F414366

General Info

Members Datasets Scaffolds Average Seq Length
340 213 680 317

Family's Representative Sequence

Representative Sequence 3300025926|Ga0207659_10074184|Ga0207659_100741842
Length 372
Sequence MNGDEGIRRLEIGARGKDNRVAARSRPARRKHRARQQEKWGQTPFLPLCWSVPSQHYHPVAYLARRGVAALGLIWLVLTLTFLLLQAAPGDAADLLVAPDATPEAAVQLRQELGLDRPLPQQYGRWLVNLLRGDLGESFRRREPVLGILTAALPVSLWLGSMSLLLTFVVGVAVGSLQAARKDRWIDRVLTGLTTAVYAAPSYWLSLTAVALFTYGLSKMGAPTWLRLPAFGLTSPASEATGLSVLPDLLRHSVLPIAVLTAVLDLARSEWVRTARAKGLGRSRVMFRHILANALPPLVVLLMLALPGVVAGSVFVESIFAWPGMGRVMLEAISARDYPVVMGATFFYAAIVVLSNAASDLLLHVVDPRRRV

Samples

Sample ID Description Type Environment
1 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
134 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
135 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
138 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
145 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
148 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
149 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
184 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
185 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
186 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
187 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
198 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
201 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
202 2643221734 Bosea sp. Root670 Isolate Unclassified
203 2643221736 Bosea sp. Root483D1 Isolate Unclassified
204 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
205 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
206 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
207 2841760612 Bosea sp. Tri-49 Isolate Nodule
208 2844104063 Bosea sp. Tri-39 Isolate Nodule
209 2851246043 Bosea sp. Tri-54 Isolate Nodule
210 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
211 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
212 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
213 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.59
Metatranscriptomes 0
Isolates 4.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.76
Nodule 1.18
Rhizoplane 5.29
Rhizosphere 86.18
Stem 0
Stem Tuber 0.59
Unclassified 16.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207659_10074184 3300025926 Unclassified 2493
2 rootH1_10048589 3300003316 Bacteria 1950
3 Ga0055526_1000084 3300003771 Bacteria 86813
4 Ga0065715_10132041 3300005293 Bacteria 1997
5 Ga0070683_100569835 3300005329 Bacteria 1083
6 Ga0070690_100099056 3300005330 Unclassified 1930
7 Ga0070670_100009670 3300005331 Bacteria 8230
8 Ga0068869_100105734 3300005334 Bacteria 2135
9 Ga0070666_10141139 3300005335 Unclassified 1678
10 Ga0070680_100011960 3300005336 Bacteria 6734
11 Ga0070680_100024382 3300005336 Bacteria 4832
12 Ga0070680_100100213 3300005336 Bacteria 2404
13 Ga0070691_10001913 3300005341 Bacteria 9134
14 Ga0070661_100184761 3300005344 Bacteria 1588
15 Ga0070692_10128088 3300005345 Bacteria 1424
16 Ga0070669_100029859 3300005353 Bacteria 3932
17 Ga0070675_100104017 3300005354 Unclassified 2394
18 Ga0070674_100002612 3300005356 Bacteria 9966
19 Ga0070659_100066437 3300005366 Bacteria 2857
20 Ga0070709_10004614 3300005434 Bacteria 7441
21 Ga0070705_100002149 3300005440 Bacteria 10020
22 Ga0070705_100170200 3300005440 Bacteria 1465
23 Ga0070700_100026591 3300005441 Bacteria 3419
24 Ga0070700_100066612 3300005441 Bacteria 2286
25 Ga0070694_100000139 3300005444 Bacteria 36599
26 Ga0070694_100014198 3300005444 Bacteria 4984
