F414185
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 340 | 227 | 305 | 319 |
Family's Representative Sequence
| Representative Sequence | 3300003794|Ga0055531_10004540|Ga0055531_100045407 |
| Length | 369 |
| Sequence | MRVMDRYFGVETRQSKRDGTKDGCKWPIRSIIRQSSVLTNFLMNRILCLALVWIGMASALPAFATGSAPANFLYASSGELSAMGVQLQRPDIDGAQIVYNWKTLEKRPGVYDFSAIETDLRIVDALHKKLFIQIQDRFFEPKARNLPRYLLDDPRYGGGLAPQFDNPGENKPVATGWVAQQWNPAVRGRYQKLLQALAKRFDGRIYGVNLPETAIDVDTAADSSGFDCDLYFAAEMENLAAAKKAFKTTKVVQYVNFWPCEWENDRNYMGRLFAYAEANGVGLGGPDIVPNHKSQTKNSYPFFHKYKGKLALVALAVQEPTLTYTNPATHRPFTKAEFVQYASDYLGADIIFWSGASPWLRKAYAPPRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 2 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 3 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 4 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 5 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 6 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 7 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 8 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 9 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 10 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 11 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 12 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 13 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 14 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 15 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 16 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 17 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 18 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 19 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 20 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 21 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 22 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 23 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 24 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 25 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 26 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 27 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 28 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 29 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 30 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 31 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 32 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 33 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 34 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 35 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 36 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 37 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 38 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 39 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 40 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 41 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 42 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 43 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 44 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 45 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 46 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 47 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 48 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 49 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 50 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 51 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 52 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 53 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 54 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 55 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 56 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 57 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 58 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 59 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 60 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 61 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 62 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 63 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 64 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 65 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 66 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 67 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 69 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 74 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 85 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 92 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 101 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 103 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 113 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 114 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 116 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 