F414256

General Info

Members Datasets Scaffolds Average Seq Length
340 179 680 106

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_102192224|Ga0070684_1021922241
Length 118
Sequence MTEKKPGVEHDNNLSDNNDSYVLRLFITGATPNSSRAIANLKEICETYLKGRYELEIIDVYQQPLIARNEQIIALPLLIKKAPFPERRLIGDMSDTAKVLRGLSLTAINKNGTGKHII

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
122 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
137 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
138 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
139 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
140 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
141 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
156 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
157 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
169 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
170 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
171 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
172 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
173 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
174 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
175 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
176 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
177 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
178 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
179 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.24
Metatranscriptomes 0.88
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.71
Nodule 0
Rhizoplane 2.06
Rhizosphere 88.24
Stem 0
Stem Tuber 0
Unclassified 16.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_102192224 3300005535 Bacteria 521
2 JGI24736J21556_1006041 3300001904 Bacteria 2044
3 JGI24739J22299_10008174 3300001989 Bacteria 3905
4 JGI24737J22298_10036127 3300001990 Bacteria 1527
5 JGI24737J22298_10189945 3300001990 Unclassified 606
6 JGI24743J22301_10029627 3300001991 Bacteria 1074
7 JGI24744J21845_10020034 3300002077 Bacteria 1321
8 rootH1_10040137 3300003316 Bacteria 15147
9 rootH2_10001274 3300003320 Bacteria 94480
10 rootH2_10017673 3300003320 Bacteria 4446
11 rootL2_10213854 3300003322 Bacteria 2162
12 rootH1_10098623 3300003323 Bacteria 7545
13 rootH1_10106895 3300003323 Bacteria 9003
14 rootH1_10171024 3300003323 Bacteria 4237
15 rootH1_10352756 3300003323 Bacteria 1290
16 Ga0065714_10367466 3300005288 Unclassified 619
17 Ga0070658_10500530 3300005327 Unclassified 1049
18 Ga0070658_11093231 3300005327 Bacteria 693
19 Ga0070676_10000236 3300005328 Bacteria 23731
20 Ga0070683_100442348 3300005329 Bacteria 1240
21 Ga0070690_100449464 3300005330 Bacteria 955
22 Ga0070670_100030330 3300005331 Bacteria 4656
23 Ga0070670_100122490 3300005331 Bacteria 2243
24 Ga0068869_100164573 3300005334 Bacteria 1729
25 Ga0068869_100634238 3300005334 Bacteria 906
26 Ga0070680_100036633 3300005336 Bacteria 3963
27 Ga0070680_100163928 3300005336 Bacteria 1868
28 Ga0070680_100303248 3300005336 Bacteria 1355
29 Ga0068868_100053551 3300005338 Bacteria 3179
30 Ga0068868_100539905 3300005338 Bacteria 1026
31 Ga0070660_100013445 3300005339 Bacteria 5872
32 Ga0070660_100387801 3300005339 Bacteria 1154
33 Ga0070689_101961438 3300005340 Bacteria 535
34 Ga0070668_101818738 3300005347 Unclassified 560
35 Ga0070675_100237295 3300005354 Bacteria 1592
36 Ga0070671_100004280 3300005355 Bacteria 11292
37 Ga0070671_100124362 3300005355 Unclassified 2171
