 Ga0451853_1533890 3300041512 Bacteria 7601
204 Ga0439433_0006848 3300041999 Bacteria 2456
205 Ga0450894_001530 3300042131 Bacteria 3287
206 Ga0439464_0000483 3300042439 Bacteria 8053
207 Ga0451577_0038512 3300042876 Bacteria 4301
208 Ga0466972_0011843 3300044658 Bacteria 4382
209 Ga0466965_0000801 3300044683 Bacteria 11856
210 Ga0466970_0002583 3300044765 Bacteria 8728
211 Ga0466957_0000207 3300044842 Bacteria 27537
212 Ga0466957_0007358 3300044842 Bacteria 6225
213 Ga0466960_0047577 3300044901 Bacteria 2057
214 Ga0451576_0078562 3300045051 Unclassified 3434
215 Ga0466967_0040145 3300045976 Bacteria 4028
216 Ga0495587_0025913 3300046536 Bacteria 3579
217 Ga0495621_0020020 3300046539 Bacteria 2191
218 Ga0496100_0024660 3300048903 Bacteria 3670
219 Ga0496101_0008265 3300048904 Bacteria 6797
220 Ga0496101_0030828 3300048904 Bacteria 3765
221 Ga0496103_0065466 3300048906 Bacteria 2267
222 Ga0496104_0001516 3300048907 Bacteria 20039
223 Ga0496104_0007340 3300048907 Bacteria 9732
224 Ga0496105_0034081 3300048908 Bacteria 4186
225 Ga0496105_0176847 3300048908 Bacteria 1748
226 Ga0496106_0010022 3300048909 Bacteria 7001
227 Ga0496106_0048417 3300048909 Bacteria 3201
228 Ga0496107_0040369 3300048910 Bacteria 3350
229 Ga0496108_0001282 3300048911 Bacteria 19690
230 Ga0496108_0065319 3300048911 Bacteria 3067
231 Ga0496108_0163712 3300048911 Bacteria 1923
232 Ga0496109_0000572 3300048912 Bacteria 30775
233 Ga0496110_0002234 3300048913 Bacteria 14473
234 Ga0496110_0071584 3300048913 Bacteria 3075
235 Ga0496110_0094875 3300048913 Bacteria 2671
236 Ga0496110_0101562 3300048913 Bacteria 2578
237 Ga0496111_0009139 3300048914 Bacteria 6596
238 Ga0496112_0000217 3300048915 Bacteria 37074
239 Ga0496112_0010508 3300048915 Bacteria 8400
240 Ga0496112_0037437 3300048915 Bacteria 4736
241 Ga0496112_0104704 3300048915 Bacteria 2799
242 Ga0496113_0093531 3300048916 Bacteria 2321
243 Ga0496113_0144575 3300048916 Bacteria 1872
244 Ga0496113_0172505 3300048916 Bacteria 1713
245 Ga0496119_0032548 3300048922 Bacteria 3473
246 Ga0501031_0096824 3300049568 Bacteria 1926
247 Ga0501034_0041777 3300049571 Bacteria 4640
248 Ga0501036_0274963 3300049572 Unclassified 1410
249 Ga0501041_0099930 3300049577 Bacteria 1795
250 Ga0501043_0162254 3300049579 Bacteria 1746
251 Ga0501048_0038586 3300049582 Bacteria 3427
252 Ga0501068_0025099 3300049584 Bacteria 3505
253 Ga0501071_0016536 3300049587 Bacteria 5075
254 Ga0501072_0016822 3300049588 Bacteria 5618
255 Ga0501072_0121017 3300049588 Bacteria 2085
256 Ga0501074_0112639 3300049590 Bacteria 1947
257 Ga0501075_0003086 3300049591 Bacteria 11133
258 Ga0501075_0020027 3300049591 Bacteria 4859
259 Ga0501076_0025823 3300049592 Bacteria 4548
260 Ga0501076_0061953 3300049592 Bacteria 2978
261 Ga0501076_0217375 3300049592 Bacteria 1562
262 Ga0501079_0177783 3300049741 Bacteria 1660
263 Ga0501081_0054701 3300049743 Unclassified 2758
264 Ga0501045_0037728 3300049824 Bacteria 3513
265 nmdc:mga00v17_1046_c1 3300050491 Bacteria 14658
266 nmdc:mga0yw44_65328_c1 3300050492 Bacteria 2242
267 nmdc:mga0k408_4707_c1 3300050493 Bacteria 7234
268 nmdc:mga06z11_8903_c1 3300050494 Bacteria 4209
269 nmdc:mga07m45_108728_c1 3300050496 Bacteria 1596
270 nmdc:mga05p37_107795_c1 3300050507 Bacteria 3427
271 nmdc:mga05p37_121933_c1 3300050507 Bacteria 3201
272 nmdc:mga05p37_17084_c1 3300050507 Bacteria 8752
273 nmdc:mga05p37_2848_c1 3300050507 Bacteria 20101
274 nmdc:mga05p37_53433_c1 3300050507 Bacteria 4968
275 nmdc:mga05p37_58873_c1 3300050507 Bacteria 4731
276 nmdc:mga05p37_8024_c1 3300050507 Bacteria 12465
277 nmdc:mga09592_182604_c1 3300050508 Unclassified 1815