144 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 151 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 153 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 154 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 155 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 156 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 157 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 158 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 159 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 160 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 161 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 162 | 3300044663 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR | Metagenome | Unclassified |
| 163 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 164 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 165 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 166 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 167 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 168 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 169 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 170 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 202 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 203 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 204 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 205 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 206 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 207 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 208 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 209 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 210 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 211 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 212 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 213 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 214 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 215 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 219 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 220 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 221 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 222 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 223 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 224 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 225 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 226 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 227 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.71 |
| Metatranscriptomes | 0 |
| Isolates | 10.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.76 |
| Nodule | 2.94 |
| Rhizoplane | 1.76 |
| Rhizosphere | 45.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 27.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1009531 | 3300001915 | Bacteria | 1779 |
| 2 | JGI25155J39150_1000284 | 3300002704 | Bacteria | 18276 |
| 3 | JGI25156J39149_1000110 | 3300002705 | Bacteria | 59456 |
| 4 | JGI25156J39149_1001005 | 3300002705 | Bacteria | 13279 |
| 5 | JGI25156J39149_1004996 | 3300002705 | Bacteria | 3917 |
| 6 | JGI25162J39368_1001809 | 3300002737 | Bacteria | 10045 |
| 7 | JGI25154J39366_1000231 | 3300002738 | Bacteria | 37387 |
| 8 | JGI25158J39367_1000065 | 3300002739 | Bacteria | 23421 |
| 9 | JGI25157J39369_1000645 | 3300002741 | Bacteria | 19502 |
| 10 | JGI25157J39369_1000705 | 3300002741 | Bacteria | 18005 |
| 11 | JGI25157J39369_1001065 | 3300002741 | Bacteria | 12420 |
| 12 | JGI25164J39214_1000057 | 3300002772 | Bacteria | 113023 |
| 13 | JGI25152J39213_1006757 | 3300002773 | Bacteria | 3054 |
| 14 | JGI25152J39213_1007562 | 3300002773 | Bacteria | 2797 |
| 15 | JGI25159J45721_1000928 | 3300002987 | Bacteria | 12764 |
| 16 | JGI25151J46595_10000733 | 3300003187 | Bacteria | 27040 |
| 17 | JGI25151J46595_10002293 | 3300003187 | Bacteria | 11705 |
| 18 | JGI25151J46595_10003097 | 3300003187 | Bacteria | 9370 |
| 19 | JGI25165J46597_1000072 | 3300003214 | Bacteria | 192184 |
| 20 | JGI25153J46596_10015749 | 3300003215 | Bacteria | 3062 |
| 21 | rootH1_10117266 | 3300003316 | Bacteria | 2805 |
| 22 | rootH2_10124041 | 3300003320 | Bacteria | 7841 |
| 23 | rootH2_10142869 | 3300003320 | Bacteria | 6160 |
| 24 | rootL2_10156889 | 3300003322 | Bacteria | 1769 |
| 25 | rootH1_10112374 | 3300003323 | Bacteria | 2299 |
| 26 | JGI25161J50226_1000370 | 3300003374 | Bacteria | 22840 |
| 27 | Ga0055532_1000015 | 3300003758 | Bacteria | 340197 |
| 28 | Ga0055525_1000027 | 3300003759 | Bacteria | 340506 |
| 29 | Ga0055527_1000283 | 3300003760 | Bacteria | 29880 |
| 30 | Ga0055527_1001150 | 3300003760 | Bacteria | 6014 |
| 31 | Ga0055535_1000065 | 3300003761 | Bacteria | 115893 |
| 32 | Ga0055535_1000366 | 3300003761 | Bacteria | 43537 |
| 33 | Ga0055535_1001041 | 3300003761 | Bacteria | 17486 |
| 34 | Ga0055542_1000634 | 3300003762 | Bacteria | 29589 |
| 35 | Ga0055542_1000666 | 3300003762 | Bacteria | 27917 |