38 Ga0070671_101631280 3300005355 Bacteria 572
39 Ga0070674_100496825 3300005356 Unclassified 1015
40 Ga0070674_100553818 3300005356 Bacteria 965
41 Ga0070673_100011409 3300005364 Bacteria 6062
42 Ga0070673_100022380 3300005364 Unclassified 4599
43 Ga0070688_100324510 3300005365 Unclassified 1120
44 Ga0070659_100017829 3300005366 Bacteria 5348
45 Ga0070659_101012972 3300005366 Unclassified 729
46 Ga0070663_100014530 3300005455 Bacteria 5057
47 Ga0070678_100005855 3300005456 Bacteria 7150
48 Ga0070662_100000070 3300005457 Bacteria 56207
49 Ga0070662_100138886 3300005457 Bacteria 1881
50 Ga0070681_10082279 3300005458 Bacteria 3174
51 Ga0070681_10368108 3300005458 Bacteria 1347
52 Ga0068867_100000822 3300005459 Bacteria 20916
53 Ga0070679_100169928 3300005530 Bacteria 2153
54 Ga0068853_100005728 3300005539 Bacteria 9780
55 Ga0068853_100075004 3300005539 Bacteria 2951
56 Ga0068853_100247836 3300005539 Bacteria 1634
57 Ga0068853_100269223 3300005539 Bacteria 1568
58 Ga0068853_100628314 3300005539 Bacteria 1021
59 Ga0068853_100841387 3300005539 Unclassified 880
60 Ga0068853_102357240 3300005539 Unclassified 515
61 Ga0070665_100000034 3300005548 Bacteria 324289
62 Ga0070665_100009493 3300005548 Bacteria 9839
63 Ga0068855_100000014 3300005563 Bacteria 232720
64 Ga0068855_100001781 3300005563 Bacteria 26916
65 Ga0068855_100043938 3300005563 Bacteria 5290
66 Ga0068855_100053818 3300005563 Bacteria 4734
67 Ga0068855_100134781 3300005563 Bacteria 2818
68 Ga0068855_100312556 3300005563 Bacteria 1738
69 Ga0068855_101165456 3300005563 Bacteria 803
70 Ga0068855_101780689 3300005563 Bacteria 626
71 Ga0068857_100042604 3300005577 Bacteria 4028
72 Ga0068857_100341925 3300005577 Bacteria 1384
73 Ga0068854_101026727 3300005578 Bacteria 731
74 Ga0068856_100099700 3300005614 Bacteria 2896
75 Ga0068856_100241026 3300005614 Bacteria 1823
76 Ga0068856_101991952 3300005614 Unclassified 591
77 Ga0068852_100002512 3300005616 Bacteria 12634
78 Ga0068852_100053906 3300005616 Bacteria 3464
79 Ga0068852_100457918 3300005616 Unclassified 1264
80 Ga0068859_102028465 3300005617 Bacteria 635
81 Ga0068864_100884174 3300005618 Unclassified 882
82 Ga0068864_102656469 3300005618 Bacteria 506
83 Ga0068866_10019593 3300005718 Bacteria 3084
84 Ga0068866_10079477 3300005718 Bacteria 1757
85 Ga0068851_10224601 3300005834 Bacteria 1056
86 Ga0068863_100498959 3300005841 Unclassified 1198
87 Ga0068858_100583943 3300005842 Bacteria 1083
88 Ga0068858_100681029 3300005842 Bacteria 1000
89 Ga0075369_10311273 3300006186 Bacteria 736
90 Ga0075366_10015381 3300006195 Bacteria 4384
91 Ga0097621_100000176 3300006237 Bacteria 40560
92 Ga0068871_100000540 3300006358 Bacteria 25800
93 Ga0068865_100001150 3300006881 Bacteria 15354
94 Ga0097620_102028586 3300006931 Bacteria 635
95 Ga0105240_10003999 3300009093 Bacteria 22716
96 Ga0105240_10058316 3300009093 Bacteria 4820
97 Ga0105240_10060343 3300009093 Bacteria 4728
98 Ga0105240_10164696 3300009093 Bacteria 2630
99 Ga0105240_10315075 3300009093 Bacteria 1785
100 Ga0105240_10404614 3300009093 Bacteria 1537
101 Ga0105240_10655865 3300009093 Bacteria 1150
102 Ga0105240_10742799 3300009093 Unclassified 1067
103 Ga0105245_11940476 3300009098 Bacteria 642
104 Ga0105243_10048511 3300009148 Unclassified 3347
105 Ga0105241_10000298 3300009174 Bacteria 37127
106 Ga0105241_10005897 3300009174 Bacteria 9039
107 Ga0105241_10027163 3300009174 Bacteria 4261
108 Ga0105241_10253081 3300009174 Unclassified 1494
109 Ga0105242_10026616 3300009176 Bacteria 4584
