F414185

General Info

Members Datasets Scaffolds Average Seq Length
340 227 305 319

Family's Representative Sequence

Representative Sequence 3300003794|Ga0055531_10004540|Ga0055531_100045407
Length 369
Sequence MRVMDRYFGVETRQSKRDGTKDGCKWPIRSIIRQSSVLTNFLMNRILCLALVWIGMASALPAFATGSAPANFLYASSGELSAMGVQLQRPDIDGAQIVYNWKTLEKRPGVYDFSAIETDLRIVDALHKKLFIQIQDRFFEPKARNLPRYLLDDPRYGGGLAPQFDNPGENKPVATGWVAQQWNPAVRGRYQKLLQALAKRFDGRIYGVNLPETAIDVDTAADSSGFDCDLYFAAEMENLAAAKKAFKTTKVVQYVNFWPCEWENDRNYMGRLFAYAEANGVGLGGPDIVPNHKSQTKNSYPFFHKYKGKLALVALAVQEPTLTYTNPATHRPFTKAEFVQYASDYLGADIIFWSGASPWLRKAYAPPRR

Samples

Sample ID Description Type Environment
1 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
2 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
3 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
4 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
5 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
6 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
7 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
8 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
9 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
10 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
11 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
12 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
13 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
14 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
15 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
16 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
17 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
18 2751185917 Enterobacter sp. HK169 Isolate Unclassified
19 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
20 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
21 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
22 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
23 2821118458 Enterobacter asburiae 609 Isolate Unclassified
24 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
25 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
26 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
27 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
28 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
29 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
30 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
31 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
32 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
33 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
34 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
35 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
36 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
37 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
38 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
39 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
40 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
41 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
42 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
43 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
44 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
45 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
46 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
47 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
48 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
49 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
50 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
51 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
52 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
53 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
54 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
55 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
56 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
57 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
58 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
59 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
60 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
61 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
62 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
63 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
64 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
65 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
66 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
67 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
68 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
69 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
70 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
71 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
72 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
73 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
74 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
92 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
104 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
112 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
113 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
114 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
116 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
117 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
144 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
161 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
162 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