| 36 | Ga0055529_1000160 | 3300003763 | Bacteria | 92524 |
| 37 | Ga0055529_1000927 | 3300003763 | Bacteria | 15750 |
| 38 | Ga0055526_1018907 | 3300003771 | Bacteria | 2539 |
| 39 | Ga0055526_1025474 | 3300003771 | Bacteria | 1897 |
| 40 | Ga0055534_1011666 | 3300003784 | Bacteria | 1775 |
| 41 | Ga0055528_1000158 | 3300003790 | Bacteria | 56769 |
| 42 | Ga0055540_1001786 | 3300003792 | Bacteria | 12225 |
| 43 | Ga0055531_10004540 | 3300003794 | Bacteria | 8418 |
| 44 | Ga0058692_1003312 | 3300003856 | Bacteria | 5009 |
| 45 | Ga0058692_1005766 | 3300003856 | Bacteria | 3488 |
| 46 | Ga0055543_1000060 | 3300004625 | Bacteria | 98330 |
| 47 | Ga0065704_10000349 | 3300005289 | Bacteria | 28555 |
| 48 | Ga0070676_10073861 | 3300005328 | Bacteria | 2052 |
| 49 | Ga0068869_100185576 | 3300005334 | Bacteria | 1632 |
| 50 | Ga0070682_100023165 | 3300005337 | Bacteria | 3686 |
| 51 | Ga0070682_100189176 | 3300005337 | Bacteria | 1444 |
| 52 | Ga0070668_100058129 | 3300005347 | Bacteria | 2991 |
| 53 | Ga0070675_100017079 | 3300005354 | Bacteria | 5766 |
| 54 | Ga0070675_100025058 | 3300005354 | Bacteria | 4781 |
| 55 | Ga0070674_100035621 | 3300005356 | Bacteria | 3334 |
| 56 | Ga0070674_100141748 | 3300005356 | Bacteria | 1804 |
| 57 | Ga0070688_100096544 | 3300005365 | Bacteria | 1941 |
| 58 | Ga0070659_100004056 | 3300005366 | Bacteria | 10442 |
| 59 | Ga0070659_100091663 | 3300005366 | Bacteria | 2436 |
| 60 | Ga0070678_100029327 | 3300005456 | Bacteria | 3766 |
| 61 | Ga0070678_100167842 | 3300005456 | Bacteria | 1784 |
| 62 | Ga0070686_100220989 | 3300005544 | Unclassified | 1369 |
| 63 | Ga0070665_100001023 | 3300005548 | Bacteria | 35083 |
| 64 | Ga0070665_100079461 | 3300005548 | Bacteria | 3285 |
| 65 | Ga0068857_100000882 | 3300005577 | Bacteria | 22652 |
| 66 | Ga0068857_100175779 | 3300005577 | Bacteria | 1948 |
| 67 | Ga0068870_10008305 | 3300005840 | Bacteria | 4664 |
| 68 | Ga0075367_10100184 | 3300006178 | Bacteria | 1770 |
| 69 | Ga0075366_10004447 | 3300006195 | Bacteria | 7523 |
| 70 | Ga0075370_10003198 | 3300006353 | Bacteria | 7756 |
| 71 | Ga0068871_100005255 | 3300006358 | Bacteria | 9064 |
| 72 | Ga0068871_100097913 | 3300006358 | Bacteria | 2453 |
| 73 | Ga0079104_1001793 | 3300006946 | Bacteria | 13334 |
| 74 | Ga0079104_1002196 | 3300006946 | Bacteria | 10993 |
| 75 | Ga0105251_10000585 | 3300009011 | Bacteria | 33544 |
| 76 | Ga0105251_10014129 | 3300009011 | Bacteria | 4431 |
| 77 | Ga0105244_10000118 | 3300009036 | Bacteria | 83868 |
| 78 | Ga0105244_10000764 | 3300009036 | Bacteria | 27477 |
| 79 | Ga0105244_10049201 | 3300009036 | Bacteria | 2155 |
| 80 | Ga0105240_10071157 | 3300009093 | Bacteria | 4302 |
| 81 | Ga0105243_10002333 | 3300009148 | Bacteria | 15886 |
| 82 | Ga0105243_10169019 | 3300009148 | Bacteria | 1892 |
| 83 | Ga0105242_10077015 | 3300009176 | Bacteria | 2782 |
| 84 | Ga0105248_10254106 | 3300009177 | Bacteria | 1978 |
| 85 | Ga0123341_1000035 | 3300009765 | Bacteria | 62072 |
| 86 | Ga0123342_1036690 | 3300009766 | Bacteria | 2009 |
| 87 | Ga0105246_10017588 | 3300011119 | Bacteria | 4547 |
| 88 | Ga0157373_10174673 | 3300013100 | Bacteria | 1512 |
| 89 | Ga0157371_10007004 | 3300013102 | Bacteria | 9172 |
| 90 | Ga0157370_10006034 | 3300013104 | Bacteria | 13470 |
| 91 | Ga0157375_10270307 | 3300013308 | Unclassified | 1862 |
| 92 | Ga0157380_10263424 | 3300014326 | Bacteria | 1567 |
| 93 | Ga0157376_10221825 | 3300014969 | Bacteria | 1751 |
| 94 | Ga0182006_1020775 | 3300015261 | Bacteria | 2747 |
| 95 | Ga0182007_10006140 | 3300015262 | Bacteria | 5188 |
| 96 | Ga0213872_10000215 | 3300021361 | Bacteria | 51118 |
| 97 | Ga0209435_100021 | 3300025206 | Bacteria | 223961 |
| 98 | Ga0209436_100081 | 3300025208 | Bacteria | 48215 |
| 99 | Ga0209672_100005 | 3300025228 | Bacteria | 1069303 |
| 100 | Ga0209672_100112 | 3300025228 | Bacteria | 92842 |
| 101 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 102 | Ga0209563_100023 | 3300025230 | Bacteria | 636844 |
| 103 | Ga0207427_100055 | 3300025231 | Bacteria | 209093 |
| 104 | Ga0209437_100127 | 3300025233 | Bacteria | 190741 |
| 105 | Ga0209258_100006 | 3300025242 | Bacteria | 1069303 |
| 106 | Ga0209258_100083 | 3300025242 | Bacteria | 246008 |
| 107 | Ga0209258_100139 | 3300025242 | Bacteria | 167268 |
| 108 | Ga0207425_1002006 | 3300025245 | Bacteria | 7600 |
| 109 | Ga0209646_1000074 | 3300025246 | Bacteria | 223961 |
| 110 | Ga0209646_1001398 | 3300025246 | Bacteria | 6582 |
| 111 | Ga0209026_1000058 | 3300025250 | Bacteria | 228656 |
| 112 | Ga0209026_1000108 | 3300025250 | Bacteria | 148837 |
| 113 | Ga0209026_1002581 | 3300025250 | Bacteria | 6664 |
| 114 | Ga0209148_1000012 | 3300025254 | Bacteria | 1069303 |
| 115 | Ga0209148_1000073 | 3300025254 | Bacteria | 320851 |
| 116 | Ga0209759_1000046 | 3300025256 | Bacteria | 230149 |
| 117 | Ga0209759_1000501 | 3300025256 | Bacteria | 42882 |