110 Ga0105237_10000072 3300009545 Bacteria 135507
111 Ga0105237_10004040 3300009545 Bacteria 17137
112 Ga0105237_10007635 3300009545 Bacteria 11816
113 Ga0105237_10009211 3300009545 Bacteria 10598
114 Ga0105238_10025160 3300009551 Bacteria 6067
115 Ga0105238_10077567 3300009551 Bacteria 3313
116 Ga0105238_10125512 3300009551 Unclassified 2545
117 Ga0105238_10156044 3300009551 Bacteria 2258
118 Ga0105238_10806585 3300009551 Unclassified 954
119 Ga0105238_11902324 3300009551 Bacteria 628
120 Ga0105238_12284199 3300009551 Bacteria 576
121 Ga0105239_10002221 3300010375 Bacteria 24920
122 Ga0105239_10008312 3300010375 Bacteria 11828
123 Ga0105239_10084723 3300010375 Bacteria 3492
124 Ga0105239_10177381 3300010375 Bacteria 2383
125 Ga0105239_10684335 3300010375 Bacteria 1172
126 Ga0157373_10007859 3300013100 Bacteria 7934
127 Ga0157373_10040573 3300013100 Unclassified 3330
128 Ga0157373_10126560 3300013100 Bacteria 1797
129 Ga0157371_10071558 3300013102 Bacteria 2455
130 Ga0157371_10074031 3300013102 Bacteria 2412
131 Ga0157371_10082428 3300013102 Bacteria 2277
132 Ga0157371_10287467 3300013102 Bacteria 1189
133 Ga0157371_10565203 3300013102 Bacteria 844
134 Ga0157370_10233470 3300013104 Bacteria 1702
135 Ga0157370_11503574 3300013104 Unclassified 605
136 Ga0157370_11603215 3300013104 Unclassified 585
137 Ga0157370_12011316 3300013104 Bacteria 518
138 Ga0157369_10054754 3300013105 Bacteria 4307
139 Ga0157369_10417327 3300013105 Bacteria 1391
140 Ga0157374_10000051 3300013296 Bacteria 126876
141 Ga0157374_10000205 3300013296 Bacteria 54329
142 Ga0157374_10365059 3300013296 Bacteria 1436
143 Ga0157374_10636371 3300013296 Bacteria 1078
144 Ga0157378_10017705 3300013297 Bacteria 6255
145 Ga0157378_10046465 3300013297 Bacteria 3859
146 Ga0157378_10845838 3300013297 Bacteria 943
147 Ga0163162_10000018 3300013306 Bacteria 226257
148 Ga0163162_10001999 3300013306 Bacteria 19184
149 Ga0163162_10004098 3300013306 Bacteria 13988
150 Ga0157372_10036200 3300013307 Bacteria 5439
151 Ga0157372_10046863 3300013307 Bacteria 4800
152 Ga0157372_10194466 3300013307 Bacteria 2350
153 Ga0157372_10376905 3300013307 Unclassified 1653
154 Ga0157372_10601191 3300013307 Bacteria 1282
155 Ga0157372_13400524 3300013307 Unclassified 506
156 Ga0157375_10003173 3300013308 Bacteria 14280
157 Ga0157375_10018707 3300013308 Bacteria 6287
158 Ga0157375_11332366 3300013308 Bacteria 845
159 Ga0157375_11974324 3300013308 Bacteria 693
160 Ga0163163_10504635 3300014325 Bacteria 1271
161 Ga0163163_11037570 3300014325 Bacteria 883
162 Ga0157377_10008850 3300014745 Bacteria 4924
163 Ga0157377_11070680 3300014745 Unclassified 616
164 Ga0157376_10146766 3300014969 Bacteria 2123
165 Ga0157376_10924037 3300014969 Bacteria 892
166 Ga0163161_10855358 3300017792 Unclassified 768
167 Ga0206352_11341345 3300020078 Bacteria 1456
168 Ga0206350_11640069 3300020080 Bacteria 622
169 Ga0213872_10038053 3300021361 Bacteria 2196
170 Ga0224712_10127943 3300022467 Bacteria 1106
171 Ga0209026_1017529 3300025250 Bacteria 1143
172 Ga0207656_10161008 3300025321 Unclassified 1068
173 Ga0207642_10121841 3300025899 Bacteria 1347
174 Ga0207647_10000265 3300025904 Bacteria 43071
175 Ga0207647_10008370 3300025904 Bacteria 7420
176 Ga0207645_10000056 3300025907 Bacteria 80880
177 Ga0207645_10047623 3300025907 Unclassified 2737
178 Ga0207705_10053387 3300025909 Bacteria 2911
179 Ga0207705_10707154 3300025909 Unclassified 783
180 Ga0207654_10004243 3300025911 Bacteria 7229