163 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
164 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
171 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
172 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
175 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
179 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
182 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
183 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
184 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
185 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
191 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
198 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
221 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
222 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
223 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
226 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
227 8018405270 Enterobacter sp. 198 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.71
Metatranscriptomes 0
Isolates 10.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.76
Nodule 2.94
Rhizoplane 1.76
Rhizosphere 45.88
Stem 0
Stem Tuber 0
Unclassified 27.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1009531 3300001915 Bacteria 1779
2 JGI25155J39150_1000284 3300002704 Bacteria 18276
3 JGI25156J39149_1000110 3300002705 Bacteria 59456
4 JGI25156J39149_1001005 3300002705 Bacteria 13279
5 JGI25156J39149_1004996 3300002705 Bacteria 3917
6 JGI25162J39368_1001809 3300002737 Bacteria 10045
7 JGI25154J39366_1000231 3300002738 Bacteria 37387
8 JGI25158J39367_1000065 3300002739 Bacteria 23421
9 JGI25157J39369_1000645 3300002741 Bacteria 19502
10 JGI25157J39369_1000705 3300002741 Bacteria 18005
11 JGI25157J39369_1001065 3300002741 Bacteria 12420
12 JGI25164J39214_1000057 3300002772 Bacteria 113023
13 JGI25152J39213_1006757 3300002773 Bacteria 3054
14 JGI25152J39213_1007562 3300002773 Bacteria 2797
15 JGI25159J45721_1000928 3300002987 Bacteria 12764
16 JGI25151J46595_10000733 3300003187 Bacteria 27040
17 JGI25151J46595_10002293 3300003187 Bacteria 11705
18 JGI25151J46595_10003097 3300003187 Bacteria 9370
19 JGI25165J46597_1000072 3300003214 Bacteria 192184
20 JGI25153J46596_10015749 3300003215 Bacteria 3062
21 rootH1_10117266 3300003316 Bacteria 2805
22 rootH2_10124041 3300003320 Bacteria 7841
23 rootH2_10142869 3300003320 Bacteria 6160
24 rootL2_10156889 3300003322 Bacteria 1769
25 rootH1_10112374 3300003323 Bacteria 2299
26 JGI25161J50226_1000370 3300003374 Bacteria 22840
27 Ga0055532_1000015 3300003758 Bacteria 340197
28 Ga0055525_1000027 3300003759 Bacteria 340506
29 Ga0055527_1000283 3300003760 Bacteria 29880
30 Ga0055527_1001150 3300003760 Bacteria 6014
31 Ga0055535_1000065 3300003761 Bacteria 115893
32 Ga0055535_1000366 3300003761 Bacteria 43537
33 Ga0055535_1001041 3300003761 Bacteria 17486
34 Ga0055542_1000634 3300003762 Bacteria 29589
35 Ga0055542_1000666 3300003762 Bacteria 27917
36 Ga0055529_1000160 3300003763 Bacteria 92524
37 Ga0055529_1000927 3300003763 Bacteria 15750
38 Ga0055526_1018907 3300003771 Bacteria 2539
39 Ga0055526_1025474 3300003771 Bacteria 1897
40 Ga0055534_1011666 3300003784 Bacteria 1775
41 Ga0055528_1000158 3300003790 Bacteria 56769
42 Ga0055540_1001786 3300003792 Bacteria 12225
43 Ga0055531_10004540 3300003794 Bacteria 8418
44 Ga0058692_1003312 3300003856 Bacteria 5009
45 Ga0058692_1005766 3300003856 Bacteria 3488
46 Ga0055543_1000060 3300004625 Bacteria 98330
47 Ga0065704_10000349 3300005289 Bacteria 28555
48 Ga0070676_10073861 3300005328 Bacteria 2052
49 Ga0068869_100185576 3300005334 Bacteria 1632
50 Ga0070682_100023165 3300005337 Bacteria 3686
51 Ga0070682_100189176 3300005337 Bacteria 1444
52 Ga0070668_100058129 3300005347 Bacteria 2991
53 Ga0070675_100017079 3300005354 Bacteria 5766
54 Ga0070675_100025058 3300005354 Bacteria 4781
55 Ga0070674_100035621 3300005356 Bacteria 3334
56 Ga0070674_100141748 3300005356 Bacteria 1804
57 Ga0070688_100096544 3300005365 Bacteria 1941
58 Ga0070659_100004056 3300005366 Bacteria 10442
59 Ga0070659_100091663 3300005366 Bacteria 2436
60 Ga0070678_100029327 3300005456 Bacteria 3766
61 Ga0070678_100167842 3300005456 Bacteria 1784
62 Ga0070686_100220989 3300005544 Unclassified 1369
63 Ga0070665_100001023 3300005548 Bacteria 35083
64 Ga0070665_100079461 3300005548 Bacteria 3285
65 Ga0068857_100000882 3300005577 Bacteria 22652
66 Ga0068857_100175779 3300005577 Bacteria 1948
67 Ga0068870_10008305 3300005840 Bacteria 4664
68 Ga0075367_10100184 3300006178 Bacteria 1770
69 Ga0075366_10004447 3300006195 Bacteria 7523
70 Ga0075370_10003198 3300006353 Bacteria 7756
71 Ga0068871_100005255 3300006358 Bacteria 9064
72 Ga0068871_100097913 3300006358 Bacteria 2453
73 Ga0079104_1001793 3300006946 Bacteria 13334
74 Ga0079104_1002196 3300006946 Bacteria 10993
75 Ga0105251_10000585 3300009011 Bacteria 33544
76 Ga0105251_10014129 3300009011 Bacteria 4431
77 Ga0105244_10000118 3300009036 Bacteria 83868
78 Ga0105244_10000764 3300009036 Bacteria 27477
79 Ga0105244_10049201 3300009036 Bacteria 2155
80 Ga0105240_10071157 3300009093 Bacteria 4302
81 Ga0105243_10002333 3300009148 Bacteria 15886
82 Ga0105243_10169019 3300009148 Bacteria 1892
83 Ga0105242_10077015 3300009176 Bacteria 2782
84 Ga0105248_10254106 3300009177 Bacteria 1978
85 Ga0123341_1000035 3300009765 Bacteria 62072
86 Ga0123342_1036690 3300009766 Bacteria 2009
87 Ga0105246_10017588 3300011119 Bacteria 4547