27 Ga0070694_100034453 3300005444 Bacteria 3339
28 Ga0070694_100147730 3300005444 Bacteria 1714
29 Ga0070694_100165926 3300005444 Bacteria 1624
30 Ga0070708_100001933 3300005445 Bacteria 15978
31 Ga0070708_100057187 3300005445 Bacteria 3471
32 Ga0070708_100294122 3300005445 Bacteria 1529
33 Ga0070663_100293071 3300005455 Unclassified 1300
34 Ga0070678_100005270 3300005456 Bacteria 7450
35 Ga0070662_100000040 3300005457 Bacteria 73497
36 Ga0070681_10029174 3300005458 Bacteria 5539
37 Ga0070681_10150431 3300005458 Bacteria 2254
38 Ga0068867_100000144 3300005459 Bacteria 45710
39 Ga0070706_100006105 3300005467 Bacteria 11393
40 Ga0070706_100100922 3300005467 Bacteria 2682
41 Ga0070707_100017848 3300005468 Bacteria 6672
42 Ga0070698_100001918 3300005471 Bacteria 23139
43 Ga0070698_100075752 3300005471 Unclassified 3369
44 Ga0070698_100125210 3300005471 Bacteria 2527
45 Ga0070699_100124244 3300005518 Unclassified 2271
46 Ga0070699_100172592 3300005518 Bacteria 1916
47 Ga0070679_100090654 3300005530 Bacteria 3045
48 Ga0070679_100151913 3300005530 Bacteria 2292
49 Ga0070679_100160316 3300005530 Bacteria 2224
50 Ga0070679_100255075 3300005530 Bacteria 1709
51 Ga0070684_100261614 3300005535 Bacteria 1583
52 Ga0070697_100003204 3300005536 Bacteria 12564
53 Ga0070697_100024628 3300005536 Bacteria 4793
54 Ga0070697_100097922 3300005536 Bacteria 2434
55 Ga0070697_100255821 3300005536 Unclassified 1498
56 Ga0068853_100017426 3300005539 Bacteria 5930
57 Ga0068853_100056697 3300005539 Bacteria 3380
58 Ga0068853_100396402 3300005539 Bacteria 1291
59 Ga0070672_100061800 3300005543 Bacteria 2954
60 Ga0070695_100000533 3300005545 Bacteria 20122
61 Ga0070695_100004425 3300005545 Bacteria 8246
62 Ga0070695_100025183 3300005545 Bacteria 3672
63 Ga0070696_100020123 3300005546 Bacteria 4525
64 Ga0070696_100021028 3300005546 Bacteria 4422
65 Ga0070693_100011301 3300005547 Bacteria 4495
66 Ga0070704_100041251 3300005549 Bacteria 3184
67 Ga0070704_100048770 3300005549 Bacteria 2966
68 Ga0070704_100067816 3300005549 Bacteria 2578
69 Ga0070704_100074120 3300005549 Bacteria 2482
70 Ga0070704_100094647 3300005549 Bacteria 2235
71 Ga0070704_100161103 3300005549 Bacteria 1774
72 Ga0070664_100011863 3300005564 Bacteria 7072
73 Ga0070664_100013240 3300005564 Bacteria 6719
74 Ga0070664_100016467 3300005564 Bacteria 6060
75 Ga0068854_100204606 3300005578 Bacteria 1554
76 Ga0068856_100005765 3300005614 Bacteria 12206
77 Ga0068859_100148888 3300005617 Unclassified 2416
78 Ga0068864_100119713 3300005618 Bacteria 2353
79 Ga0068866_10001337 3300005718 Bacteria 10656
80 Ga0068861_100101631 3300005719 Unclassified 2287
81 Ga0068858_100452239 3300005842 Unclassified 1238
82 Ga0068860_100024718 3300005843 Bacteria 5802
83 Ga0075369_10039202 3300006186 Bacteria 2023
84 Ga0075428_100035486 3300006844 Bacteria 5497
85 Ga0075428_100175769 3300006844 Unclassified 2319
86 Ga0075428_100281936 3300006844 Bacteria 1788
87 Ga0075430_100011887 3300006846 Bacteria 7410
88 Ga0075430_100030313 3300006846 Bacteria 4593
89 Ga0075431_100040251 3300006847 Bacteria 4816
90 Ga0075431_100067389 3300006847 Bacteria 3695
91 Ga0075431_100136553 3300006847 Unclassified 2528
92 Ga0075431_100237337 3300006847 Unclassified 1856
93 Ga0075433_10094090 3300006852 Bacteria 2652
94 Ga0075433_10216393 3300006852 Bacteria 1702
95 Ga0075434_100146528 3300006871 Bacteria 2381
96 Ga0075436_100017435 3300006914 Bacteria 4917
97 Ga0097620_100148893 3300006931 Unclassified 2416
98 Ga0099794_10005443 3300007265 Bacteria 5101