181 Ga0207654_10014521 3300025911 Bacteria 4069
182 Ga0207654_10270289 3300025911 Unclassified 1146
183 Ga0207654_10861967 3300025911 Bacteria 656
184 Ga0207707_10056369 3300025912 Bacteria 3419
185 Ga0207707_10294719 3300025912 Bacteria 1403
186 Ga0207695_10000048 3300025913 Bacteria 421800
187 Ga0207695_10013959 3300025913 Bacteria 9545
188 Ga0207695_10040328 3300025913 Bacteria 5008
189 Ga0207695_10053623 3300025913 Bacteria 4216
190 Ga0207695_10713500 3300025913 Unclassified 883
191 Ga0207695_10858254 3300025913 Unclassified 788
192 Ga0207695_10996283 3300025913 Unclassified 718
193 Ga0207695_11144646 3300025913 Unclassified 658
194 Ga0207671_10000300 3300025914 Bacteria 73008
195 Ga0207671_10006302 3300025914 Bacteria 10598
196 Ga0207671_10019213 3300025914 Bacteria 5230
197 Ga0207671_10038907 3300025914 Bacteria 3524
198 Ga0207660_10380844 3300025917 Bacteria 1134
199 Ga0207660_10500049 3300025917 Unclassified 986
200 Ga0207657_10009552 3300025919 Bacteria 9737
201 Ga0207657_10361169 3300025919 Bacteria 1145
202 Ga0207657_10554117 3300025919 Bacteria 899
203 Ga0207652_10044903 3300025921 Bacteria 3766
204 Ga0207652_10110320 3300025921 Bacteria 2439
205 Ga0207694_10018502 3300025924 Bacteria 5265
206 Ga0207694_11027471 3300025924 Bacteria 697
207 Ga0207650_10039524 3300025925 Bacteria 3448
208 Ga0207650_10147849 3300025925 Bacteria 1852
209 Ga0207650_11233503 3300025925 Bacteria 637
210 Ga0207659_10434813 3300025926 Bacteria 1103
211 Ga0207687_11227821 3300025927 Bacteria 644
212 Ga0207644_10045293 3300025931 Bacteria 3129
213 Ga0207690_10221305 3300025932 Bacteria 1448
214 Ga0207690_10508607 3300025932 Unclassified 975
215 Ga0207706_10000221 3300025933 Bacteria 62295
216 Ga0207706_10250001 3300025933 Bacteria 1549
217 Ga0207686_10006572 3300025934 Bacteria 6261
218 Ga0207709_10378563 3300025935 Bacteria 1076
219 Ga0207669_10508283 3300025937 Bacteria 965
220 Ga0207704_10000035 3300025938 Bacteria 96154
221 Ga0207665_11153933 3300025939 Bacteria 618
222 Ga0207689_10205671 3300025942 Bacteria 1626
223 Ga0207667_10000049 3300025949 Bacteria 235027
224 Ga0207667_10001809 3300025949 Bacteria 26928
225 Ga0207667_10010171 3300025949 Bacteria 11019
226 Ga0207667_10038141 3300025949 Bacteria 5133
227 Ga0207667_10256156 3300025949 Bacteria 1790
228 Ga0207667_11416844 3300025949 Unclassified 668
229 Ga0207651_10018859 3300025960 Bacteria 4118
230 Ga0207677_10004875 3300026023 Bacteria 7241
231 Ga0207677_10036233 3300026023 Bacteria 3213
232 Ga0207677_11412941 3300026023 Unclassified 641
233 Ga0207703_10568851 3300026035 Bacteria 1070
234 Ga0207703_10758829 3300026035 Bacteria 925
235 Ga0207639_10015877 3300026041 Bacteria 5318
236 Ga0207639_10260101 3300026041 Bacteria 1517
237 Ga0207639_10366888 3300026041 Bacteria 1290
238 Ga0207678_10023664 3300026067 Bacteria 5371
239 Ga0207678_11665346 3300026067 Bacteria 561
240 Ga0207702_10000361 3300026078 Bacteria 51967
241 Ga0207702_10345951 3300026078 Unclassified 1421
242 Ga0207702_11871196 3300026078 Unclassified 592
243 Ga0207641_10051024 3300026088 Unclassified 3502
244 Ga0207648_10020120 3300026089 Bacteria 6017
245 Ga0207648_10112466 3300026089 Unclassified 2391
246 Ga0207676_11638780 3300026095 Unclassified 641
247 Ga0207676_12296844 3300026095 Bacteria 537
248 Ga0207674_10143438 3300026116 Bacteria 2347
249 Ga0207674_10192923 3300026116 Bacteria 1987
250 Ga0207683_10012831 3300026121 Bacteria 7152
251 Ga0207698_10004426 3300026142 Bacteria 8560