88 Ga0157373_10174673 3300013100 Bacteria 1512
89 Ga0157371_10007004 3300013102 Bacteria 9172
90 Ga0157370_10006034 3300013104 Bacteria 13470
91 Ga0157375_10270307 3300013308 Unclassified 1862
92 Ga0157380_10263424 3300014326 Bacteria 1567
93 Ga0157376_10221825 3300014969 Bacteria 1751
94 Ga0182006_1020775 3300015261 Bacteria 2747
95 Ga0182007_10006140 3300015262 Bacteria 5188
96 Ga0213872_10000215 3300021361 Bacteria 51118
97 Ga0209435_100021 3300025206 Bacteria 223961
98 Ga0209436_100081 3300025208 Bacteria 48215
99 Ga0209672_100005 3300025228 Bacteria 1069303
100 Ga0209672_100112 3300025228 Bacteria 92842
101 Ga0209147_100004 3300025229 Bacteria 1371850
102 Ga0209563_100023 3300025230 Bacteria 636844
103 Ga0207427_100055 3300025231 Bacteria 209093
104 Ga0209437_100127 3300025233 Bacteria 190741
105 Ga0209258_100006 3300025242 Bacteria 1069303
106 Ga0209258_100083 3300025242 Bacteria 246008
107 Ga0209258_100139 3300025242 Bacteria 167268
108 Ga0207425_1002006 3300025245 Bacteria 7600
109 Ga0209646_1000074 3300025246 Bacteria 223961
110 Ga0209646_1001398 3300025246 Bacteria 6582
111 Ga0209026_1000058 3300025250 Bacteria 228656
112 Ga0209026_1000108 3300025250 Bacteria 148837
113 Ga0209026_1002581 3300025250 Bacteria 6664
114 Ga0209148_1000012 3300025254 Bacteria 1069303
115 Ga0209148_1000073 3300025254 Bacteria 320851
116 Ga0209759_1000046 3300025256 Bacteria 230149
117 Ga0209759_1000501 3300025256 Bacteria 42882
118 Ga0209759_1007751 3300025256 Bacteria 3419
119 Ga0209129_1000324 3300025258 Bacteria 42226
120 Ga0209129_1002210 3300025258 Bacteria 9762
121 Ga0209129_1005043 3300025258 Bacteria 4852
122 Ga0209233_1000063 3300025261 Bacteria 395810
123 Ga0209455_1000008 3300025272 Bacteria 1069303
124 Ga0209455_1000018 3300025272 Bacteria 718034
125 Ga0209673_1000010 3300025273 Bacteria 596656
126 Ga0209130_1000023 3300025284 Bacteria 359355
127 Ga0209130_1005802 3300025284 Bacteria 4177
128 Ga0209675_1000033 3300025291 Bacteria 271576
129 Ga0209025_1000168 3300025294 Bacteria 162386
130 Ga0209025_1002028 3300025294 Bacteria 23124
131 Ga0209025_1031437 3300025294 Bacteria 2511
132 Ga0209564_1004488 3300025295 Bacteria 8515
133 Ga0209758_1012156 3300025297 Bacteria 4858
134 Ga0209758_1043316 3300025297 Bacteria 1659
135 Ga0209256_1000704 3300025299 Bacteria 44504
136 Ga0207426_1000008 3300025302 Bacteria 848730
137 Ga0209257_1000197 3300025304 Bacteria 149491
138 Ga0207655_1001261 3300025728 Bacteria 24132
139 Ga0207655_1001330 3300025728 Bacteria 23320
140 Ga0207713_1000004 3300025735 Bacteria 702781
141 Ga0207713_1004229 3300025735 Bacteria 9392
142 Ga0207713_1006656 3300025735 Bacteria 6994
143 Ga0207713_1023016 3300025735 Bacteria 2942
144 Ga0207713_1039725 3300025735 Bacteria 1982
145 Ga0207713_1058793 3300025735 Bacteria 1479
146 Ga0207682_10026825 3300025893 Bacteria 2292
147 Ga0207682_10029945 3300025893 Bacteria 2178
148 Ga0207643_10009226 3300025908 Bacteria 5299
149 Ga0207695_10079616 3300025913 Bacteria 3320
150 Ga0207659_10040110 3300025926 Bacteria 3271
151 Ga0207690_10154359 3300025932 Bacteria 1705
152 Ga0207709_10034963 3300025935 Bacteria 2966
153 Ga0207669_10072258 3300025937 Bacteria 2171
154 Ga0207704_10203125 3300025938 Bacteria 1452
155 Ga0207691_10007572 3300025940 Bacteria 10452
156 Ga0207691_10007865 3300025940 Bacteria 10269
157 Ga0207689_10013289 3300025942 Bacteria 7023
158 Ga0207648_10575921 3300026089 Bacteria 1036
159 Ga0207674_10002548 3300026116 Bacteria 22961
160 Ga0207674_10101486 3300026116 Bacteria 2858
161 Ga0207683_10032836 3300026121 Bacteria 4509
162 Ga0207683_10124321 3300026121 Bacteria 2318
163 Ga0209281_1000143 3300027111 Bacteria 174070
164 Ga0209281_1000222 3300027111 Bacteria 121388
165 Ga0209371_1000001 3300027312 Bacteria 2771503
166 Ga0209371_1001025 3300027312 Bacteria 21208
167 Ga0268266_10000902 3300028379 Bacteria 38407
168 Ga0268265_10030460 3300028380 Bacteria 3886
169 Ga0265338_10073700 3300028800 Unclassified 2908
170 Ga0268256_1000001 3300030500 Bacteria 2771065
171 Ga0268256_1000866 3300030500 Bacteria 21139
172 Ga0265339_10009907 3300031249 Bacteria 5951
173 Ga0307513_10013048 3300031456 Bacteria 10218
174 Ga0307513_10187735 3300031456 Bacteria 1922
175 Ga0265314_10013767 3300031711 Bacteria 6519
176 Ga0307409_100022511 3300031995 Bacteria 4347
177 Ga0395899_0000108 3300037312 Bacteria 142347
178 Ga0395899_0055290 3300037312 Bacteria 2936
179 Ga0395900_0000144 3300037418 Bacteria 119971
180 Ga0395898_0000018 3300037466 Bacteria 418600
181 Ga0395898_0000049 3300037466 Bacteria 284792
182 Ga0395901_0137006 3300038443 Bacteria 2572
183 Ga0436361_0739768 3300039447 Bacteria 83506
184 Ga0451847_0995215 3300041503 Bacteria 1622
185 Ga0451853_2296880 3300041512 Bacteria 1834
186 Ga0439452_000014 3300042010 Bacteria 344969
187 Ga0466969_0008099 3300044656 Bacteria 5578
188 Ga0466969_0011629 3300044656 Bacteria 4655
189 Ga0466989_0114959 3300044663 Bacteria 1647
190 Ga0466981_0000004 3300044669 Bacteria 171461
191 Ga0466965_0095914 3300044683 Bacteria 1513
192 Ga0466966_0034861 3300044684 Bacteria 3253
193 Ga0466966_0171421 3300044684 Bacteria 1318
194 Ga0466961_0007745 3300044693 Bacteria 6838
195 Ga0466961_0019590 3300044693 Bacteria 4353
196 Ga0466970_0012901 3300044765 Bacteria 4278
197 Ga0466959_0000042 3300045049 Bacteria 98655
198 Ga0466959_0006665 3300045049 Bacteria 8026
199 Ga0466958_0003044 3300045836 Bacteria 8595