99 Ga0099794_10025551 3300007265 Unclassified 2722
100 Ga0105240_10063260 3300009093 Bacteria 4603
101 Ga0111539_10006498 3300009094 Bacteria 15061
102 Ga0111539_10052529 3300009094 Unclassified 4851
103 Ga0111539_10079358 3300009094 Bacteria 3861
104 Ga0111539_10106188 3300009094 Unclassified 3294
105 Ga0111539_10331130 3300009094 Bacteria 1772
106 Ga0105245_10063111 3300009098 Bacteria 3345
107 Ga0105247_10127780 3300009101 Unclassified 1654
108 Ga0114129_10028856 3300009147 Bacteria 7861
109 Ga0114129_10119073 3300009147 Bacteria 3637
110 Ga0114129_10296070 3300009147 Unclassified 2158
111 Ga0114129_11079331 3300009147 Bacteria 1006
112 Ga0105241_10010432 3300009174 Bacteria 6818
113 Ga0105242_10049671 3300009176 Bacteria 3414
114 Ga0105248_10001515 3300009177 Bacteria 25851
115 Ga0105238_10038296 3300009551 Bacteria 4869
116 Ga0105249_10073594 3300009553 Bacteria 3161
117 Ga0105239_10075164 3300010375 Bacteria 3714
118 Ga0105246_10163660 3300011119 Bacteria 1697
119 Ga0105246_10186571 3300011119 Bacteria 1602
120 Ga0157378_10053317 3300013297 Bacteria 3601
121 Ga0157375_10055281 3300013308 Bacteria 3914
122 Ga0157375_10115748 3300013308 Bacteria 2784
123 Ga0163163_10263916 3300014325 Unclassified 1773
124 Ga0163163_10573195 3300014325 Bacteria 1192
125 Ga0157380_10108409 3300014326 Bacteria 2328
126 Ga0213876_10065129 3300021384 Bacteria 1923
127 Ga0213871_10010407 3300021441 Bacteria 2109
128 Ga0209025_1022375 3300025294 Bacteria 3355
129 Ga0209564_1000017 3300025295 Bacteria 594063
130 Ga0207653_10000181 3300025885 Bacteria 44255
131 Ga0207653_10005564 3300025885 Bacteria 3933
132 Ga0207653_10033282 3300025885 Bacteria 1671
133 Ga0207682_10034831 3300025893 Unclassified 2032
134 Ga0207642_10017225 3300025899 Unclassified 2742
135 Ga0207710_10061816 3300025900 Unclassified 1700
136 Ga0207680_10130108 3300025903 Unclassified 1658
137 Ga0207645_10000321 3300025907 Bacteria 39983
138 Ga0207643_10050551 3300025908 Bacteria 2357
139 Ga0207684_10056006 3300025910 Bacteria 3345
140 Ga0207684_10072410 3300025910 Bacteria 2927
141 Ga0207684_10095858 3300025910 Bacteria 2532
142 Ga0207654_10008364 3300025911 Bacteria 5228
143 Ga0207707_10053125 3300025912 Bacteria 3527
144 Ga0207707_10055890 3300025912 Bacteria 3433
145 Ga0207660_10016019 3300025917 Bacteria 4956
146 Ga0207660_10032382 3300025917 Bacteria 3608
147 Ga0207649_10065019 3300025920 Bacteria 2308
148 Ga0207652_10018157 3300025921 Bacteria 5765
149 Ga0207652_10034284 3300025921 Bacteria 4277
150 Ga0207652_10089019 3300025921 Bacteria 2709
151 Ga0207646_10317965 3300025922 Unclassified 1407
152 Ga0207694_10120272 3300025924 Bacteria 2096
153 Ga0207650_10018877 3300025925 Bacteria 4845
154 Ga0207706_10000005 3300025933 Bacteria 224460
155 Ga0207686_10000138 3300025934 Bacteria 57684
156 Ga0207709_10016026 3300025935 Bacteria 4161
157 Ga0207704_10007810 3300025938 Bacteria 5076
158 Ga0207691_10121891 3300025940 Unclassified 2310
159 Ga0207691_10126850 3300025940 Bacteria 2257
160 Ga0207711_10001937 3300025941 Bacteria 18789
161 Ga0207689_10002089 3300025942 Bacteria 18836
162 Ga0207661_10288924 3300025944 Bacteria 1467
163 Ga0207679_10019915 3300025945 Bacteria 4519
164 Ga0207679_10425232 3300025945 Bacteria 1173
165 Ga0207712_10016184 3300025961 Bacteria 4823
166 Ga0207712_10125883 3300025961 Unclassified 1945
167 Ga0207640_10013172 3300025981 Bacteria 4732
168 Ga0207640_10119983 3300025981 Bacteria 1882
169 Ga0207703_10215266 3300026035 Unclassified 1715
170 Ga0207639_10087985 3300026041 Bacteria 2477