| 118 | Ga0209759_1007751 | 3300025256 | Bacteria | 3419 |
| 119 | Ga0209129_1000324 | 3300025258 | Bacteria | 42226 |
| 120 | Ga0209129_1002210 | 3300025258 | Bacteria | 9762 |
| 121 | Ga0209129_1005043 | 3300025258 | Bacteria | 4852 |
| 122 | Ga0209233_1000063 | 3300025261 | Bacteria | 395810 |
| 123 | Ga0209455_1000008 | 3300025272 | Bacteria | 1069303 |
| 124 | Ga0209455_1000018 | 3300025272 | Bacteria | 718034 |
| 125 | Ga0209673_1000010 | 3300025273 | Bacteria | 596656 |
| 126 | Ga0209130_1000023 | 3300025284 | Bacteria | 359355 |
| 127 | Ga0209130_1005802 | 3300025284 | Bacteria | 4177 |
| 128 | Ga0209675_1000033 | 3300025291 | Bacteria | 271576 |
| 129 | Ga0209025_1000168 | 3300025294 | Bacteria | 162386 |
| 130 | Ga0209025_1002028 | 3300025294 | Bacteria | 23124 |
| 131 | Ga0209025_1031437 | 3300025294 | Bacteria | 2511 |
| 132 | Ga0209564_1004488 | 3300025295 | Bacteria | 8515 |
| 133 | Ga0209758_1012156 | 3300025297 | Bacteria | 4858 |
| 134 | Ga0209758_1043316 | 3300025297 | Bacteria | 1659 |
| 135 | Ga0209256_1000704 | 3300025299 | Bacteria | 44504 |
| 136 | Ga0207426_1000008 | 3300025302 | Bacteria | 848730 |
| 137 | Ga0209257_1000197 | 3300025304 | Bacteria | 149491 |
| 138 | Ga0207655_1001261 | 3300025728 | Bacteria | 24132 |
| 139 | Ga0207655_1001330 | 3300025728 | Bacteria | 23320 |
| 140 | Ga0207713_1000004 | 3300025735 | Bacteria | 702781 |
| 141 | Ga0207713_1004229 | 3300025735 | Bacteria | 9392 |
| 142 | Ga0207713_1006656 | 3300025735 | Bacteria | 6994 |
| 143 | Ga0207713_1023016 | 3300025735 | Bacteria | 2942 |
| 144 | Ga0207713_1039725 | 3300025735 | Bacteria | 1982 |
| 145 | Ga0207713_1058793 | 3300025735 | Bacteria | 1479 |
| 146 | Ga0207682_10026825 | 3300025893 | Bacteria | 2292 |
| 147 | Ga0207682_10029945 | 3300025893 | Bacteria | 2178 |
| 148 | Ga0207643_10009226 | 3300025908 | Bacteria | 5299 |
| 149 | Ga0207695_10079616 | 3300025913 | Bacteria | 3320 |
| 150 | Ga0207659_10040110 | 3300025926 | Bacteria | 3271 |
| 151 | Ga0207690_10154359 | 3300025932 | Bacteria | 1705 |
| 152 | Ga0207709_10034963 | 3300025935 | Bacteria | 2966 |
| 153 | Ga0207669_10072258 | 3300025937 | Bacteria | 2171 |
| 154 | Ga0207704_10203125 | 3300025938 | Bacteria | 1452 |
| 155 | Ga0207691_10007572 | 3300025940 | Bacteria | 10452 |
| 156 | Ga0207691_10007865 | 3300025940 | Bacteria | 10269 |
| 157 | Ga0207689_10013289 | 3300025942 | Bacteria | 7023 |
| 158 | Ga0207648_10575921 | 3300026089 | Bacteria | 1036 |
| 159 | Ga0207674_10002548 | 3300026116 | Bacteria | 22961 |
| 160 | Ga0207674_10101486 | 3300026116 | Bacteria | 2858 |
| 161 | Ga0207683_10032836 | 3300026121 | Bacteria | 4509 |
| 162 | Ga0207683_10124321 | 3300026121 | Bacteria | 2318 |
| 163 | Ga0209281_1000143 | 3300027111 | Bacteria | 174070 |
| 164 | Ga0209281_1000222 | 3300027111 | Bacteria | 121388 |
| 165 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 166 | Ga0209371_1001025 | 3300027312 | Bacteria | 21208 |
| 167 | Ga0268266_10000902 | 3300028379 | Bacteria | 38407 |
| 168 | Ga0268265_10030460 | 3300028380 | Bacteria | 3886 |
| 169 | Ga0265338_10073700 | 3300028800 | Unclassified | 2908 |
| 170 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 171 | Ga0268256_1000866 | 3300030500 | Bacteria | 21139 |
| 172 | Ga0265339_10009907 | 3300031249 | Bacteria | 5951 |
| 173 | Ga0307513_10013048 | 3300031456 | Bacteria | 10218 |
| 174 | Ga0307513_10187735 | 3300031456 | Bacteria | 1922 |
| 175 | Ga0265314_10013767 | 3300031711 | Bacteria | 6519 |
| 176 | Ga0307409_100022511 | 3300031995 | Bacteria | 4347 |
| 177 | Ga0395899_0000108 | 3300037312 | Bacteria | 142347 |
| 178 | Ga0395899_0055290 | 3300037312 | Bacteria | 2936 |
| 179 | Ga0395900_0000144 | 3300037418 | Bacteria | 119971 |
| 180 | Ga0395898_0000018 | 3300037466 | Bacteria | 418600 |
| 181 | Ga0395898_0000049 | 3300037466 | Bacteria | 284792 |
| 182 | Ga0395901_0137006 | 3300038443 | Bacteria | 2572 |
| 183 | Ga0436361_0739768 | 3300039447 | Bacteria | 83506 |
| 184 | Ga0451847_0995215 | 3300041503 | Bacteria | 1622 |
| 185 | Ga0451853_2296880 | 3300041512 | Bacteria | 1834 |
| 186 | Ga0439452_000014 | 3300042010 | Bacteria | 344969 |
| 187 | Ga0466969_0008099 | 3300044656 | Bacteria | 5578 |
| 188 | Ga0466969_0011629 | 3300044656 | Bacteria | 4655 |
| 189 | Ga0466989_0114959 | 3300044663 | Bacteria | 1647 |
| 190 | Ga0466981_0000004 | 3300044669 | Bacteria | 171461 |
| 191 | Ga0466965_0095914 | 3300044683 | Bacteria | 1513 |
| 192 | Ga0466966_0034861 | 3300044684 | Bacteria | 3253 |
| 193 | Ga0466966_0171421 | 3300044684 | Bacteria | 1318 |
| 194 | Ga0466961_0007745 | 3300044693 | Bacteria | 6838 |
| 195 | Ga0466961_0019590 | 3300044693 | Bacteria | 4353 |
| 196 | Ga0466970_0012901 | 3300044765 | Bacteria | 4278 |
| 197 | Ga0466959_0000042 | 3300045049 | Bacteria | 98655 |
| 198 | Ga0466959_0006665 | 3300045049 | Bacteria | 8026 |
| 199 | Ga0466958_0003044 | 3300045836 | Bacteria | 8595 |