200 Ga0466958_0127648 3300045836 Bacteria 1595
201 Ga0495627_036481 3300046453 Bacteria 1528
202 Ga0495590_0002019 3300046457 Bacteria 8536
203 Ga0495591_007685 3300046458 Bacteria 4537
204 Ga0495638_0000790 3300046460 Bacteria 33426
205 Ga0495650_0000005 3300046471 Bacteria 766553
206 Ga0495650_0002819 3300046471 Bacteria 13338
207 Ga0495605_0000060 3300046474 Bacteria 145530
208 Ga0495585_0154875 3300046492 Bacteria 1193
209 Ga0495594_0004846 3300046499 Bacteria 6929
210 Ga0495596_0011948 3300046500 Bacteria 3727
211 Ga0495583_0000566 3300046506 Bacteria 51163
212 Ga0495610_0005477 3300046512 Bacteria 9009
213 Ga0495616_0032530 3300046513 Bacteria 2724
214 Ga0495620_0000145 3300046515 Bacteria 58063
215 Ga0495631_0001553 3300046518 Bacteria 13821
216 Ga0495648_0025691 3300046524 Bacteria 3981
217 Ga0495663_0021061 3300046525 Bacteria 1875
218 Ga0495654_0001559 3300046530 Bacteria 15555
219 Ga0495609_0000390 3300046538 Bacteria 37062
220 Ga0495597_0003388 3300046542 Bacteria 9341
221 Ga0495633_0000286 3300046558 Bacteria 58029
222 Ga0495611_0000684 3300046648 Bacteria 19313
223 Ga0495661_0000684 3300046665 Bacteria 33807
224 Ga0495671_0004591 3300046692 Bacteria 8217
225 Ga0495649_0003627 3300046694 Bacteria 10305
226 Ga0495589_0001657 3300046794 Bacteria 12759
227 Ga0495660_0001058 3300046810 Bacteria 19921
228 Ga0495672_0034814 3300047320 Bacteria 3108
229 Ga0495683_0000020 3300047323 Bacteria 181773
230 Ga0495679_000636 3300047446 Bacteria 23583
231 Ga0495673_0009339 3300047469 Bacteria 5434
232 Ga0495681_0006824 3300047470 Bacteria 7422
233 Ga0496104_0001201 3300048907 Bacteria 22311
234 Ga0496105_0028754 3300048908 Bacteria 4547
235 Ga0496106_0002317 3300048909 Bacteria 14193
236 Ga0496116_0000022 3300048919 Bacteria 482506
237 Ga0496116_0000324 3300048919 Bacteria 78414
238 Ga0496116_0004836 3300048919 Bacteria 12705
239 Ga0496117_0000020 3300048920 Bacteria 458405
240 Ga0496117_0000064 3300048920 Bacteria 254248
241 Ga0496117_0002340 3300048920 Bacteria 24240
242 Ga0496117_0138030 3300048920 Bacteria 1465
243 Ga0496118_0000015 3300048921 Bacteria 551359
244 Ga0496118_0002371 3300048921 Bacteria 25492
245 Ga0496118_0039466 3300048921 Bacteria 3766
246 Ga0496118_0069535 3300048921 Bacteria 2548
247 Ga0496119_0000025 3300048922 Bacteria 257069
248 Ga0496119_0001846 3300048922 Bacteria 24477
249 Ga0496119_0009249 3300048922 Bacteria 8489
250 Ga0496119_0015967 3300048922 Bacteria 5744
251 Ga0496119_0072665 3300048922 Bacteria 2009
252 Ga0496120_0001141 3300048923 Bacteria 34252
253 Ga0496120_0003129 3300048923 Bacteria 15502
254 Ga0496120_0017533 3300048923 Bacteria 4639
255 Ga0496121_0008883 3300048924 Bacteria 11681
256 Ga0496121_0012458 3300048924 Bacteria 9267
257 Ga0496121_0019887 3300048924 Bacteria 6685
258 Ga0496121_0050831 3300048924 Bacteria 3497
259 Ga0496121_0055881 3300048924 Bacteria 3284
260 Ga0496121_0128557 3300048924 Bacteria 1900
261 Ga0496121_0272313 3300048924 Bacteria 1163
262 Ga0496122_0001362 3300048925 Bacteria 39760
263 Ga0496122_0001579 3300048925 Bacteria 35800
264 Ga0496122_0008783 3300048925 Bacteria 10795
265 Ga0496122_0010965 3300048925 Bacteria 9262
266 Ga0496122_0011333 3300048925 Bacteria 9047
267 Ga0496122_0097162 3300048925 Bacteria 1983
268 Ga0496122_0126211 3300048925 Bacteria 1637
269 Ga0496123_0000897 3300048926 Bacteria 47137
270 Ga0496123_0004805 3300048926 Bacteria 13947
271 Ga0496123_0006963 3300048926 Bacteria 10795
272 Ga0496123_0019928 3300048926 Bacteria 5264
273 Ga0496123_0035439 3300048926 Bacteria 3556
274 Ga0496123_0041773 3300048926 Bacteria 3173
275 Ga0496124_0000287 3300048927 Bacteria 95238
276 Ga0496124_0000505 3300048927 Bacteria 67090
277 Ga0496124_0000935 3300048927 Bacteria 46956
278 Ga0496124_0007031 3300048927 Bacteria 12055
279 Ga0496124_0089603 3300048927 Bacteria 2511
280 Ga0496124_0144897 3300048927 Bacteria 1870
281 Ga0496125_0000662 3300048928 Bacteria 57446
282 Ga0496125_0001043 3300048928 Bacteria 42850
283 Ga0496125_0010764 3300048928 Bacteria 9213
284 Ga0496125_0030810 3300048928 Bacteria 4791
285 Ga0496125_0069309 3300048928 Bacteria 2768
286 Ga0496126_0000349 3300048929 Bacteria 96786
287 Ga0496126_0001868 3300048929 Bacteria 30681
288 Ga0496126_0002334 3300048929 Bacteria 26008
289 Ga0496126_0186914 3300048929 Bacteria 1756
290 Ga0496126_0320297 3300048929 Bacteria 1274
291 Ga0496126_0408753 3300048929 Bacteria 1099
292 Ga0495678_000077 3300049459 Bacteria 125025
293 Ga0501043_0118753 3300049579 Bacteria 2074
294 Ga0501035_0253310 3300049822 Bacteria 1494
295 nmdc:mga06z11_75473_c1 3300050494 Bacteria 1795
296 nmdc:mga07m45_23981_c1 3300050496 Bacteria 3338
297 Ga0500643_003643 3300053087 Bacteria 7297
298 Ga0500643_043203 3300053087 Bacteria 1315
299 Ga0500555_026287 3300053103 Bacteria 1664
300 Ga0500658_0010036 3300053134 Bacteria 3495
301 Ga0500568_0001419 3300053139 Bacteria 15537
302 Ga0500616_0003746 3300053153 Bacteria 11341
303 Ga0500622_0000597 3300053156 Bacteria 32786
304 Ga0466962_0069659 3300061719 Bacteria 1680
305 Ga0466962_0081619 3300061719 Bacteria 1546

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044683 Ga0466965_0095914 Ga0466965_0095914_601_1500 298
2 3300003187 JGI25151J46595_10000733 JGI25151J46595_1000073327 300
3 3300006178 Ga0075367_10100184 Ga0075367_101001841 300
4 3300002773 JGI25152J39213_1007562 JGI25152J39213_10075623 301
5 3300003187 JGI25151J46595_10003097 JGI25151J46595_100030975 301