171 Ga0207639_10181549 3300026041 Unclassified 1790
172 Ga0207639_10412170 3300026041 Bacteria 1220
173 Ga0207708_10116410 3300026075 Unclassified 2079
174 Ga0207702_10005647 3300026078 Bacteria 10910
175 Ga0207648_10000021 3300026089 Bacteria 139257
176 Ga0207676_10014564 3300026095 Bacteria 5661
177 Ga0207676_10016637 3300026095 Bacteria 5327
178 Ga0207676_10322356 3300026095 Bacteria 1419
179 Ga0207675_100128513 3300026118 Unclassified 2402
180 Ga0207683_10040608 3300026121 Bacteria 4061
181 Ga0209974_10069754 3300027876 Bacteria 1197
182 Ga0268265_10239334 3300028380 Bacteria 1600
183 Ga0268264_10018776 3300028381 Bacteria 5653
184 Ga0307515_10091975 3300028794 Bacteria 3782
185 Ga0307408_100004540 3300031548 Bacteria 9404
186 Ga0307408_100056318 3300031548 Bacteria 2851
187 Ga0307408_100228682 3300031548 Bacteria 1522
188 Ga0265314_10021453 3300031711 Bacteria 4965
189 Ga0316576_10046468 3300031727 Bacteria 3143
190 Ga0316576_10071651 3300031727 Bacteria 2556
191 Ga0307405_10027895 3300031731 Unclassified 3281
192 Ga0307405_10035774 3300031731 Bacteria 2969
193 Ga0307405_10053488 3300031731 Bacteria 2516
194 Ga0307405_10143422 3300031731 Bacteria 1669
195 Ga0316577_10017301 3300031733 Bacteria 3979
196 Ga0316577_10061416 3300031733 Unclassified 2097
197 Ga0307413_10008948 3300031824 Bacteria 4761
198 Ga0307413_10077942 3300031824 Bacteria 2112
199 Ga0307413_10087016 3300031824 Bacteria 2022
200 Ga0307410_10001594 3300031852 Bacteria 10401
201 Ga0307410_10016527 3300031852 Bacteria 4404
202 Ga0307410_10161994 3300031852 Bacteria 1677
203 Ga0307406_10067130 3300031901 Bacteria 2337
204 Ga0307406_10234714 3300031901 Bacteria 1372
205 Ga0307407_10036719 3300031903 Bacteria 2702
206 Ga0307407_10057580 3300031903 Bacteria 2255
207 Ga0307407_10066016 3300031903 Bacteria 2133
208 Ga0307412_10003662 3300031911 Bacteria 8538
209 Ga0307409_100018705 3300031995 Bacteria 4668
210 Ga0307409_100021250 3300031995 Bacteria 4446
211 Ga0307409_100028732 3300031995 Bacteria 3968
212 Ga0307409_100033853 3300031995 Bacteria 3724
213 Ga0307409_100037565 3300031995 Bacteria 3571
214 Ga0307409_100079642 3300031995 Unclassified 2641
215 Ga0307409_100100257 3300031995 Bacteria 2400
216 Ga0307409_100288828 3300031995 Unclassified 1520
217 Ga0307416_100000223 3300032002 Bacteria 30013
218 Ga0307416_100012668 3300032002 Bacteria 5693
219 Ga0307416_100042200 3300032002 Bacteria 3559
220 Ga0307416_100063148 3300032002 Unclassified 3032
221 Ga0307416_100081417 3300032002 Bacteria 2737
222 Ga0307416_100088323 3300032002 Bacteria 2650
223 Ga0307416_100163889 3300032002 Bacteria 2059
224 Ga0307416_100375312 3300032002 Unclassified 1450
225 Ga0307414_10053725 3300032004 Unclassified 2811
226 Ga0307414_10197773 3300032004 Bacteria 1632
227 Ga0307411_10064864 3300032005 Bacteria 2447
228 Ga0307415_100000150 3300032126 Bacteria 30818
229 Ga0307415_100062054 3300032126 Bacteria 2590
230 Ga0307415_100226936 3300032126 Bacteria 1501
231 Ga0373929_0027423 3300035085 Unclassified 1197
232 Ga0373961_0069844 3300035241 Bacteria 1084
233 Ga0316574_0089371 3300035398 Bacteria 1962
234 Ga0373931_0098860 3300035691 Bacteria 1638
235 Ga0316582_0090874 3300036647 Bacteria 2009
236 Ga0316584_0056198 3300036712 Bacteria 2947
237 Ga0395899_0091205 3300037312 Bacteria 2208
238 Ga0395900_0031801 3300037418 Bacteria 5424
239 Ga0395905_0005194 3300037471 Bacteria 13341
240 Ga0436364_0859602 3300037853 Bacteria 2691
241 Ga0395901_0003022 3300038443 Bacteria 16958
242 Ga0400490_08088 3300038726 Unclassified 1165