252 Ga0207698_10030507 3300026142 Bacteria 3878
253 Ga0207698_10423083 3300026142 Bacteria 1279
254 Ga0207698_11064818 3300026142 Viruses 821
255 Ga0268266_10000119 3300028379 Bacteria 162424
256 Ga0268266_10004680 3300028379 Bacteria 13031
257 Ga0268265_12176319 3300028380 Unclassified 562
258 Ga0268264_10533806 3300028381 Bacteria 1149
259 Ga0307517_10003207 3300028786 Bacteria 25691
260 Ga0316177_1123455 3300030731 Bacteria 559
261 Ga0307513_10802990 3300031456 Bacteria 647
262 Ga0307509_10596370 3300031507 Bacteria 777
263 Ga0307408_101166165 3300031548 Unclassified 717
264 Ga0307405_10064756 3300031731 Bacteria 2324
265 Ga0307412_10101193 3300031911 Bacteria 2038
266 Ga0307414_10878166 3300032004 Bacteria 821
267 Ga0307414_11510842 3300032004 Bacteria 625
268 Ga0307510_10006599 3300033180 Bacteria 13843
269 Ga0395899_0000462 3300037312 Bacteria 46052
270 Ga0395899_0018622 3300037312 Bacteria 5276
271 Ga0395899_0037390 3300037312 Bacteria 3638
272 Ga0395900_0000141 3300037418 Bacteria 121159
273 Ga0395900_0078652 3300037418 Bacteria 3388
274 Ga0395900_0079313 3300037418 Bacteria 3373
275 Ga0395900_0307069 3300037418 Bacteria 1571
276 Ga0395900_0616996 3300037418 Bacteria 1024
277 Ga0395898_0005005 3300037466 Bacteria 14379
278 Ga0395898_0085858 3300037466 Unclassified 3033
279 Ga0395898_0151985 3300037466 Bacteria 2214
280 Ga0395905_0000124 3300037471 Bacteria 126707
281 Ga0395905_0990802 3300037471 Bacteria 743
282 Ga0395901_0000138 3300038443 Bacteria 94944
283 Ga0395901_0057434 3300038443 Bacteria 4047
284 Ga0395901_0254394 3300038443 Bacteria 1829
285 Ga0436361_0613516 3300039447 Bacteria 8149
286 Ga0451789_0918748 3300041443 Unclassified 879
287 Ga0451791_0720445 3300041451 Bacteria 712
288 Ga0451795_0041810 3300041456 Bacteria 961
289 Ga0451798_0607406 3300041458 Unclassified 647
290 Ga0451807_1514918 3300041486 Unclassified 795
291 Ga0451841_0398647 3300041498 Unclassified 586
292 Ga0451853_1140549 3300041512 Bacteria 581
293 Ga0495592_0611488 3300046454 Bacteria 664
294 Ga0495592_0848565 3300046454 Bacteria 540
295 Ga0495638_0050647 3300046460 Bacteria 2593
296 Ga0495583_0018634 3300046506 Bacteria 3650
297 Ga0495606_0465919 3300046507 Bacteria 644
298 Ga0495616_0009352 3300046513 Bacteria 5744
299 Ga0495628_0915695 3300046516 Unclassified 608
300 Ga0495632_0268304 3300046519 Bacteria 762
301 Ga0495652_0101699 3300046529 Bacteria 2329
302 Ga0495652_0528367 3300046529 Bacteria 814
303 Ga0495625_0000159 3300046660 Bacteria 104355
304 Ga0495625_0444139 3300046660 Unclassified 802
305 Ga0495661_0002045 3300046665 Bacteria 15866
306 Ga0495649_0000003 3300046694 Bacteria 880817
307 Ga0495649_0128479 3300046694 Bacteria 1338
308 Ga0495672_0058387 3300047320 Unclassified 2237
309 Ga0495683_0141271 3300047323 Bacteria 1128
310 Ga0495687_013417 3300047443 Bacteria 4279
311 Ga0495679_045398 3300047446 Bacteria 1342
312 Ga0495686_0024703 3300047472 Bacteria 3945
313 Ga0495686_0155089 3300047472 Bacteria 1342
314 Ga0496115_0247925 3300048918 Bacteria 1467
315 Ga0495682_0276570 3300049460 Unclassified 593
316 Ga0501034_0116443 3300049571 Bacteria 2661
317 Ga0501034_0262616 3300049571 Bacteria 1669
318 Ga0501070_0238396 3300049586 Bacteria 1489
319 Ga0501070_1365171 3300049586 Bacteria 539
320 Ga0501071_1185903 3300049587 Bacteria 590
321 Ga0501223_000294 3300049663 Bacteria 12597
322 Ga0501035_0712953 3300049822 Bacteria 808
323 Ga0501044_0083671 3300049823 Bacteria 3227