6 3300025258 Ga0209129_1000324 Ga0209129_100032431 301
7 3300025294 Ga0209025_1002028 Ga0209025_100202819 301
8 3300011119 Ga0105246_10017588 Ga0105246_100175886 303
9 3300048920 Ga0496117_0138030 Ga0496117_0138030_167_1126 303
10 3300048921 Ga0496118_0039466 Ga0496118_0039466_576_1535 303
11 3300048929 Ga0496126_0408753 Ga0496126_0408753_33_992 303
12 3300031249 Ga0265339_10009907 Ga0265339_100099073 305
13 3300031711 Ga0265314_10013767 Ga0265314_100137671 305
14 3300005337 Ga0070682_100023165 Ga0070682_1000231652 306
15 3300037312 Ga0395899_0000108 Ga0395899_0000108_125510_126433 306
16 3300037418 Ga0395900_0000144 Ga0395900_0000144_72540_73463 306
17 3300037466 Ga0395898_0000018 Ga0395898_0000018_288177_289100 306
18 3300038443 Ga0395901_0137006 Ga0395901_0137006_196_1119 306
19 3300009765 Ga0123341_1000035 Ga0123341_100003557 307
20 3300009766 Ga0123342_1036690 Ga0123342_10366901 307
21 3300044669 Ga0466981_0000004 Ga0466981_0000004_58371_59333 307
22 3300003771 Ga0055526_1018907 Ga0055526_10189071 308
23 3300003771 Ga0055526_1025474 Ga0055526_10254742 308
24 3300003790 Ga0055528_1000158 Ga0055528_100015825 308
25 3300025273 Ga0209673_1000010 Ga0209673_1000010537 308
26 3300025295 Ga0209564_1004488 Ga0209564_10044883 308
27 3300025299 Ga0209256_1000704 Ga0209256_100070438 308
28 3300048924 Ga0496121_0272313 Ga0496121_0272313_60_1013 308
29 3300002773 JGI25152J39213_1006757 JGI25152J39213_10067572 309
30 3300003215 JGI25153J46596_10015749 JGI25153J46596_100157492 309
31 3300009177 Ga0105248_10254106 Ga0105248_102541063 309
32 3300014969 Ga0157376_10221825 Ga0157376_102218252 309
33 3300025245 Ga0207425_1002006 Ga0207425_10020065 309
34 3300025258 Ga0209129_1005043 Ga0209129_10050433 309
35 3300025297 Ga0209758_1012156 Ga0209758_10121563 309
36 3300041512 Ga0451853_2296880 Ga0451853_2296880_390_1343 309
37 3300048924 Ga0496121_0128557 Ga0496121_0128557_146_1105 309
38 iso_pu_bacteria 2588254257 2590612134 309
39 3300046694 Ga0495649_0003627 Ga0495649_0003627_3013_3954 310
40 3300044656 Ga0466969_0008099 Ga0466969_0008099_183_1127 311
41 3300044663 Ga0466989_0114959 Ga0466989_0114959_470_1414 311
42 3300044684 Ga0466966_0034861 Ga0466966_0034861_1735_2679 311
43 3300044693 Ga0466961_0007745 Ga0466961_0007745_5697_6641 311
44 3300045049 Ga0466959_0006665 Ga0466959_0006665_6238_7182 311
45 3300046453 Ga0495627_036481 Ga0495627_036481_322_1341 311
46 3300046457 Ga0495590_0002019 Ga0495590_0002019_6240_7181 311
47 3300061719 Ga0466962_0081619 Ga0466962_0081619_52_996 311
48 3300009036 Ga0105244_10000118 Ga0105244_1000011810 312
49 3300041503 Ga0451847_0995215 Ga0451847_0995215_547_1500 312
50 3300048920 Ga0496117_0002340 Ga0496117_0002340_22823_23764 312
51 3300048921 Ga0496118_0069535 Ga0496118_0069535_631_1572 312
52 3300048925 Ga0496122_0126211 Ga0496122_0126211_530_1471 312
53 3300048927 Ga0496124_0000935 Ga0496124_0000935_858_1799 312
54 3300048928 Ga0496125_0001043 Ga0496125_0001043_6062_7003 312
55 iso_pu_bacteria 2857504554 2857506097 312
56 3300002739 JGI25158J39367_1000065 JGI25158J39367_10000653 313
57 3300002987 JGI25159J45721_1000928 JGI25159J45721_100092814 313
58 3300003316 rootH1_10117266 rootH1_101172664 313
59 3300003374 JGI25161J50226_1000370 JGI25161J50226_100037024 313
60 3300004625 Ga0055543_1000060 Ga0055543_100006032 313
61 3300005544 Ga0070686_100220989 Ga0070686_1002209892 313
62 3300025208 Ga0209436_100081 Ga0209436_10008117 313
63 3300025284 Ga0209130_1000023 Ga0209130_100002326 313
64 3300025302 Ga0207426_1000008 Ga0207426_100000845 313
65 3300045836 Ga0466958_0003044 Ga0466958_0003044_479_1432 313
66 3300053103 Ga0500555_026287 Ga0500555_026287_348_1376 313
67 iso_pu_bacteria 2889790730 2889796074 313
68 iso_pu_bacteria 2889914905 2889919881 313
69 3300002705 JGI25156J39149_1004996 JGI25156J39149_10049964 314
70 3300002741 JGI25157J39369_1000645 JGI25157J39369_100064513 314
71 3300006358 Ga0068871_100097913 Ga0068871_1000979133 314
72 3300025250 Ga0209026_1000108 Ga0209026_100010839 314
73 3300025256 Ga0209759_1000501 Ga0209759_100050132 314
74 3300031456 Ga0307513_10013048 Ga0307513_100130488 314
75 3300031456 Ga0307513_10187735 Ga0307513_101877352 314
76 3300048927 Ga0496124_0089603 Ga0496124_0089603_256_1332 314
77 3300048928 Ga0496125_0030810 Ga0496125_0030810_2168_3244 314
78 3300053087 Ga0500643_003643 Ga0500643_003643_743_1762 314
79 iso_pu_bacteria 2667528172 2671101967 314
80 iso_pu_bacteria 2681812866 2681997162 314
81 iso_pu_bacteria 2681812869 2682005563 314
82 iso_pu_bacteria 2751185917 2753856132 314
83 iso_pu_bacteria 2765235842 2765589088 314
84 iso_pu_bacteria 2775506706 2775539193 314
85 iso_pu_bacteria 2821118458 2821119966 314
86 iso_pu_bacteria 2823373977 2823374887 314
87 iso_pu_bacteria 2927833300 2927833941 314
88 iso_pu_bacteria 2974310843 2974311975 314
89 iso_pu_bacteria 3005409236 3005414293 314
90 iso_pu_bacteria 8018405270 8018407643 314
91 3300003759 Ga0055525_1000027 Ga0055525_1000027127 315
92 3300003760 Ga0055527_1000283 Ga0055527_100028319 315
93 3300003761 Ga0055535_1000065 Ga0055535_100006587 315
94 3300003763 Ga0055529_1000927 Ga0055529_10009275 315
95 3300005577 Ga0068857_100175779 Ga0068857_1001757793 315
96 3300025230 Ga0209563_100023 Ga0209563_100023289 315
97 3300026116 Ga0207674_10101486 Ga0207674_101014864 315
98 3300037312 Ga0395899_0055290 Ga0395899_0055290_64_1020 315
99 3300037466 Ga0395898_0000049 Ga0395898_0000049_155016_155972 315