243 Ga0400483_005860 3300039062 Unclassified 2546
244 Ga0400483_129278 3300039062 Bacteria 1298
245 Ga0400483_196845 3300039062 Unclassified 2212
246 Ga0436365_0529953 3300039437 Bacteria 10596
247 Ga0436360_0420163 3300039438 Bacteria 1848
248 Ga0436360_0945673 3300039438 Unclassified 2547
249 Ga0439455_0035510 3300042012 Unclassified 1258
250 Ga0439458_0048685 3300042157 Bacteria 1042
251 Ga0466969_0004567 3300044656 Bacteria 7373
252 Ga0453683_0036303 3300044673 Bacteria 3102
253 Ga0466966_0021300 3300044684 Bacteria 4257
254 Ga0466961_0000486 3300044693 Bacteria 25277
255 Ga0466970_0026704 3300044765 Bacteria 3026
256 Ga0466959_0010441 3300045049 Bacteria 6640
257 Ga0495603_0013286 3300046455 Bacteria 4978
258 Ga0495606_0002335 3300046507 Bacteria 22349
259 Ga0495643_0012546 3300046522 Bacteria 5108
260 Ga0495663_0010091 3300046525 Bacteria 2623
261 Ga0495672_0003579 3300047320 Bacteria 13214
262 Ga0495672_0130494 3300047320 Bacteria 1323
263 Ga0496102_0022063 3300048905 Bacteria 5639
264 Ga0496102_0161927 3300048905 Bacteria 2105
265 Ga0496104_0029195 3300048907 Bacteria 5115
266 Ga0496104_0150152 3300048907 Bacteria 2237
267 Ga0496106_0017115 3300048909 Bacteria 5366
268 Ga0496106_0048795 3300048909 Unclassified 3189
269 Ga0496108_0119307 3300048911 Bacteria 2261
270 Ga0496108_0480530 3300048911 Bacteria 1085
271 Ga0496109_0060559 3300048912 Bacteria 3459
272 Ga0496109_0116288 3300048912 Bacteria 2489
273 Ga0496109_0298512 3300048912 Bacteria 1519
274 Ga0496110_0162480 3300048913 Bacteria 2024
275 Ga0496110_0257768 3300048913 Bacteria 1587
276 Ga0496112_0000859 3300048915 Bacteria 21727
277 Ga0496113_0000560 3300048916 Bacteria 18482
278 Ga0496114_0239069 3300048917 Bacteria 1597
279 Ga0496117_0184024 3300048920 Bacteria 1197
280 Ga0496122_0051195 3300048925 Bacteria 3141
281 Ga0501033_0174640 3300049570 Bacteria 1542
282 Ga0501037_0028201 3300049573 Bacteria 4148
283 Ga0501037_0057679 3300049573 Bacteria 2834
284 Ga0501048_0098640 3300049582 Bacteria 2061
285 Ga0501068_0025899 3300049584 Bacteria 3452
286 Ga0501069_0031632 3300049585 Bacteria 2912
287 Ga0501069_0082319 3300049585 Bacteria 1814
288 Ga0501070_0132989 3300049586 Unclassified 2054
289 Ga0501072_0306367 3300049588 Unclassified 1263
290 Ga0501072_0373191 3300049588 Bacteria 1132
291 Ga0501247_004324 3300049677 Unclassified 1549
292 Ga0501080_0005065 3300049742 Bacteria 11737
293 Ga0501080_0412453 3300049742 Bacteria 1214
294 Ga0501081_0139195 3300049743 Bacteria 1739
295 Ga0501083_0160218 3300049744 Unclassified 1472
296 Ga0501263_006094 3300049760 Bacteria 1381
297 Ga0501268_002345 3300049765 Unclassified 2487
298 Ga0501270_016558 3300049767 Unclassified 1067
299 Ga0501272_007897 3300049769 Unclassified 1161
300 Ga0501273_010915 3300049770 Unclassified 1124
301 nmdc:mga05p37_249671_c1 3300050507 Unclassified 2129
302 nmdc:mga05p37_259811_c1 3300050507 Unclassified 2079
303 nmdc:mga05p37_628152_c1 3300050507 Bacteria 1207
304 nmdc:mga09592_84264_c1 3300050508 Bacteria 2710
305 nmdc:mga0qj67_200254_c1 3300050509 Bacteria 1622
306 nmdc:mga0qj67_34177_c1 3300050509 Bacteria 3970
307 nmdc:mga0qj67_89338_c1 3300050509 Bacteria 2474
308 nmdc:mga06r32_555240_c1 3300050510 Bacteria 1122
309 nmdc:mga08y16_114751_c1 3300050511 Bacteria 2804
310 nmdc:mga08y16_251825_c1 3300050511 Unclassified 1825
311 nmdc:mga08y16_269816_c1 3300050511 Bacteria 1757
312 nmdc:mga08y16_339276_c1 3300050511 Bacteria 1545
313 nmdc:mga08y16_3828_c1 3300050511 Bacteria 15653
314 nmdc:mga0n895_166243_c1 3300050512 Bacteria 2237