278 nmdc:mga09592_2893_c1 3300050508 Bacteria 13912
279 nmdc:mga0qj67_19306_c1 3300050509 Bacteria 5206
280 nmdc:mga0qj67_25035_c1 3300050509 Bacteria 4607
281 nmdc:mga0qj67_70124_c1 3300050509 Bacteria 2796
282 nmdc:mga06r32_161168_c1 3300050510 Bacteria 2226
283 nmdc:mga06r32_2985_c1 3300050510 Bacteria 15145
284 nmdc:mga06r32_53418_c1 3300050510 Bacteria 3870
285 nmdc:mga06r32_75286_c1 3300050510 Bacteria 3275
286 nmdc:mga06r32_76858_c1 3300050510 Bacteria 3243
287 nmdc:mga06r32_85517_c1 3300050510 Bacteria 3075
288 nmdc:mga08y16_180383_c1 3300050511 Bacteria 2193
289 nmdc:mga08y16_2029_c1 3300050511 Bacteria 20740
290 nmdc:mga08y16_49212_c1 3300050511 Bacteria 4411
291 nmdc:mga08y16_6827_c1 3300050511 Bacteria 11975
292 nmdc:mga08y16_71285_c1 3300050511 Bacteria 3621
293 nmdc:mga0n895_39401_c1 3300050512 Bacteria 4584
294 nmdc:mga0rr50_129884_c1 3300050513 Bacteria 2016
295 nmdc:mga0rr50_165003_c1 3300050513 Bacteria 1800
296 nmdc:mga0rr50_57272_c1 3300050513 Bacteria 2915
297 nmdc:mga0a205_102522_c1 3300050515 Bacteria 2760
298 nmdc:mga0a205_12954_c1 3300050515 Bacteria 7739
299 nmdc:mga0a205_307006_c1 3300050515 Bacteria 1459
300 nmdc:mga0a205_42224_c1 3300050515 Bacteria 4393
301 Ga0501084_0031781 3300054114 Bacteria 4414
302 Ga0501084_0041219 3300054114 Bacteria 3862
303 Ga0590071_000083 3300059421 Bacteria 26037
304 Ga0590071_000265 3300059421 Bacteria 15234
305 Ga0590074_001012 3300059423 Bacteria 4419
306 Ga0590074_005642 3300059423 Bacteria 2076
307 Ga0590074_007657 3300059423 Bacteria 1795
308 Ga0590074_008879 3300059423 Bacteria 1673
309 Ga0590075_000112 3300059424 Bacteria 20941
310 Ga0590075_000234 3300059424 Bacteria 15531
311 Ga0590075_000916 3300059424 Bacteria 7684
312 Ga0590077_000247 3300059426 Bacteria 15383
313 Ga0590077_000414 3300059426 Bacteria 12002
314 Ga0590077_002014 3300059426 Bacteria 4466
315 Ga0501082_0008134 3300060353 Bacteria 9049
316 Ga0501082_0193342 3300060353 Bacteria 1770
317 Ga0530510_0007473 3300061734 Bacteria 7608
318 2515495688 2515154088 Bacteria 5526283
319 2515756311 2515154137 Bacteria 5711575
320 2516091038 2515154203 Bacteria 5458536
321 2556063568 2554235469 Bacteria 3590176
322 2644716945 2643221731 Bacteria 5623886
323 2644725766 2643221732 Bacteria 5756404
324 2712198426 2711768088 Bacteria 3195027
325 2793320294 2791355260 Bacteria 6598818
326 2819710390 2818991465 Bacteria 5388835
327 2842462431 2842454564 Bacteria 8730687
328 2842886832 2842882022 Bacteria 6158489
329 2857586029 2857581216 Bacteria 5522813
330 2857608942 2857604169 Bacteria 5111450
331 2904525722 2904524088 Bacteria 5887454
332 2919145683 2919143609 Bacteria 6219228
333 2919517624 2919517244 Bacteria 5858162
334 2919721998 2919720352 Bacteria 5986006
335 2928094238 2928093941 Bacteria 5965005
336 2929007220 2929004312 Bacteria 5678476
337 2960321024 2960319331 Bacteria 5502575
338 2960380136 2960375949 Bacteria 5361395
339 8022898745 8022893055 Bacteria 5300455
340 8022920655 8022914991 Bacteria 5584517
341 8022950606 8022948649 Bacteria 5366783
342 Ga0070661_100094663
343 JGI25406J46586_10000102
344 JGI25406J46586_10001270
345 rootH1_10041684
346 rootL2_10154213
347 Ga0006562J51391_1010506
348 Ga0065704_10107293
349 Ga0065712_10069327
350 Ga0065715_10090455
351 Ga0065715_10107492
352 Ga0065707_10013433
353 Ga0065707_10092434
354 Ga0070683_100000817
355 Ga0070683_100140610
356 Ga0070670_100003221
357 Ga0070670_100004878
358 Ga0068868_100103161
359 Ga0068868_100177623
360 Ga0070689_100151179
361 Ga0070689_100202583
362 Ga0070661_100019804
363 Ga0070668_100088812
364 Ga0070669_100000133
365 Ga0070669_100018314