100 3300053156 Ga0500622_0000597 Ga0500622_0000597_16892_17989 315
101 iso_pu_bacteria 2509276033 2509447380 315
102 iso_pu_bacteria 2534681796 2535517138 315
103 iso_pu_bacteria 2582581278 2585141388 315
104 iso_pu_bacteria 2585428045 2587678371 315
105 iso_pu_bacteria 2585428060 2587749237 315
106 iso_pu_bacteria 2585428182 2588208005 315
107 iso_pu_bacteria 2588253712 2588446623 315
108 iso_pu_bacteria 2588254255 2590600593 315
109 iso_pu_bacteria 2643221634 2644191788 315
110 iso_pu_bacteria 2739367874 2740057919 315
111 iso_pu_bacteria 2791355259 2793318172 315
112 iso_pu_bacteria 2816332188 2816873157 315
113 iso_pu_bacteria 2871720351 2871722720 315
114 iso_pu_bacteria 2889290771 2889291470 315
115 iso_pu_bacteria 2919100787 2919106184 315
116 iso_pu_bacteria 3005445848 3005448721 315
117 3300002704 JGI25155J39150_1000284 JGI25155J39150_10002848 316
118 3300002705 JGI25156J39149_1000110 JGI25156J39149_100011039 316
119 3300002738 JGI25154J39366_1000231 JGI25154J39366_100023119 316
120 3300002741 JGI25157J39369_1000705 JGI25157J39369_100070516 316
121 3300003758 Ga0055532_1000015 Ga0055532_1000015307 316
122 3300005337 Ga0070682_100189176 Ga0070682_1001891762 316
123 3300006358 Ga0068871_100005255 Ga0068871_1000052553 316
124 3300013308 Ga0157375_10270307 Ga0157375_102703071 316
125 3300021361 Ga0213872_10000215 Ga0213872_100002157 316
126 3300025206 Ga0209435_100021 Ga0209435_100021159 316
127 3300025229 Ga0209147_100004 Ga0209147_100004871 316
128 3300025242 Ga0209258_100083 Ga0209258_10008338 316
129 3300025246 Ga0209646_1000074 Ga0209646_1000074159 316
130 3300025250 Ga0209026_1000058 Ga0209026_100005844 316
131 3300025256 Ga0209759_1000046 Ga0209759_100004643 316
132 3300039447 Ga0436361_0739768 Ga0436361_0739768_38387_39346 316
133 3300053134 Ga0500658_0010036 Ga0500658_0010036_2390_3418 316
134 3300003320 rootH2_10124041 rootH2_101240416 317
135 3300003784 Ga0055534_1011666 Ga0055534_10116661 317
136 3300005328 Ga0070676_10073861 Ga0070676_100738612 317
137 3300005347 Ga0070668_100058129 Ga0070668_1000581292 317
138 3300005354 Ga0070675_100017079 Ga0070675_1000170791 317
139 3300005356 Ga0070674_100141748 Ga0070674_1001417482 317
140 3300005365 Ga0070688_100096544 Ga0070688_1000965443 317
141 3300005456 Ga0070678_100029327 Ga0070678_1000293272 317
142 3300009036 Ga0105244_10000764 Ga0105244_1000076422 317
143 3300025284 Ga0209130_1005802 Ga0209130_10058022 317
144 3300025291 Ga0209675_1000033 Ga0209675_1000033252 317
145 3300025294 Ga0209025_1031437 Ga0209025_10314372 317
146 3300025728 Ga0207655_1001261 Ga0207655_100126120 317
147 3300025893 Ga0207682_10029945 Ga0207682_100299453 317
148 3300046458 Ga0495591_007685 Ga0495591_007685_2816_3769 317
149 3300046471 Ga0495650_0002819 Ga0495650_0002819_6268_7221 317
150 3300046474 Ga0495605_0000060 Ga0495605_0000060_103335_104288 317
151 3300046499 Ga0495594_0004846 Ga0495594_0004846_3641_4594 317
152 3300046506 Ga0495583_0000566 Ga0495583_0000566_15562_16515 317
153 3300046512 Ga0495610_0005477 Ga0495610_0005477_915_1868 317
154 3300046515 Ga0495620_0000145 Ga0495620_0000145_42155_43108 317
155 3300046518 Ga0495631_0001553 Ga0495631_0001553_5137_6090 317
156 3300046524 Ga0495648_0025691 Ga0495648_0025691_935_1888 317
157 3300046530 Ga0495654_0001559 Ga0495654_0001559_8510_9463 317
158 3300046538 Ga0495609_0000390 Ga0495609_0000390_20551_21504 317
159 3300046558 Ga0495633_0000286 Ga0495633_0000286_15003_15956 317
160 3300046648 Ga0495611_0000684 Ga0495611_0000684_10695_11648 317
161 3300046665 Ga0495661_0000684 Ga0495661_0000684_17610_18563 317
162 3300046692 Ga0495671_0004591 Ga0495671_0004591_7141_8094 317
163 3300046794 Ga0495589_0001657 Ga0495589_0001657_6559_7512 317
164 3300046810 Ga0495660_0001058 Ga0495660_0001058_89_1042 317
165 3300047323 Ga0495683_0000020 Ga0495683_0000020_41731_42684 317
166 3300047446 Ga0495679_000636 Ga0495679_000636_7969_8922 317
167 3300047469 Ga0495673_0009339 Ga0495673_0009339_840_1793 317
168 3300047470 Ga0495681_0006824 Ga0495681_0006824_1865_2818 317
169 3300048924 Ga0496121_0050831 Ga0496121_0050831_587_1540 317
170 3300048925 Ga0496122_0097162 Ga0496122_0097162_345_1298 317
171 3300048926 Ga0496123_0041773 Ga0496123_0041773_769_1722 317
172 3300048928 Ga0496125_0000662 Ga0496125_0000662_2843_3850 317
173 3300049459 Ga0495678_000077 Ga0495678_000077_19409_20362 317
174 3300002705 JGI25156J39149_1001005 JGI25156J39149_100100512 318
175 3300002737 JGI25162J39368_1001809 JGI25162J39368_10018099 318
176 3300002741 JGI25157J39369_1001065 JGI25157J39369_100106511 318
177 3300002772 JGI25164J39214_1000057 JGI25164J39214_100005774 318
178 3300003214 JGI25165J46597_1000072 JGI25165J46597_1000072139 318
179 3300003760 Ga0055527_1001150 Ga0055527_10011505 318
180 3300003761 Ga0055535_1000366 Ga0055535_100036636 318
181 3300003761 Ga0055535_1001041 Ga0055535_10010417 318
182 3300003762 Ga0055542_1000634 Ga0055542_100063419 318
183 3300003762 Ga0055542_1000666 Ga0055542_100066618 318
184 3300003763 Ga0055529_1000160 Ga0055529_100016015 318
185 3300003856 Ga0058692_1003312 Ga0058692_10033127 318
186 3300003856 Ga0058692_1005766 Ga0058692_10057664 318
187 3300005289 Ga0065704_10000349 Ga0065704_1000034924 318
188 3300005366 Ga0070659_100091663 Ga0070659_1000916632 318
189 3300005548 Ga0070665_100001023 Ga0070665_10000102310 318
190 3300005577 Ga0068857_100000882 Ga0068857_10000088219 318
191 3300006946 Ga0079104_1001793 Ga0079104_10017939 318