315 nmdc:mga0n895_470387_c1 3300050512 Bacteria 1268
316 nmdc:mga0n895_5167_c1 3300050512 Bacteria 10861
317 nmdc:mga0rr50_3319_c1 3300050513 Bacteria 9240
318 nmdc:mga0rr50_416873_c1 3300050513 Bacteria 1136
319 nmdc:mga08x19_40411_c1 3300050514 Bacteria 2968
320 nmdc:mga0a205_173840_c1 3300050515 Bacteria 2050
321 nmdc:mga0a205_243003_c1 3300050515 Bacteria 1681
322 nmdc:mga0a205_82038_c1 3300050515 Bacteria 3115
323 nmdc:mga0sz30_65794_c1 3300050516 Bacteria 1554
324 Ga0500636_0001188 3300053177 Bacteria 14069
325 Ga0501084_0156277 3300054114 Bacteria 1923
326 2538425324 2537561728 Bacteria 5149301
327 2599717804 2599185236 Bacteria 6875203
328 2644737619 2643221734 Bacteria 5365412
329 2644742693 2643221736 Bacteria 6608466
330 2687578810 2687453129 Bacteria 4387428
331 2805922611 2802429603 Bacteria 8777136
332 2837273000 2837268691 Bacteria 7850704
333 2841761209 2841760612 Bacteria 6454112
334 2844104234 2844104063 Bacteria 6440972
335 2851247222 2851246043 Bacteria 6439203
336 2855197140 2855195626 Bacteria 4927512
337 2871275834 2871272651 Bacteria 5042015
338 2899807456 2899803654 Bacteria 5577784
339 8045867396 8045864390 Bacteria 5043873
340 8045868059 8045864390 Bacteria 5043873
341 Ga0207659_10074184
342 rootH1_10048589
343 Ga0055526_1000084
344 Ga0065715_10132041
345 Ga0070683_100569835
346 Ga0070690_100099056
347 Ga0070670_100009670
348 Ga0068869_100105734
349 Ga0070666_10141139
350 Ga0070680_100011960
351 Ga0070680_100024382
352 Ga0070680_100100213
353 Ga0070691_10001913
354 Ga0070661_100184761
355 Ga0070692_10128088
356 Ga0070669_100029859
357 Ga0070675_100104017
358 Ga0070674_100002612
359 Ga0070659_100066437
360 Ga0070709_10004614
361 Ga0070705_100002149
362 Ga0070705_100170200
363 Ga0070700_100026591
364 Ga0070700_100066612
365 Ga0070694_100000139
366 Ga0070694_100014198
367 Ga0070694_100034453
368 Ga0070694_100147730
369 Ga0070694_100165926
370 Ga0070708_100001933
371 Ga0070708_100057187
372 Ga0070708_100294122
373 Ga0070663_100293071
374 Ga0070678_100005270
375 Ga0070662_100000040
376 Ga0070681_10029174
377 Ga0070681_10150431
378 Ga0068867_100000144
379 Ga0070706_100006105
380 Ga0070706_100100922
381 Ga0070707_100017848
382 Ga0070698_100001918
383 Ga0070698_100075752
384 Ga0070698_100125210
385 Ga0070699_100124244
386 Ga0070699_100172592
387 Ga0070679_100090654
388 Ga0070679_100151913
389 Ga0070679_100160316
390 Ga0070679_100255075
391 Ga0070684_100261614
392 Ga0070697_100003204
393 Ga0070697_100024628
394 Ga0070697_100097922
395 Ga0070697_100255821
396 Ga0068853_100017426
397 Ga0068853_100056697
398 Ga0068853_100396402
399 Ga0070672_100061800
400 Ga0070695_100000533
401 Ga0070695_100004425
402 Ga0070695_100025183
403 Ga0070696_100020123
404 Ga0070696_100021028
405 Ga0070693_100011301
406 Ga0070704_100041251
407 Ga0070704_100048770
408 Ga0070704_100067816
409 Ga0070704_100074120
410 Ga0070704_100094647
411 Ga0070704_100161103
412 Ga0070664_100011863
413 Ga0070664_100013240
414 Ga0070664_100016467
415 Ga0068854_100204606
416 Ga0068856_100005765
417 Ga0068859_100148888
418 Ga0068864_100119713
419 Ga0068866_10001337
420 Ga0068861_100101631
421 Ga0068858_100452239
422 Ga0068860_100024718
423 Ga0075369_10039202
424 Ga0075428_100035486
425 Ga0075428_100175769
426 Ga0075428_100281936
427 Ga0075430_100011887
428 Ga0075430_100030313
429 Ga0075431_100040251
430 Ga0075431_100067389
431 Ga0075431_100136553
432 Ga0075431_100237337
433 Ga0075433_10094090
434 Ga0075433_10216393
435 Ga0075434_100146528
436 Ga0075436_100017435