366 Ga0070669_100095227
367 Ga0070671_100012705
368 Ga0070674_100001657
369 Ga0070674_100003721
370 Ga0070674_100099428
371 Ga0070673_100007783
372 Ga0070673_100102202
373 Ga0070714_100002687
374 Ga0070700_100027049
375 Ga0070663_100012727
376 Ga0070678_100059183
377 Ga0070678_100080039
378 Ga0070681_10218575
379 Ga0068867_100203181
380 Ga0070707_100212692
381 Ga0070698_100198918
382 Ga0070699_100031317
383 Ga0070679_100047837
384 Ga0070684_100000538
385 Ga0070697_100159674
386 Ga0070672_100009593
387 Ga0070686_100018833
388 Ga0070665_100190836
389 Ga0070664_100000055
390 Ga0070664_100050765
391 Ga0068857_100047006
392 Ga0068854_100201306
393 Ga0068852_100194231
394 Ga0068859_100079421
395 Ga0068859_100184206
396 Ga0068864_100266360
397 Ga0068861_100078011
398 Ga0068863_100345102
399 Ga0068858_100134340
400 Ga0068860_100179166
401 Ga0081539_10000056
402 Ga0081539_10000460
403 Ga0081539_10005019
404 Ga0081539_10024647
405 Ga0075363_100039007
406 Ga0075364_10021813
407 Ga0075366_10024554
408 Ga0075370_10005192
409 Ga0075428_100002058
410 Ga0075428_100003760
411 Ga0075428_100027456
412 Ga0075430_100002788
413 Ga0075430_100010719
414 Ga0075430_100052113
415 Ga0075431_100006847
416 Ga0075431_100007559
417 Ga0075431_100016286
418 Ga0075431_100027535
419 Ga0075431_100033052
420 Ga0075431_100034677
421 Ga0075431_100043795
422 Ga0075431_100106404
423 Ga0075433_10008360
424 Ga0075433_10024449
425 Ga0075433_10082340
426 Ga0075429_100085680
427 Ga0075429_100194023
428 Ga0097620_100079417
429 Ga0097620_100184203
430 Ga0075435_100012392
431 Ga0075435_100034993
432 Ga0111539_10000859
433 Ga0111539_10001246
434 Ga0111539_10003020
435 Ga0111539_10028859
436 Ga0111539_10050204
437 Ga0111539_10093806
438 Ga0111539_10241654
439 Ga0111539_10416804
440 Ga0105245_10070713
441 Ga0114129_10000802
442 Ga0114129_10004303
443 Ga0114129_10010905
444 Ga0114129_10044617
445 Ga0114129_10046303
446 Ga0114129_10049543
447 Ga0114129_10091747
448 Ga0114129_10110807
449 Ga0105243_10194275
450 Ga0105242_10015999
451 Ga0105242_10119832
452 Ga0105248_10031753
453 Ga0105248_10079318
454 Ga0105249_10009355
455 Ga0105249_10097948
456 Ga0105249_10101143
457 Ga0105249_10456874
458 Ga0105246_10166544
459 Ga0105246_10201518
460 Ga0157374_10019323
461 Ga0157372_10031496
462 Ga0157380_10016948
463 Ga0157380_10028629
464 Ga0157380_10054153
465 Ga0157379_10159165
466 Ga0157376_10039625
467 Ga0163161_10094249
468 Ga0209025_1002323
469 Ga0209025_1029420
470 Ga0207697_10002262
471 Ga0207697_10041877
472 Ga0207697_10068838
473 Ga0207696_1018090
474 Ga0207655_1011500
475 Ga0207688_10004743
476 Ga0207680_10156679
477 Ga0207707_10171676
478 Ga0207662_10001608
479 Ga0207649_10009593
480 Ga0207652_10109870
481 Ga0207681_10008219
482 Ga0207681_10076632
483 Ga0207681_10213736
484 Ga0207650_10008128
485 Ga0207650_10048843
486 Ga0207659_10208011
487 Ga0207670_10050467
488 Ga0207669_10003329
489 Ga0207669_10005286
490 Ga0207669_10063040
491 Ga0207704_10202853
492 Ga0207691_10005745
493 Ga0207691_10029885
494 Ga0207711_10103973
495 Ga0207711_10116957
496 Ga0207661_10001501
497 Ga0207661_10123947
498 Ga0207661_10203575
499 Ga0207679_10001458
500 Ga0207679_10036574
501 Ga0207667_10152025
502 Ga0207651_10005716
503 Ga0207712_10026518
504 Ga0207712_10033673
505 Ga0207677_10061262
506 Ga0207678_10041715
507 Ga0207708_10019159
508 Ga0207708_10071874
509 Ga0207648_10032316
510 Ga0207648_10071523
511 Ga0207676_10021946
512 Ga0207674_10028123
513 Ga0207675_100034588
514 Ga0207683_10048653
515 Ga0207683_10143898
516 Ga0207428_10001731
517 Ga0207428_10005503
518 Ga0207428_10019004
519 Ga0268265_10035948