324 nmdc:mga0k408_1790_c1 3300050493 Bacteria 11512
325 nmdc:mga0k408_247404_c1 3300050493 Unclassified 1065
326 nmdc:mga0k408_6828_c1 3300050493 Bacteria 6086
327 Ga0500635_0006186 3300053080 Bacteria 3186
328 Ga0500578_0097961 3300053086 Bacteria 1858
329 Ga0500646_0013980 3300053090 Bacteria 2081
330 Ga0500651_0167217 3300053093 Bacteria 1313
331 Ga0500608_004909 3300053122 Bacteria 5239
332 Ga0500658_0398391 3300053134 Unclassified 630
333 Ga0500604_0076616 3300053151 Bacteria 1075
334 Ga0500622_0000932 3300053156 Bacteria 24881
335 Ga0500622_0027542 3300053156 Bacteria 2996
336 Ga0500622_0207629 3300053156 Bacteria 886
337 Ga0500611_000098 3300053727 Bacteria 23666
338 2599478047 2599185184 Bacteria 6430550
339 2740033180 2739367866 Bacteria 4215900
340 2928147535 2928147474 Bacteria 6512076
341 Ga0070684_102192224
342 JGI24736J21556_1006041
343 JGI24739J22299_10008174
344 JGI24737J22298_10036127
345 JGI24737J22298_10189945
346 JGI24743J22301_10029627
347 JGI24744J21845_10020034
348 rootH1_10040137
349 rootH2_10001274
350 rootH2_10017673
351 rootL2_10213854
352 rootH1_10098623
353 rootH1_10106895
354 rootH1_10171024
355 rootH1_10352756
356 Ga0065714_10367466
357 Ga0070658_10500530
358 Ga0070658_11093231
359 Ga0070676_10000236
360 Ga0070683_100442348
361 Ga0070690_100449464
362 Ga0070670_100030330
363 Ga0070670_100122490
364 Ga0068869_100164573
365 Ga0068869_100634238
366 Ga0070680_100036633
367 Ga0070680_100163928
368 Ga0070680_100303248
369 Ga0068868_100053551
370 Ga0068868_100539905
371 Ga0070660_100013445
372 Ga0070660_100387801
373 Ga0070689_101961438
374 Ga0070668_101818738
375 Ga0070675_100237295
376 Ga0070671_100004280
377 Ga0070671_100124362
378 Ga0070671_101631280
379 Ga0070674_100496825
380 Ga0070674_100553818
381 Ga0070673_100011409
382 Ga0070673_100022380
383 Ga0070688_100324510
384 Ga0070659_100017829
385 Ga0070659_101012972
386 Ga0070663_100014530
387 Ga0070678_100005855
388 Ga0070662_100000070
389 Ga0070662_100138886
390 Ga0070681_10082279
391 Ga0070681_10368108
392 Ga0068867_100000822
393 Ga0070679_100169928
394 Ga0068853_100005728
395 Ga0068853_100075004
396 Ga0068853_100247836
397 Ga0068853_100269223
398 Ga0068853_100628314
399 Ga0068853_100841387
400 Ga0068853_102357240
401 Ga0070665_100000034
402 Ga0070665_100009493
403 Ga0068855_100000014
404 Ga0068855_100001781
405 Ga0068855_100043938
406 Ga0068855_100053818
407 Ga0068855_100134781
408 Ga0068855_100312556
409 Ga0068855_101165456
410 Ga0068855_101780689
411 Ga0068857_100042604
412 Ga0068857_100341925
413 Ga0068854_101026727
414 Ga0068856_100099700
415 Ga0068856_100241026
416 Ga0068856_101991952
417 Ga0068852_100002512
418 Ga0068852_100053906
419 Ga0068852_100457918
420 Ga0068859_102028465
421 Ga0068864_100884174
422 Ga0068864_102656469
423 Ga0068866_10019593
424 Ga0068866_10079477
425 Ga0068851_10224601
426 Ga0068863_100498959
427 Ga0068858_100583943
428 Ga0068858_100681029
429 Ga0075369_10311273
430 Ga0075366_10015381
431 Ga0097621_100000176
432 Ga0068871_100000540
433 Ga0068865_100001150
434 Ga0097620_102028586
435 Ga0105240_10003999
436 Ga0105240_10058316
437 Ga0105240_10060343
438 Ga0105240_10164696
439 Ga0105240_10315075
440 Ga0105240_10404614
441 Ga0105240_10655865
442 Ga0105240_10742799
443 Ga0105245_11940476
444 Ga0105243_10048511
445 Ga0105241_10000298
446 Ga0105241_10005897
447 Ga0105241_10027163
448 Ga0105241_10253081
449 Ga0105242_10026616
450 Ga0105237_10000072
451 Ga0105237_10004040
452 Ga0105237_10007635
453 Ga0105237_10009211