437 Ga0097620_100148893
438 Ga0099794_10005443
439 Ga0099794_10025551
440 Ga0105240_10063260
441 Ga0111539_10006498
442 Ga0111539_10052529
443 Ga0111539_10079358
444 Ga0111539_10106188
445 Ga0111539_10331130
446 Ga0105245_10063111
447 Ga0105247_10127780
448 Ga0114129_10028856
449 Ga0114129_10119073
450 Ga0114129_10296070
451 Ga0114129_11079331
452 Ga0105241_10010432
453 Ga0105242_10049671
454 Ga0105248_10001515
455 Ga0105238_10038296
456 Ga0105249_10073594
457 Ga0105239_10075164
458 Ga0105246_10163660
459 Ga0105246_10186571
460 Ga0157378_10053317
461 Ga0157375_10055281
462 Ga0157375_10115748
463 Ga0163163_10263916
464 Ga0163163_10573195
465 Ga0157380_10108409
466 Ga0213876_10065129
467 Ga0213871_10010407
468 Ga0209025_1022375
469 Ga0209564_1000017
470 Ga0207653_10000181
471 Ga0207653_10005564
472 Ga0207653_10033282
473 Ga0207682_10034831
474 Ga0207642_10017225
475 Ga0207710_10061816
476 Ga0207680_10130108
477 Ga0207645_10000321
478 Ga0207643_10050551
479 Ga0207684_10056006
480 Ga0207684_10072410
481 Ga0207684_10095858
482 Ga0207654_10008364
483 Ga0207707_10053125
484 Ga0207707_10055890
485 Ga0207660_10016019
486 Ga0207660_10032382
487 Ga0207649_10065019
488 Ga0207652_10018157
489 Ga0207652_10034284
490 Ga0207652_10089019
491 Ga0207646_10317965
492 Ga0207694_10120272
493 Ga0207650_10018877
494 Ga0207706_10000005
495 Ga0207686_10000138
496 Ga0207709_10016026
497 Ga0207704_10007810
498 Ga0207691_10121891
499 Ga0207691_10126850
500 Ga0207711_10001937
501 Ga0207689_10002089
502 Ga0207661_10288924
503 Ga0207679_10019915
504 Ga0207679_10425232
505 Ga0207712_10016184
506 Ga0207712_10125883
507 Ga0207640_10013172
508 Ga0207640_10119983
509 Ga0207703_10215266
510 Ga0207639_10087985
511 Ga0207639_10181549
512 Ga0207639_10412170
513 Ga0207708_10116410
514 Ga0207702_10005647
515 Ga0207648_10000021
516 Ga0207676_10014564
517 Ga0207676_10016637
518 Ga0207676_10322356
519 Ga0207675_100128513
520 Ga0207683_10040608
521 Ga0209974_10069754
522 Ga0268265_10239334
523 Ga0268264_10018776
524 Ga0307515_10091975
525 Ga0307408_100004540
526 Ga0307408_100056318
527 Ga0307408_100228682
528 Ga0265314_10021453
529 Ga0316576_10046468
530 Ga0316576_10071651
531 Ga0307405_10027895
532 Ga0307405_10035774
533 Ga0307405_10053488
534 Ga0307405_10143422
535 Ga0316577_10017301
536 Ga0316577_10061416
537 Ga0307413_10008948
538 Ga0307413_10077942
539 Ga0307413_10087016
540 Ga0307410_10001594
541 Ga0307410_10016527
542 Ga0307410_10161994
543 Ga0307406_10067130
544 Ga0307406_10234714
545 Ga0307407_10036719
546 Ga0307407_10057580
547 Ga0307407_10066016
548 Ga0307412_10003662
549 Ga0307409_100018705
550 Ga0307409_100021250
551 Ga0307409_100028732
552 Ga0307409_100033853
553 Ga0307409_100037565
554 Ga0307409_100079642
555 Ga0307409_100100257
556 Ga0307409_100288828
557 Ga0307416_100000223
558 Ga0307416_100012668
559 Ga0307416_100042200
560 Ga0307416_100063148
561 Ga0307416_100081417
562 Ga0307416_100088323
563 Ga0307416_100163889
564 Ga0307416_100375312
565 Ga0307414_10053725
566 Ga0307414_10197773
567 Ga0307411_10064864
568 Ga0307415_100000150
569 Ga0307415_100062054
570 Ga0307415_100226936
571 Ga0373929_0027423
572 Ga0373961_0069844
573 Ga0316574_0089371
574 Ga0373931_0098860
575 Ga0316582_0090874
576 Ga0316584_0056198
577 Ga0395899_0091205
578 Ga0395900_0031801
579 Ga0395905_0005194
580 Ga0436364_0859602
581 Ga0395901_0003022
582 Ga0400490_08088
583 Ga0400483_005860
584 Ga0400483_129278
585 Ga0400483_196845
586 Ga0436365_0529953
587 Ga0436360_0420163
588 Ga0436360_0945673
589 Ga0439455_0035510