520 Ga0307408_100002442
521 Ga0307408_100011481
522 Ga0307408_100054145
523 Ga0307405_10173064
524 Ga0307410_10183950
525 Ga0307410_10292689
526 Ga0307406_10012673
527 Ga0307406_10176366
528 Ga0307412_10062577
529 Ga0307409_100014897
530 Ga0307409_100085580
531 Ga0307416_100019660
532 Ga0307416_100209188
533 Ga0307414_10052853
534 Ga0307411_10011537
535 Ga0307415_100053039
536 Ga0307415_100135285
537 Ga0373951_0000043
538 Ga0373956_0029591
539 Ga0373957_0059642
540 Ga0373955_0015352
541 Ga0373947_0041206
542 Ga0373937_0000262
543 Ga0373925_0016046
544 Ga0451853_1533890
545 Ga0439433_0006848
546 Ga0450894_001530
547 Ga0439464_0000483
548 Ga0451577_0038512
549 Ga0466972_0011843
550 Ga0466965_0000801
551 Ga0466970_0002583
552 Ga0466957_0000207
553 Ga0466957_0007358
554 Ga0466960_0047577
555 Ga0451576_0078562
556 Ga0466967_0040145
557 Ga0495587_0025913
558 Ga0495621_0020020
559 Ga0496100_0024660
560 Ga0496101_0008265
561 Ga0496101_0030828
562 Ga0496103_0065466
563 Ga0496104_0001516
564 Ga0496104_0007340
565 Ga0496105_0034081
566 Ga0496105_0176847
567 Ga0496106_0010022
568 Ga0496106_0048417
569 Ga0496107_0040369
570 Ga0496108_0001282
571 Ga0496108_0065319
572 Ga0496108_0163712
573 Ga0496109_0000572
574 Ga0496110_0002234
575 Ga0496110_0071584
576 Ga0496110_0094875
577 Ga0496110_0101562
578 Ga0496111_0009139
579 Ga0496112_0000217
580 Ga0496112_0010508
581 Ga0496112_0037437
582 Ga0496112_0104704
583 Ga0496113_0093531
584 Ga0496113_0144575
585 Ga0496113_0172505
586 Ga0496119_0032548
587 Ga0501031_0096824
588 Ga0501034_0041777
589 Ga0501036_0274963
590 Ga0501041_0099930
591 Ga0501043_0162254
592 Ga0501048_0038586
593 Ga0501068_0025099
594 Ga0501071_0016536
595 Ga0501072_0016822
596 Ga0501072_0121017
597 Ga0501074_0112639
598 Ga0501075_0003086
599 Ga0501075_0020027
600 Ga0501076_0025823
601 Ga0501076_0061953
602 Ga0501076_0217375
603 Ga0501079_0177783
604 Ga0501081_0054701
605 Ga0501045_0037728
606 nmdc:mga00v17_1046_c1
607 nmdc:mga0yw44_65328_c1
608 nmdc:mga0k408_4707_c1
609 nmdc:mga06z11_8903_c1
610 nmdc:mga07m45_108728_c1
611 nmdc:mga05p37_107795_c1
612 nmdc:mga05p37_121933_c1
613 nmdc:mga05p37_17084_c1
614 nmdc:mga05p37_2848_c1
615 nmdc:mga05p37_53433_c1
616 nmdc:mga05p37_58873_c1
617 nmdc:mga05p37_8024_c1
618 nmdc:mga09592_182604_c1
619 nmdc:mga09592_2893_c1
620 nmdc:mga0qj67_19306_c1
621 nmdc:mga0qj67_25035_c1
622 nmdc:mga0qj67_70124_c1
623 nmdc:mga06r32_161168_c1
624 nmdc:mga06r32_2985_c1
625 nmdc:mga06r32_53418_c1
626 nmdc:mga06r32_75286_c1
627 nmdc:mga06r32_76858_c1
628 nmdc:mga06r32_85517_c1
629 nmdc:mga08y16_180383_c1
630 nmdc:mga08y16_2029_c1
631 nmdc:mga08y16_49212_c1
632 nmdc:mga08y16_6827_c1
633 nmdc:mga08y16_71285_c1
634 nmdc:mga0n895_39401_c1
635 nmdc:mga0rr50_129884_c1
636 nmdc:mga0rr50_165003_c1
637 nmdc:mga0rr50_57272_c1
638 nmdc:mga0a205_102522_c1
639 nmdc:mga0a205_12954_c1
640 nmdc:mga0a205_307006_c1
641 nmdc:mga0a205_42224_c1
642 Ga0501084_0031781
643 Ga0501084_0041219
644 Ga0590071_000083
645 Ga0590071_000265
646 Ga0590074_001012
647 Ga0590074_005642
648 Ga0590074_007657
649 Ga0590074_008879
650 Ga0590075_000112
651 Ga0590075_000234
652 Ga0590075_000916
653 Ga0590077_000247
654 Ga0590077_000414
655 Ga0590077_002014
656 Ga0501082_0008134
657 Ga0501082_0193342
658 Ga0530510_0007473
659 2515495688
660 2515756311
661 2516091038
662 2556063568
663 2644716945
664 2644725766
665 2712198426
666 2793320294
667 2819710390
668 2842462431
669 2842886832
670 2857586029
671 2857608942
672 2904525722
673 2919145683
674 2919517624
675 2919721998
676 2928094238
677 2929007220
678 2960321024
679 2960380136
680 8022898745
681 8022920655
682 8022950606