| 200 | Ga0466958_0127648 | 3300045836 | Bacteria | 1595 |
| 201 | Ga0495627_036481 | 3300046453 | Bacteria | 1528 |
| 202 | Ga0495590_0002019 | 3300046457 | Bacteria | 8536 |
| 203 | Ga0495591_007685 | 3300046458 | Bacteria | 4537 |
| 204 | Ga0495638_0000790 | 3300046460 | Bacteria | 33426 |
| 205 | Ga0495650_0000005 | 3300046471 | Bacteria | 766553 |
| 206 | Ga0495650_0002819 | 3300046471 | Bacteria | 13338 |
| 207 | Ga0495605_0000060 | 3300046474 | Bacteria | 145530 |
| 208 | Ga0495585_0154875 | 3300046492 | Bacteria | 1193 |
| 209 | Ga0495594_0004846 | 3300046499 | Bacteria | 6929 |
| 210 | Ga0495596_0011948 | 3300046500 | Bacteria | 3727 |
| 211 | Ga0495583_0000566 | 3300046506 | Bacteria | 51163 |
| 212 | Ga0495610_0005477 | 3300046512 | Bacteria | 9009 |
| 213 | Ga0495616_0032530 | 3300046513 | Bacteria | 2724 |
| 214 | Ga0495620_0000145 | 3300046515 | Bacteria | 58063 |
| 215 | Ga0495631_0001553 | 3300046518 | Bacteria | 13821 |
| 216 | Ga0495648_0025691 | 3300046524 | Bacteria | 3981 |
| 217 | Ga0495663_0021061 | 3300046525 | Bacteria | 1875 |
| 218 | Ga0495654_0001559 | 3300046530 | Bacteria | 15555 |
| 219 | Ga0495609_0000390 | 3300046538 | Bacteria | 37062 |
| 220 | Ga0495597_0003388 | 3300046542 | Bacteria | 9341 |
| 221 | Ga0495633_0000286 | 3300046558 | Bacteria | 58029 |
| 222 | Ga0495611_0000684 | 3300046648 | Bacteria | 19313 |
| 223 | Ga0495661_0000684 | 3300046665 | Bacteria | 33807 |
| 224 | Ga0495671_0004591 | 3300046692 | Bacteria | 8217 |
| 225 | Ga0495649_0003627 | 3300046694 | Bacteria | 10305 |
| 226 | Ga0495589_0001657 | 3300046794 | Bacteria | 12759 |
| 227 | Ga0495660_0001058 | 3300046810 | Bacteria | 19921 |
| 228 | Ga0495672_0034814 | 3300047320 | Bacteria | 3108 |
| 229 | Ga0495683_0000020 | 3300047323 | Bacteria | 181773 |
| 230 | Ga0495679_000636 | 3300047446 | Bacteria | 23583 |
| 231 | Ga0495673_0009339 | 3300047469 | Bacteria | 5434 |
| 232 | Ga0495681_0006824 | 3300047470 | Bacteria | 7422 |
| 233 | Ga0496104_0001201 | 3300048907 | Bacteria | 22311 |
| 234 | Ga0496105_0028754 | 3300048908 | Bacteria | 4547 |
| 235 | Ga0496106_0002317 | 3300048909 | Bacteria | 14193 |
| 236 | Ga0496116_0000022 | 3300048919 | Bacteria | 482506 |
| 237 | Ga0496116_0000324 | 3300048919 | Bacteria | 78414 |
| 238 | Ga0496116_0004836 | 3300048919 | Bacteria | 12705 |
| 239 | Ga0496117_0000020 | 3300048920 | Bacteria | 458405 |
| 240 | Ga0496117_0000064 | 3300048920 | Bacteria | 254248 |
| 241 | Ga0496117_0002340 | 3300048920 | Bacteria | 24240 |
| 242 | Ga0496117_0138030 | 3300048920 | Bacteria | 1465 |
| 243 | Ga0496118_0000015 | 3300048921 | Bacteria | 551359 |
| 244 | Ga0496118_0002371 | 3300048921 | Bacteria | 25492 |
| 245 | Ga0496118_0039466 | 3300048921 | Bacteria | 3766 |
| 246 | Ga0496118_0069535 | 3300048921 | Bacteria | 2548 |
| 247 | Ga0496119_0000025 | 3300048922 | Bacteria | 257069 |
| 248 | Ga0496119_0001846 | 3300048922 | Bacteria | 24477 |
| 249 | Ga0496119_0009249 | 3300048922 | Bacteria | 8489 |
| 250 | Ga0496119_0015967 | 3300048922 | Bacteria | 5744 |
| 251 | Ga0496119_0072665 | 3300048922 | Bacteria | 2009 |
| 252 | Ga0496120_0001141 | 3300048923 | Bacteria | 34252 |
| 253 | Ga0496120_0003129 | 3300048923 | Bacteria | 15502 |
| 254 | Ga0496120_0017533 | 3300048923 | Bacteria | 4639 |
| 255 | Ga0496121_0008883 | 3300048924 | Bacteria | 11681 |
| 256 | Ga0496121_0012458 | 3300048924 | Bacteria | 9267 |
| 257 | Ga0496121_0019887 | 3300048924 | Bacteria | 6685 |
| 258 | Ga0496121_0050831 | 3300048924 | Bacteria | 3497 |
| 259 | Ga0496121_0055881 | 3300048924 | Bacteria | 3284 |
| 260 | Ga0496121_0128557 | 3300048924 | Bacteria | 1900 |
| 261 | Ga0496121_0272313 | 3300048924 | Bacteria | 1163 |
| 262 | Ga0496122_0001362 | 3300048925 | Bacteria | 39760 |
| 263 | Ga0496122_0001579 | 3300048925 | Bacteria | 35800 |
| 264 | Ga0496122_0008783 | 3300048925 | Bacteria | 10795 |
| 265 | Ga0496122_0010965 | 3300048925 | Bacteria | 9262 |
| 266 | Ga0496122_0011333 | 3300048925 | Bacteria | 9047 |
| 267 | Ga0496122_0097162 | 3300048925 | Bacteria | 1983 |
| 268 | Ga0496122_0126211 | 3300048925 | Bacteria | 1637 |
| 269 | Ga0496123_0000897 | 3300048926 | Bacteria | 47137 |
| 270 | Ga0496123_0004805 | 3300048926 | Bacteria | 13947 |
| 271 | Ga0496123_0006963 | 3300048926 | Bacteria | 10795 |
| 272 | Ga0496123_0019928 | 3300048926 | Bacteria | 5264 |
| 273 | Ga0496123_0035439 | 3300048926 | Bacteria | 3556 |
| 274 | Ga0496123_0041773 | 3300048926 | Bacteria | 3173 |
| 275 | Ga0496124_0000287 | 3300048927 | Bacteria | 95238 |
| 276 | Ga0496124_0000505 | 3300048927 | Bacteria | 67090 |
| 277 | Ga0496124_0000935 | 3300048927 | Bacteria | 46956 |
| 278 | Ga0496124_0007031 | 3300048927 | Bacteria | 12055 |
| 279 | Ga0496124_0089603 | 3300048927 | Bacteria | 2511 |
| 280 | Ga0496124_0144897 | 3300048927 | Bacteria | 1870 |
| 281 | Ga0496125_0000662 | 3300048928 | Bacteria | 57446 |
| 282 | Ga0496125_0001043 | 3300048928 | Bacteria | 42850 |