192 3300006946 Ga0079104_1002196 Ga0079104_10021969 318
193 3300009011 Ga0105251_10000585 Ga0105251_1000058535 318
194 3300009011 Ga0105251_10014129 Ga0105251_100141296 318
195 3300009036 Ga0105244_10049201 Ga0105244_100492013 318
196 3300013100 Ga0157373_10174673 Ga0157373_101746732 318
197 3300013102 Ga0157371_10007004 Ga0157371_100070048 318
198 3300013104 Ga0157370_10006034 Ga0157370_100060347 318
199 3300025228 Ga0209672_100005 Ga0209672_100005630 318
200 3300025228 Ga0209672_100112 Ga0209672_10011273 318
201 3300025231 Ga0207427_100055 Ga0207427_10005572 318
202 3300025233 Ga0209437_100127 Ga0209437_1001274 318
203 3300025242 Ga0209258_100006 Ga0209258_100006630 318
204 3300025242 Ga0209258_100139 Ga0209258_100139139 318
205 3300025246 Ga0209646_1001398 Ga0209646_10013985 318
206 3300025250 Ga0209026_1002581 Ga0209026_10025816 318
207 3300025254 Ga0209148_1000012 Ga0209148_1000012630 318
208 3300025254 Ga0209148_1000073 Ga0209148_1000073155 318
209 3300025256 Ga0209759_1007751 Ga0209759_10077515 318
210 3300025261 Ga0209233_1000063 Ga0209233_1000063222 318
211 3300025272 Ga0209455_1000008 Ga0209455_1000008630 318
212 3300025272 Ga0209455_1000018 Ga0209455_1000018574 318
213 3300025728 Ga0207655_1001330 Ga0207655_100133012 318
214 3300025735 Ga0207713_1000004 Ga0207713_1000004699 318
215 3300025735 Ga0207713_1004229 Ga0207713_10042299 318
216 3300025735 Ga0207713_1006656 Ga0207713_10066563 318
217 3300025735 Ga0207713_1023016 Ga0207713_10230163 318
218 3300025735 Ga0207713_1039725 Ga0207713_10397252 318
219 3300025735 Ga0207713_1058793 Ga0207713_10587931 318
220 3300025932 Ga0207690_10154359 Ga0207690_101543591 318
221 3300026116 Ga0207674_10002548 Ga0207674_100025483 318
222 3300027111 Ga0209281_1000143 Ga0209281_1000143167 318
223 3300027111 Ga0209281_1000222 Ga0209281_10002226 318
224 3300027312 Ga0209371_1000001 Ga0209371_10000011496 318
225 3300027312 Ga0209371_1001025 Ga0209371_100102518 318
226 3300028379 Ga0268266_10000902 Ga0268266_1000090229 318
227 3300030500 Ga0268256_1000001 Ga0268256_10000011146 318
228 3300030500 Ga0268256_1000866 Ga0268256_10008664 318
229 3300042010 Ga0439452_000014 Ga0439452_000014_258297_259256 318
230 3300046471 Ga0495650_0000005 Ga0495650_0000005_298882_299841 318
231 3300048907 Ga0496104_0001201 Ga0496104_0001201_12971_13930 318
232 3300048908 Ga0496105_0028754 Ga0496105_0028754_2604_3563 318
233 3300048919 Ga0496116_0000324 Ga0496116_0000324_4627_5586 318
234 3300048919 Ga0496116_0004836 Ga0496116_0004836_3188_4147 318
235 3300048920 Ga0496117_0000020 Ga0496117_0000020_72929_73888 318
236 3300048921 Ga0496118_0000015 Ga0496118_0000015_88147_89106 318
237 3300048922 Ga0496119_0001846 Ga0496119_0001846_23198_24157 318
238 3300048922 Ga0496119_0009249 Ga0496119_0009249_6182_7141 318
239 3300048922 Ga0496119_0015967 Ga0496119_0015967_3643_4602 318
240 3300048922 Ga0496119_0072665 Ga0496119_0072665_162_1121 318
241 3300048923 Ga0496120_0001141 Ga0496120_0001141_4646_5605 318
242 3300048923 Ga0496120_0003129 Ga0496120_0003129_4598_5557 318
243 3300048923 Ga0496120_0017533 Ga0496120_0017533_1155_2114 318
244 3300048924 Ga0496121_0008883 Ga0496121_0008883_4627_5586 318
245 3300048924 Ga0496121_0012458 Ga0496121_0012458_6233_7192 318
246 3300048924 Ga0496121_0055881 Ga0496121_0055881_1557_2516 318
247 3300048925 Ga0496122_0008783 Ga0496122_0008783_1492_2451 318
248 3300048925 Ga0496122_0010965 Ga0496122_0010965_2150_3109 318
249 3300048926 Ga0496123_0006963 Ga0496123_0006963_1492_2451 318
250 3300048926 Ga0496123_0019928 Ga0496123_0019928_982_1941 318
251 3300048927 Ga0496124_0000505 Ga0496124_0000505_18890_19849 318
252 3300048927 Ga0496124_0007031 Ga0496124_0007031_3315_4274 318
253 3300048927 Ga0496124_0144897 Ga0496124_0144897_310_1269 318
254 3300048928 Ga0496125_0069309 Ga0496125_0069309_1293_2252 318
255 3300048929 Ga0496126_0000349 Ga0496126_0000349_7459_8418 318
256 3300048929 Ga0496126_0002334 Ga0496126_0002334_17118_18077 318
257 3300048929 Ga0496126_0186914 Ga0496126_0186914_582_1541 318
258 3300048929 Ga0496126_0320297 Ga0496126_0320297_171_1130 318
259 3300003320 rootH2_10142869 rootH2_101428695 319
260 3300003322 rootL2_10156889 rootL2_101568893 319
261 3300003323 rootH1_10112374 rootH1_101123742 319
262 3300003792 Ga0055540_1001786 Ga0055540_100178613 319
263 3300005334 Ga0068869_100185576 Ga0068869_1001855762 319
264 3300005354 Ga0070675_100025058 Ga0070675_1000250582 319
265 3300005356 Ga0070674_100035621 Ga0070674_1000356213 319
266 3300005456 Ga0070678_100167842 Ga0070678_1001678423 319
267 3300005548 Ga0070665_100079461 Ga0070665_1000794613 319
268 3300005840 Ga0068870_10008305 Ga0068870_100083054 319
269 3300009148 Ga0105243_10002333 Ga0105243_1000233315 319
270 3300009176 Ga0105242_10077015 Ga0105242_100770153 319
271 3300014326 Ga0157380_10263424 Ga0157380_102634242 319
272 3300025297 Ga0209758_1043316 Ga0209758_10433161 319
273 3300025893 Ga0207682_10026825 Ga0207682_100268253 319
274 3300025908 Ga0207643_10009226 Ga0207643_100092263 319
275 3300025926 Ga0207659_10040110 Ga0207659_100401103 319
276 3300025935 Ga0207709_10034963 Ga0207709_100349631 319
277 3300025937 Ga0207669_10072258 Ga0207669_100722582 319
278 3300025938 Ga0207704_10203125 Ga0207704_102031252 319
279 3300025940 Ga0207691_10007572 Ga0207691_100075728 319
280 3300025942 Ga0207689_10013289 Ga0207689_100132896 319
281 3300026089 Ga0207648_10575921 Ga0207648_105759211 319
282 3300026121 Ga0207683_10124321 Ga0207683_101243213 319