590 Ga0439458_0048685
591 Ga0466969_0004567
592 Ga0453683_0036303
593 Ga0466966_0021300
594 Ga0466961_0000486
595 Ga0466970_0026704
596 Ga0466959_0010441
597 Ga0495603_0013286
598 Ga0495606_0002335
599 Ga0495643_0012546
600 Ga0495663_0010091
601 Ga0495672_0003579
602 Ga0495672_0130494
603 Ga0496102_0022063
604 Ga0496102_0161927
605 Ga0496104_0029195
606 Ga0496104_0150152
607 Ga0496106_0017115
608 Ga0496106_0048795
609 Ga0496108_0119307
610 Ga0496108_0480530
611 Ga0496109_0060559
612 Ga0496109_0116288
613 Ga0496109_0298512
614 Ga0496110_0162480
615 Ga0496110_0257768
616 Ga0496112_0000859
617 Ga0496113_0000560
618 Ga0496114_0239069
619 Ga0496117_0184024
620 Ga0496122_0051195
621 Ga0501033_0174640
622 Ga0501037_0028201
623 Ga0501037_0057679
624 Ga0501048_0098640
625 Ga0501068_0025899
626 Ga0501069_0031632
627 Ga0501069_0082319
628 Ga0501070_0132989
629 Ga0501072_0306367
630 Ga0501072_0373191
631 Ga0501247_004324
632 Ga0501080_0005065
633 Ga0501080_0412453
634 Ga0501081_0139195
635 Ga0501083_0160218
636 Ga0501263_006094
637 Ga0501268_002345
638 Ga0501270_016558
639 Ga0501272_007897
640 Ga0501273_010915
641 nmdc:mga05p37_249671_c1
642 nmdc:mga05p37_259811_c1
643 nmdc:mga05p37_628152_c1
644 nmdc:mga09592_84264_c1
645 nmdc:mga0qj67_200254_c1
646 nmdc:mga0qj67_34177_c1
647 nmdc:mga0qj67_89338_c1
648 nmdc:mga06r32_555240_c1
649 nmdc:mga08y16_114751_c1
650 nmdc:mga08y16_251825_c1
651 nmdc:mga08y16_269816_c1
652 nmdc:mga08y16_339276_c1
653 nmdc:mga08y16_3828_c1
654 nmdc:mga0n895_166243_c1
655 nmdc:mga0n895_470387_c1
656 nmdc:mga0n895_5167_c1
657 nmdc:mga0rr50_3319_c1
658 nmdc:mga0rr50_416873_c1
659 nmdc:mga08x19_40411_c1
660 nmdc:mga0a205_173840_c1
661 nmdc:mga0a205_243003_c1
662 nmdc:mga0a205_82038_c1
663 nmdc:mga0sz30_65794_c1
664 Ga0500636_0001188
665 Ga0501084_0156277
666 2538425324
667 2599717804
668 2644737619
669 2644742693
670 2687578810
671 2805922611
672 2837273000
673 2841761209
674 2844104234
675 2851247222
676 2855197140
677 2871275834
678 2899807456
679 8045867396
680 8045868059

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

171

372

0.93

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

60

160

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.8315 88 314
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.8169 97 310
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.7916 88 307
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7863 88 314
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7759 88 319
ID Description Score Start End Superfamily
af_Q2FZR7_83_297_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9456 85 309 1.10.3720.10
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9374 89 314 1.10.3720.10
af_P75798_87_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9374 88 314 1.10.3720.10
af_Q2FYQ5_85_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9354 83 316 1.10.3720.10
af_Q2FVE8_90_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9329 86 312 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A2V7QDB2-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9687 1 319 GO:0005886
GO:0071916
AF-A0A7V9GGE7-F1-model_v4 ABC transporter permease 0.9599 1 318 GO:0005886
GO:0055085
AF-A0A662ECP0-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.959 91 318 GO:0005886
GO:0015031
GO:0015833
GO:0055085
AF-A0A523N9B6-F1-model_v4 ABC transporter permease 0.9577 1 320 GO:0005886
GO:0055085
AF-A0A2N1VAV6-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.955 2 321 GO:0005886
GO:0055085

Map