454 Ga0105238_10025160
455 Ga0105238_10077567
456 Ga0105238_10125512
457 Ga0105238_10156044
458 Ga0105238_10806585
459 Ga0105238_11902324
460 Ga0105238_12284199
461 Ga0105239_10002221
462 Ga0105239_10008312
463 Ga0105239_10084723
464 Ga0105239_10177381
465 Ga0105239_10684335
466 Ga0157373_10007859
467 Ga0157373_10040573
468 Ga0157373_10126560
469 Ga0157371_10071558
470 Ga0157371_10074031
471 Ga0157371_10082428
472 Ga0157371_10287467
473 Ga0157371_10565203
474 Ga0157370_10233470
475 Ga0157370_11503574
476 Ga0157370_11603215
477 Ga0157370_12011316
478 Ga0157369_10054754
479 Ga0157369_10417327
480 Ga0157374_10000051
481 Ga0157374_10000205
482 Ga0157374_10365059
483 Ga0157374_10636371
484 Ga0157378_10017705
485 Ga0157378_10046465
486 Ga0157378_10845838
487 Ga0163162_10000018
488 Ga0163162_10001999
489 Ga0163162_10004098
490 Ga0157372_10036200
491 Ga0157372_10046863
492 Ga0157372_10194466
493 Ga0157372_10376905
494 Ga0157372_10601191
495 Ga0157372_13400524
496 Ga0157375_10003173
497 Ga0157375_10018707
498 Ga0157375_11332366
499 Ga0157375_11974324
500 Ga0163163_10504635
501 Ga0163163_11037570
502 Ga0157377_10008850
503 Ga0157377_11070680
504 Ga0157376_10146766
505 Ga0157376_10924037
506 Ga0163161_10855358
507 Ga0206352_11341345
508 Ga0206350_11640069
509 Ga0213872_10038053
510 Ga0224712_10127943
511 Ga0209026_1017529
512 Ga0207656_10161008
513 Ga0207642_10121841
514 Ga0207647_10000265
515 Ga0207647_10008370
516 Ga0207645_10000056
517 Ga0207645_10047623
518 Ga0207705_10053387
519 Ga0207705_10707154
520 Ga0207654_10004243
521 Ga0207654_10014521
522 Ga0207654_10270289
523 Ga0207654_10861967
524 Ga0207707_10056369
525 Ga0207707_10294719
526 Ga0207695_10000048
527 Ga0207695_10013959
528 Ga0207695_10040328
529 Ga0207695_10053623
530 Ga0207695_10713500
531 Ga0207695_10858254
532 Ga0207695_10996283
533 Ga0207695_11144646
534 Ga0207671_10000300
535 Ga0207671_10006302
536 Ga0207671_10019213
537 Ga0207671_10038907
538 Ga0207660_10380844
539 Ga0207660_10500049
540 Ga0207657_10009552
541 Ga0207657_10361169
542 Ga0207657_10554117
543 Ga0207652_10044903
544 Ga0207652_10110320
545 Ga0207694_10018502
546 Ga0207694_11027471
547 Ga0207650_10039524
548 Ga0207650_10147849
549 Ga0207650_11233503
550 Ga0207659_10434813
551 Ga0207687_11227821
552 Ga0207644_10045293
553 Ga0207690_10221305
554 Ga0207690_10508607
555 Ga0207706_10000221
556 Ga0207706_10250001
557 Ga0207686_10006572
558 Ga0207709_10378563
559 Ga0207669_10508283
560 Ga0207704_10000035
561 Ga0207665_11153933
562 Ga0207689_10205671
563 Ga0207667_10000049
564 Ga0207667_10001809
565 Ga0207667_10010171
566 Ga0207667_10038141
567 Ga0207667_10256156
568 Ga0207667_11416844
569 Ga0207651_10018859
570 Ga0207677_10004875
571 Ga0207677_10036233
572 Ga0207677_11412941
573 Ga0207703_10568851
574 Ga0207703_10758829
575 Ga0207639_10015877
576 Ga0207639_10260101
577 Ga0207639_10366888
578 Ga0207678_10023664
579 Ga0207678_11665346
580 Ga0207702_10000361
581 Ga0207702_10345951
582 Ga0207702_11871196
583 Ga0207641_10051024
584 Ga0207648_10020120
585 Ga0207648_10112466
586 Ga0207676_11638780
587 Ga0207676_12296844
588 Ga0207674_10143438
589 Ga0207674_10192923
590 Ga0207683_10012831
591 Ga0207698_10004426
592 Ga0207698_10030507
593 Ga0207698_10423083
594 Ga0207698_11064818
595 Ga0268266_10000119
596 Ga0268266_10004680
597 Ga0268265_12176319
598 Ga0268264_10533806
599 Ga0307517_10003207
600 Ga0316177_1123455
601 Ga0307513_10802990
602 Ga0307509_10596370
603 Ga0307408_101166165