| 283 | Ga0496125_0010764 | 3300048928 | Bacteria | 9213 |
| 284 | Ga0496125_0030810 | 3300048928 | Bacteria | 4791 |
| 285 | Ga0496125_0069309 | 3300048928 | Bacteria | 2768 |
| 286 | Ga0496126_0000349 | 3300048929 | Bacteria | 96786 |
| 287 | Ga0496126_0001868 | 3300048929 | Bacteria | 30681 |
| 288 | Ga0496126_0002334 | 3300048929 | Bacteria | 26008 |
| 289 | Ga0496126_0186914 | 3300048929 | Bacteria | 1756 |
| 290 | Ga0496126_0320297 | 3300048929 | Bacteria | 1274 |
| 291 | Ga0496126_0408753 | 3300048929 | Bacteria | 1099 |
| 292 | Ga0495678_000077 | 3300049459 | Bacteria | 125025 |
| 293 | Ga0501043_0118753 | 3300049579 | Bacteria | 2074 |
| 294 | Ga0501035_0253310 | 3300049822 | Bacteria | 1494 |
| 295 | nmdc:mga06z11_75473_c1 | 3300050494 | Bacteria | 1795 |
| 296 | nmdc:mga07m45_23981_c1 | 3300050496 | Bacteria | 3338 |
| 297 | Ga0500643_003643 | 3300053087 | Bacteria | 7297 |
| 298 | Ga0500643_043203 | 3300053087 | Bacteria | 1315 |
| 299 | Ga0500555_026287 | 3300053103 | Bacteria | 1664 |
| 300 | Ga0500658_0010036 | 3300053134 | Bacteria | 3495 |
| 301 | Ga0500568_0001419 | 3300053139 | Bacteria | 15537 |
| 302 | Ga0500616_0003746 | 3300053153 | Bacteria | 11341 |
| 303 | Ga0500622_0000597 | 3300053156 | Bacteria | 32786 |
| 304 | Ga0466962_0069659 | 3300061719 | Bacteria | 1680 |
| 305 | Ga0466962_0081619 | 3300061719 | Bacteria | 1546 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044683 | Ga0466965_0095914 | Ga0466965_0095914_601_1500 | 298 |
| 2 | 3300003187 | JGI25151J46595_10000733 | JGI25151J46595_1000073327 | 300 |
| 3 | 3300006178 | Ga0075367_10100184 | Ga0075367_101001841 | 300 |
| 4 | 3300002773 | JGI25152J39213_1007562 | JGI25152J39213_10075623 | 301 |
| 5 | 3300003187 | JGI25151J46595_10003097 | JGI25151J46595_100030975 | 301 |
| 6 | 3300025258 | Ga0209129_1000324 | Ga0209129_100032431 | 301 |
| 7 | 3300025294 | Ga0209025_1002028 | Ga0209025_100202819 | 301 |
| 8 | 3300011119 | Ga0105246_10017588 | Ga0105246_100175886 | 303 |
| 9 | 3300048920 | Ga0496117_0138030 | Ga0496117_0138030_167_1126 | 303 |
| 10 | 3300048921 | Ga0496118_0039466 | Ga0496118_0039466_576_1535 | 303 |
| 11 | 3300048929 | Ga0496126_0408753 | Ga0496126_0408753_33_992 | 303 |
| 12 | 3300031249 | Ga0265339_10009907 | Ga0265339_100099073 | 305 |
| 13 | 3300031711 | Ga0265314_10013767 | Ga0265314_100137671 | 305 |
| 14 | 3300005337 | Ga0070682_100023165 | Ga0070682_1000231652 | 306 |
| 15 | 3300037312 | Ga0395899_0000108 | Ga0395899_0000108_125510_126433 | 306 |
| 16 | 3300037418 | Ga0395900_0000144 | Ga0395900_0000144_72540_73463 | 306 |
| 17 | 3300037466 | Ga0395898_0000018 | Ga0395898_0000018_288177_289100 | 306 |
| 18 | 3300038443 | Ga0395901_0137006 | Ga0395901_0137006_196_1119 | 306 |
| 19 | 3300009765 | Ga0123341_1000035 | Ga0123341_100003557 | 307 |
| 20 | 3300009766 | Ga0123342_1036690 | Ga0123342_10366901 | 307 |
| 21 | 3300044669 | Ga0466981_0000004 | Ga0466981_0000004_58371_59333 | 307 |
| 22 | 3300003771 | Ga0055526_1018907 | Ga0055526_10189071 | 308 |
| 23 | 3300003771 | Ga0055526_1025474 | Ga0055526_10254742 | 308 |
| 24 | 3300003790 | Ga0055528_1000158 | Ga0055528_100015825 | 308 |
| 25 | 3300025273 | Ga0209673_1000010 | Ga0209673_1000010537 | 308 |
| 26 | 3300025295 | Ga0209564_1004488 | Ga0209564_10044883 | 308 |
| 27 | 3300025299 | Ga0209256_1000704 | Ga0209256_100070438 | 308 |
| 28 | 3300048924 | Ga0496121_0272313 | Ga0496121_0272313_60_1013 | 308 |
| 29 | 3300002773 | JGI25152J39213_1006757 | JGI25152J39213_10067572 | 309 |
| 30 | 3300003215 | JGI25153J46596_10015749 | JGI25153J46596_100157492 | 309 |
| 31 | 3300009177 | Ga0105248_10254106 | Ga0105248_102541063 | 309 |
| 32 | 3300014969 | Ga0157376_10221825 | Ga0157376_102218252 | 309 |
| 33 | 3300025245 | Ga0207425_1002006 | Ga0207425_10020065 | 309 |
| 34 | 3300025258 | Ga0209129_1005043 | Ga0209129_10050433 | 309 |
| 35 | 3300025297 | Ga0209758_1012156 | Ga0209758_10121563 | 309 |
| 36 | 3300041512 | Ga0451853_2296880 | Ga0451853_2296880_390_1343 | 309 |
| 37 | 3300048924 | Ga0496121_0128557 | Ga0496121_0128557_146_1105 | 309 |
| 38 | iso_pu_bacteria | 2588254257 | 2590612134 | 309 |
| 39 | 3300046694 | Ga0495649_0003627 | Ga0495649_0003627_3013_3954 | 310 |
| 40 | 3300044656 | Ga0466969_0008099 | Ga0466969_0008099_183_1127 | 311 |
| 41 | 3300044663 | Ga0466989_0114959 | Ga0466989_0114959_470_1414 | 311 |
| 42 | 3300044684 | Ga0466966_0034861 | Ga0466966_0034861_1735_2679 | 311 |
| 43 | 3300044693 | Ga0466961_0007745 | Ga0466961_0007745_5697_6641 | 311 |
| 44 | 3300045049 | Ga0466959_0006665 | Ga0466959_0006665_6238_7182 | 311 |
| 45 | 3300046453 | Ga0495627_036481 | Ga0495627_036481_322_1341 | 311 |
| 46 | 3300046457 | Ga0495590_0002019 | Ga0495590_0002019_6240_7181 | 311 |
| 47 | 3300061719 | Ga0466962_0081619 | Ga0466962_0081619_52_996 | 311 |
| 48 | 3300009036 | Ga0105244_10000118 | Ga0105244_1000011810 | 312 |
| 49 | 3300041503 | Ga0451847_0995215 | Ga0451847_0995215_547_1500 | 312 |