283 3300028380 Ga0268265_10030460 Ga0268265_100304603 319
284 3300031995 Ga0307409_100022511 Ga0307409_1000225113 319
285 3300046460 Ga0495638_0000790 Ga0495638_0000790_25815_26777 319
286 3300046525 Ga0495663_0021061 Ga0495663_0021061_170_1141 319
287 3300047320 Ga0495672_0034814 Ga0495672_0034814_273_1235 319
288 3300048909 Ga0496106_0002317 Ga0496106_0002317_1210_2172 319
289 3300048919 Ga0496116_0000022 Ga0496116_0000022_455951_456910 319
290 3300048925 Ga0496122_0011333 Ga0496122_0011333_822_1787 319
291 3300048926 Ga0496123_0035439 Ga0496123_0035439_2401_3366 319
292 3300048927 Ga0496124_0000287 Ga0496124_0000287_66077_67036 319
293 3300049822 Ga0501035_0253310 Ga0501035_0253310_502_1464 319
294 3300053087 Ga0500643_043203 Ga0500643_043203_244_1218 319
295 3300053139 Ga0500568_0001419 Ga0500568_0001419_10559_11521 319
296 3300053153 Ga0500616_0003746 Ga0500616_0003746_9404_10366 319
297 3300005366 Ga0070659_100004056 Ga0070659_1000040569 320
298 3300025940 Ga0207691_10007865 Ga0207691_100078652 320
299 3300026121 Ga0207683_10032836 Ga0207683_100328362 320
300 3300046513 Ga0495616_0032530 Ga0495616_0032530_1667_2638 320
301 3300046542 Ga0495597_0003388 Ga0495597_0003388_684_1646 320
302 3300003187 JGI25151J46595_10002293 JGI25151J46595_1000229312 321
303 3300006195 Ga0075366_10004447 Ga0075366_100044478 321
304 3300006353 Ga0075370_10003198 Ga0075370_100031984 321
305 3300009148 Ga0105243_10169019 Ga0105243_101690192 321
306 3300025258 Ga0209129_1002210 Ga0209129_10022108 321
307 3300025294 Ga0209025_1000168 Ga0209025_100016888 321
308 3300044656 Ga0466969_0011629 Ga0466969_0011629_1634_2608 321
309 3300044684 Ga0466966_0171421 Ga0466966_0171421_61_1035 321
310 3300044693 Ga0466961_0019590 Ga0466961_0019590_1915_2889 321
311 3300044765 Ga0466970_0012901 Ga0466970_0012901_1919_2893 321
312 3300045049 Ga0466959_0000042 Ga0466959_0000042_86584_87558 321
313 3300045836 Ga0466958_0127648 Ga0466958_0127648_435_1409 321
314 3300050494 nmdc:mga06z11_75473_c1 nmdc:mga06z11_75473_c1_565_1572 321
315 3300050496 nmdc:mga07m45_23981_c1 nmdc:mga07m45_23981_c1_1657_2664 321
316 3300061719 Ga0466962_0069659 Ga0466962_0069659_153_1127 321
317 3300015261 Ga0182006_1020775 Ga0182006_10207752 323
318 3300015262 Ga0182007_10006140 Ga0182007_100061404 323
319 3300048925 Ga0496122_0001579 Ga0496122_0001579_3902_4909 323
320 3300048926 Ga0496123_0004805 Ga0496123_0004805_8795_9802 323
321 3300003794 Ga0055531_10004540 Ga0055531_100045407 324
322 3300025304 Ga0209257_1000197 Ga0209257_100019776 324
323 3300028800 Ga0265338_10073700 Ga0265338_100737002 324
324 iso_pu_bacteria 2585428183 2588213418 324
325 iso_pu_bacteria 2585428184 2588220020 324
326 iso_pu_bacteria 2585428185 2588223682 324
327 3300049579 Ga0501043_0118753 Ga0501043_0118753_374_1471 325
328 3300009093 Ga0105240_10071157 Ga0105240_100711572 326
329 3300025913 Ga0207695_10079616 Ga0207695_100796162 326
330 3300048924 Ga0496121_0019887 Ga0496121_0019887_4072_5115 326
331 3300001915 JGI24741J21665_1009531 JGI24741J21665_10095312 328
332 3300046492 Ga0495585_0154875 Ga0495585_0154875_153_1169 328
333 3300046500 Ga0495596_0011948 Ga0495596_0011948_573_1559 328
334 3300048920 Ga0496117_0000064 Ga0496117_0000064_221691_222677 328
335 3300048921 Ga0496118_0002371 Ga0496118_0002371_15215_16201 328
336 3300048922 Ga0496119_0000025 Ga0496119_0000025_34264_35250 328
337 3300048925 Ga0496122_0001362 Ga0496122_0001362_8950_9936 328
338 3300048926 Ga0496123_0000897 Ga0496123_0000897_16346_17332 328
339 3300048928 Ga0496125_0010764 Ga0496125_0010764_4343_5329 328
340 3300048929 Ga0496126_0001868 Ga0496126_0001868_26566_27552 328

Structural Annotation

Top 5 Hits

ID Description Score Start End
1es9-assembly1.cif.gz_A-2 x-ray crystal structure of r22k mutant of the mammalian brain platelet-activating factor acetylhydrolases (paf-ah) 0.7094 170 219
2bnj-assembly1.cif.gz_A the xylanase ta from thermoascus aurantiacus utilizes arabinose decorations of xylan as significant substrate specificity determinants. 0.7012 28 319
1i1x-assembly1.cif.gz_A 1.11 a atomic resolution structure of a thermostable xylanase from thermoascus aurantiacus 0.6966 30 319
8usj-assembly3.cif.gz_C crystal structure of kemp eliminase hg198 with bound transition state analogue, 280 k 0.6917 30 319
3wug-assembly1.cif.gz_A the mutant crystal structure of b-1,4-xylanase (xynas9_v43p/g44e) with xylobiose from streptomyces sp. 9 0.691 30 283
ID Description Score Start End Superfamily
af_Q8VYW2_77_527_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.6826 31 319 3.20.20.80
4k9sB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.6792 160 219 3.40.50.1110
3oa3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.6762 31 322 3.20.20.70
af_K7LG54_258_704_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.6671 32 328 3.20.20.80
af_K7WC35_80_528_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.6635 31 328 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A1Y2SH56-F1-model_v4 Uncharacterized protein 0.9895 52 325
AF-A0A1C0U503-F1-model_v4 Uncharacterized protein 0.9864 152 326
AF-A0A1I3LPG4-F1-model_v4 deleted 0.9864 234 328
AF-A0A6N6VXA7-F1-model_v4 Glycoside hydrolase family 42 N-terminal domain-containing protein 0.9832 33 325
AF-A0A455VZK4-F1-model_v4 Uncharacterized protein 0.9822 61 328

Feature Viewer

pLDDT pTM Quality
90.79 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map