604 Ga0307405_10064756
605 Ga0307412_10101193
606 Ga0307414_10878166
607 Ga0307414_11510842
608 Ga0307510_10006599
609 Ga0395899_0000462
610 Ga0395899_0018622
611 Ga0395899_0037390
612 Ga0395900_0000141
613 Ga0395900_0078652
614 Ga0395900_0079313
615 Ga0395900_0307069
616 Ga0395900_0616996
617 Ga0395898_0005005
618 Ga0395898_0085858
619 Ga0395898_0151985
620 Ga0395905_0000124
621 Ga0395905_0990802
622 Ga0395901_0000138
623 Ga0395901_0057434
624 Ga0395901_0254394
625 Ga0436361_0613516
626 Ga0451789_0918748
627 Ga0451791_0720445
628 Ga0451795_0041810
629 Ga0451798_0607406
630 Ga0451807_1514918
631 Ga0451841_0398647
632 Ga0451853_1140549
633 Ga0495592_0611488
634 Ga0495592_0848565
635 Ga0495638_0050647
636 Ga0495583_0018634
637 Ga0495606_0465919
638 Ga0495616_0009352
639 Ga0495628_0915695
640 Ga0495632_0268304
641 Ga0495652_0101699
642 Ga0495652_0528367
643 Ga0495625_0000159
644 Ga0495625_0444139
645 Ga0495661_0002045
646 Ga0495649_0000003
647 Ga0495649_0128479
648 Ga0495672_0058387
649 Ga0495683_0141271
650 Ga0495687_013417
651 Ga0495679_045398
652 Ga0495686_0024703
653 Ga0495686_0155089
654 Ga0496115_0247925
655 Ga0495682_0276570
656 Ga0501034_0116443
657 Ga0501034_0262616
658 Ga0501070_0238396
659 Ga0501070_1365171
660 Ga0501071_1185903
661 Ga0501223_000294
662 Ga0501035_0712953
663 Ga0501044_0083671
664 nmdc:mga0k408_1790_c1
665 nmdc:mga0k408_247404_c1
666 nmdc:mga0k408_6828_c1
667 Ga0500635_0006186
668 Ga0500578_0097961
669 Ga0500646_0013980
670 Ga0500651_0167217
671 Ga0500608_004909
672 Ga0500658_0398391
673 Ga0500604_0076616
674 Ga0500622_0000932
675 Ga0500622_0027542
676 Ga0500622_0207629
677 Ga0500611_000098
678 2599478047
679 2740033180
680 2928147535

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07689

KaiB

KaiB domain

24

105

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jwr-assembly1.cif.gz_B crystal structure of foldswitch-stabilized kaib in complex with the n-terminal ci domain of kaic and a dimer of kaia c-terminal domains from thermosynechococcus elongatus 0.9186 16 103
4kun-assembly1.cif.gz_B crystal structure of legionella pneumophila lpp1115 / kaib 0.912 15 102
5jwr-assembly1.cif.gz_B crystal structure of foldswitch-stabilized kaib in complex with the n-terminal ci domain of kaic and a dimer of kaia c-terminal domains from thermosynechococcus elongatus 0.8994 16 103
8fwj-assembly1.cif.gz_M structure of dodecameric kaic-rs-s413e/s414e complexed with kaib-rs solved by cryo-em 0.8855 18 99
4kun-assembly1.cif.gz_B crystal structure of legionella pneumophila lpp1115 / kaib 0.8841 15 102
ID Description Score Start End Superfamily
4kunB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9191 16 99 3.40.30.10
5jwoB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9015 17 101 3.40.30.10
4kunB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8709 16 99 3.40.30.10
1v98B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8662 17 100 3.40.30.10
5jwoB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8639 17 101 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7V4Q7F2-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9877 16 103 GO:0000155
GO:0048511
AF-A0A2U1ALZ0-F1-model_v4 Circadian clock protein KaiB 0.9862 16 104 GO:0048511
AF-A0A660TL91-F1-model_v4 Circadian clock protein KaiB 0.9752 16 103 GO:0048511
AF-A0A2E1A6G2-F1-model_v4 Circadian clock protein KaiB 0.9689 14 103 GO:0048511
AF-A0A520IHL5-F1-model_v4 Circadian clock protein KaiB 0.9656 16 102 GO:0048511

Map