| 50 | 3300048920 | Ga0496117_0002340 | Ga0496117_0002340_22823_23764 | 312 |
| 51 | 3300048921 | Ga0496118_0069535 | Ga0496118_0069535_631_1572 | 312 |
| 52 | 3300048925 | Ga0496122_0126211 | Ga0496122_0126211_530_1471 | 312 |
| 53 | 3300048927 | Ga0496124_0000935 | Ga0496124_0000935_858_1799 | 312 |
| 54 | 3300048928 | Ga0496125_0001043 | Ga0496125_0001043_6062_7003 | 312 |
| 55 | iso_pu_bacteria | 2857504554 | 2857506097 | 312 |
| 56 | 3300002739 | JGI25158J39367_1000065 | JGI25158J39367_10000653 | 313 |
| 57 | 3300002987 | JGI25159J45721_1000928 | JGI25159J45721_100092814 | 313 |
| 58 | 3300003316 | rootH1_10117266 | rootH1_101172664 | 313 |
| 59 | 3300003374 | JGI25161J50226_1000370 | JGI25161J50226_100037024 | 313 |
| 60 | 3300004625 | Ga0055543_1000060 | Ga0055543_100006032 | 313 |
| 61 | 3300005544 | Ga0070686_100220989 | Ga0070686_1002209892 | 313 |
| 62 | 3300025208 | Ga0209436_100081 | Ga0209436_10008117 | 313 |
| 63 | 3300025284 | Ga0209130_1000023 | Ga0209130_100002326 | 313 |
| 64 | 3300025302 | Ga0207426_1000008 | Ga0207426_100000845 | 313 |
| 65 | 3300045836 | Ga0466958_0003044 | Ga0466958_0003044_479_1432 | 313 |
| 66 | 3300053103 | Ga0500555_026287 | Ga0500555_026287_348_1376 | 313 |
| 67 | iso_pu_bacteria | 2889790730 | 2889796074 | 313 |
| 68 | iso_pu_bacteria | 2889914905 | 2889919881 | 313 |
| 69 | 3300002705 | JGI25156J39149_1004996 | JGI25156J39149_10049964 | 314 |
| 70 | 3300002741 | JGI25157J39369_1000645 | JGI25157J39369_100064513 | 314 |
| 71 | 3300006358 | Ga0068871_100097913 | Ga0068871_1000979133 | 314 |
| 72 | 3300025250 | Ga0209026_1000108 | Ga0209026_100010839 | 314 |
| 73 | 3300025256 | Ga0209759_1000501 | Ga0209759_100050132 | 314 |
| 74 | 3300031456 | Ga0307513_10013048 | Ga0307513_100130488 | 314 |
| 75 | 3300031456 | Ga0307513_10187735 | Ga0307513_101877352 | 314 |
| 76 | 3300048927 | Ga0496124_0089603 | Ga0496124_0089603_256_1332 | 314 |
| 77 | 3300048928 | Ga0496125_0030810 | Ga0496125_0030810_2168_3244 | 314 |
| 78 | 3300053087 | Ga0500643_003643 | Ga0500643_003643_743_1762 | 314 |
| 79 | iso_pu_bacteria | 2667528172 | 2671101967 | 314 |
| 80 | iso_pu_bacteria | 2681812866 | 2681997162 | 314 |
| 81 | iso_pu_bacteria | 2681812869 | 2682005563 | 314 |
| 82 | iso_pu_bacteria | 2751185917 | 2753856132 | 314 |
| 83 | iso_pu_bacteria | 2765235842 | 2765589088 | 314 |
| 84 | iso_pu_bacteria | 2775506706 | 2775539193 | 314 |
| 85 | iso_pu_bacteria | 2821118458 | 2821119966 | 314 |
| 86 | iso_pu_bacteria | 2823373977 | 2823374887 | 314 |
| 87 | iso_pu_bacteria | 2927833300 | 2927833941 | 314 |
| 88 | iso_pu_bacteria | 2974310843 | 2974311975 | 314 |
| 89 | iso_pu_bacteria | 3005409236 | 3005414293 | 314 |
| 90 | iso_pu_bacteria | 8018405270 | 8018407643 | 314 |
| 91 | 3300003759 | Ga0055525_1000027 | Ga0055525_1000027127 | 315 |
| 92 | 3300003760 | Ga0055527_1000283 | Ga0055527_100028319 | 315 |
| 93 | 3300003761 | Ga0055535_1000065 | Ga0055535_100006587 | 315 |
| 94 | 3300003763 | Ga0055529_1000927 | Ga0055529_10009275 | 315 |
| 95 | 3300005577 | Ga0068857_100175779 | Ga0068857_1001757793 | 315 |
| 96 | 3300025230 | Ga0209563_100023 | Ga0209563_100023289 | 315 |
| 97 | 3300026116 | Ga0207674_10101486 | Ga0207674_101014864 | 315 |
| 98 | 3300037312 | Ga0395899_0055290 | Ga0395899_0055290_64_1020 | 315 |
| 99 | 3300037466 | Ga0395898_0000049 | Ga0395898_0000049_155016_155972 | 315 |
| 100 | 3300053156 | Ga0500622_0000597 | Ga0500622_0000597_16892_17989 | 315 |
| 101 | iso_pu_bacteria | 2509276033 | 2509447380 | 315 |
| 102 | iso_pu_bacteria | 2534681796 | 2535517138 | 315 |
| 103 | iso_pu_bacteria | 2582581278 | 2585141388 | 315 |
| 104 | iso_pu_bacteria | 2585428045 | 2587678371 | 315 |
| 105 | iso_pu_bacteria | 2585428060 | 2587749237 | 315 |
| 106 | iso_pu_bacteria | 2585428182 | 2588208005 | 315 |
| 107 | iso_pu_bacteria | 2588253712 | 2588446623 | 315 |
| 108 | iso_pu_bacteria | 2588254255 | 2590600593 | 315 |
| 109 | iso_pu_bacteria | 2643221634 | 2644191788 | 315 |
| 110 | iso_pu_bacteria | 2739367874 | 2740057919 | 315 |
| 111 | iso_pu_bacteria | 2791355259 | 2793318172 | 315 |
| 112 | iso_pu_bacteria | 2816332188 | 2816873157 | 315 |
| 113 | iso_pu_bacteria | 2871720351 | 2871722720 | 315 |
| 114 | iso_pu_bacteria | 2889290771 | 2889291470 | 315 |
| 115 | iso_pu_bacteria | 2919100787 | 2919106184 | 315 |
| 116 | iso_pu_bacteria | 3005445848 | 3005448721 | 315 |
| 117 | 3300002704 | JGI25155J39150_1000284 | JGI25155J39150_10002848 | 316 |
| 118 | 3300002705 | JGI25156J39149_1000110 | JGI25156J39149_100011039 | 316 |
| 119 | 3300002738 | JGI25154J39366_1000231 | JGI25154J39366_100023119 | 316 |
| 120 | 3300002741 | JGI25157J39369_1000705 | JGI25157J39369_100070516 | 316 |
| 121 | 3300003758 | Ga0055532_1000015 | Ga0055532_1000015307 | 316 |
| 122 | 3300005337 | Ga0070682_100189176 | Ga0070682_1001891762 | 316 |
| 123 | 3300006358 | Ga0068871_100005255 | Ga0068871_1000052553 | 316 |