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

31

404

0.87

PF12897

Asp_aminotransf

Aspartate amino-transferase

92

418

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3av7-assembly1.cif.gz_A crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products 0.957 3 402
2z1y-assembly1.cif.gz_A crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27 0.9511 2 402
2zc0-assembly1.cif.gz_A crystal structure of an archaeal alanine:glyoxylate aminotransferase 0.9485 2 402
2zp7-assembly3.cif.gz_F crystal structure of lysn, alpha-aminoadipate aminotransferase (leucine complex), from thermus thermophilus hb27 0.9432 3 402
1wst-assembly1.cif.gz_A-2 crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus 0.9389 2 402
ID Description Score Start End Superfamily
3aovA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9585 68 295 3.40.640.10
3aovA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9502 68 295 3.40.640.10
2zc0A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9427 68 295 3.40.640.10
2dtvA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9415 68 293 3.40.640.10
1vp4B02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9411 68 294 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A7V3WKZ9-F1-model_v4 PLP-dependent aminotransferase family protein 0.9779 127 402 GO:0008483
GO:0009058
GO:0030170
GO:1901605
AF-A0A2V7UFZ6-F1-model_v4 Aminotransferase 0.976 1 403 GO:0008483
GO:0009058
GO:0030170
GO:1901605
AF-A0A7J9WHI1-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9746 15 402 GO:0008483
GO:0009058
GO:0030170
GO:1901605
AF-A0A1F9UR80-F1-model_v4 Aminotransferase class I/classII large domain-containing protein 0.9724 8 404 GO:0008483
GO:0009058
GO:0030170
GO:1901605
AF-A0A1V5J543-F1-model_v4 2-aminoadipate transaminase (EC 2.6.1.39) 0.9724 6 402 GO:0009058
GO:0030170
GO:0047536
GO:1901605

Map