| 124 | 3300013308 | Ga0157375_10270307 | Ga0157375_102703071 | 316 |
| 125 | 3300021361 | Ga0213872_10000215 | Ga0213872_100002157 | 316 |
| 126 | 3300025206 | Ga0209435_100021 | Ga0209435_100021159 | 316 |
| 127 | 3300025229 | Ga0209147_100004 | Ga0209147_100004871 | 316 |
| 128 | 3300025242 | Ga0209258_100083 | Ga0209258_10008338 | 316 |
| 129 | 3300025246 | Ga0209646_1000074 | Ga0209646_1000074159 | 316 |
| 130 | 3300025250 | Ga0209026_1000058 | Ga0209026_100005844 | 316 |
| 131 | 3300025256 | Ga0209759_1000046 | Ga0209759_100004643 | 316 |
| 132 | 3300039447 | Ga0436361_0739768 | Ga0436361_0739768_38387_39346 | 316 |
| 133 | 3300053134 | Ga0500658_0010036 | Ga0500658_0010036_2390_3418 | 316 |
| 134 | 3300003320 | rootH2_10124041 | rootH2_101240416 | 317 |
| 135 | 3300003784 | Ga0055534_1011666 | Ga0055534_10116661 | 317 |
| 136 | 3300005328 | Ga0070676_10073861 | Ga0070676_100738612 | 317 |
| 137 | 3300005347 | Ga0070668_100058129 | Ga0070668_1000581292 | 317 |
| 138 | 3300005354 | Ga0070675_100017079 | Ga0070675_1000170791 | 317 |
| 139 | 3300005356 | Ga0070674_100141748 | Ga0070674_1001417482 | 317 |
| 140 | 3300005365 | Ga0070688_100096544 | Ga0070688_1000965443 | 317 |
| 141 | 3300005456 | Ga0070678_100029327 | Ga0070678_1000293272 | 317 |
| 142 | 3300009036 | Ga0105244_10000764 | Ga0105244_1000076422 | 317 |
| 143 | 3300025284 | Ga0209130_1005802 | Ga0209130_10058022 | 317 |
| 144 | 3300025291 | Ga0209675_1000033 | Ga0209675_1000033252 | 317 |
| 145 | 3300025294 | Ga0209025_1031437 | Ga0209025_10314372 | 317 |
| 146 | 3300025728 | Ga0207655_1001261 | Ga0207655_100126120 | 317 |
| 147 | 3300025893 | Ga0207682_10029945 | Ga0207682_100299453 | 317 |
| 148 | 3300046458 | Ga0495591_007685 | Ga0495591_007685_2816_3769 | 317 |
| 149 | 3300046471 | Ga0495650_0002819 | Ga0495650_0002819_6268_7221 | 317 |
| 150 | 3300046474 | Ga0495605_0000060 | Ga0495605_0000060_103335_104288 | 317 |
| 151 | 3300046499 | Ga0495594_0004846 | Ga0495594_0004846_3641_4594 | 317 |
| 152 | 3300046506 | Ga0495583_0000566 | Ga0495583_0000566_15562_16515 | 317 |
| 153 | 3300046512 | Ga0495610_0005477 | Ga0495610_0005477_915_1868 | 317 |
| 154 | 3300046515 | Ga0495620_0000145 | Ga0495620_0000145_42155_43108 | 317 |
| 155 | 3300046518 | Ga0495631_0001553 | Ga0495631_0001553_5137_6090 | 317 |
| 156 | 3300046524 | Ga0495648_0025691 | Ga0495648_0025691_935_1888 | 317 |
| 157 | 3300046530 | Ga0495654_0001559 | Ga0495654_0001559_8510_9463 | 317 |
| 158 | 3300046538 | Ga0495609_0000390 | Ga0495609_0000390_20551_21504 | 317 |
| 159 | 3300046558 | Ga0495633_0000286 | Ga0495633_0000286_15003_15956 | 317 |
| 160 | 3300046648 | Ga0495611_0000684 | Ga0495611_0000684_10695_11648 | 317 |
| 161 | 3300046665 | Ga0495661_0000684 | Ga0495661_0000684_17610_18563 | 317 |
| 162 | 3300046692 | Ga0495671_0004591 | Ga0495671_0004591_7141_8094 | 317 |
| 163 | 3300046794 | Ga0495589_0001657 | Ga0495589_0001657_6559_7512 | 317 |
| 164 | 3300046810 | Ga0495660_0001058 | Ga0495660_0001058_89_1042 | 317 |
| 165 | 3300047323 | Ga0495683_0000020 | Ga0495683_0000020_41731_42684 | 317 |
| 166 | 3300047446 | Ga0495679_000636 | Ga0495679_000636_7969_8922 | 317 |
| 167 | 3300047469 | Ga0495673_0009339 | Ga0495673_0009339_840_1793 | 317 |
| 168 | 3300047470 | Ga0495681_0006824 | Ga0495681_0006824_1865_2818 | 317 |
| 169 | 3300048924 | Ga0496121_0050831 | Ga0496121_0050831_587_1540 | 317 |
| 170 | 3300048925 | Ga0496122_0097162 | Ga0496122_0097162_345_1298 | 317 |
| 171 | 3300048926 | Ga0496123_0041773 | Ga0496123_0041773_769_1722 | 317 |
| 172 | 3300048928 | Ga0496125_0000662 | Ga0496125_0000662_2843_3850 | 317 |
| 173 | 3300049459 | Ga0495678_000077 | Ga0495678_000077_19409_20362 | 317 |
| 174 | 3300002705 | JGI25156J39149_1001005 | JGI25156J39149_100100512 | 318 |
| 175 | 3300002737 | JGI25162J39368_1001809 | JGI25162J39368_10018099 | 318 |
| 176 | 3300002741 | JGI25157J39369_1001065 | JGI25157J39369_100106511 | 318 |
| 177 | 3300002772 | JGI25164J39214_1000057 | JGI25164J39214_100005774 | 318 |
| 178 | 3300003214 | JGI25165J46597_1000072 | JGI25165J46597_1000072139 | 318 |
| 179 | 3300003760 | Ga0055527_1001150 | Ga0055527_10011505 | 318 |
| 180 | 3300003761 | Ga0055535_1000366 | Ga0055535_100036636 | 318 |
| 181 | 3300003761 | Ga0055535_1001041 | Ga0055535_10010417 | 318 |
| 182 | 3300003762 | Ga0055542_1000634 | Ga0055542_100063419 | 318 |
| 183 | 3300003762 | Ga0055542_1000666 | Ga0055542_100066618 | 318 |
| 184 | 3300003763 | Ga0055529_1000160 | Ga0055529_100016015 | 318 |
| 185 | 3300003856 | Ga0058692_1003312 | Ga0058692_10033127 | 318 |
| 186 | 3300003856 | Ga0058692_1005766 | Ga0058692_10057664 | 318 |
| 187 | 3300005289 | Ga0065704_10000349 | Ga0065704_1000034924 | 318 |
| 188 | 3300005366 | Ga0070659_100091663 | Ga0070659_1000916632 | 318 |
| 189 | 3300005548 | Ga0070665_100001023 | Ga0070665_10000102310 | 318 |
| 190 | 3300005577 | Ga0068857_100000882 | Ga0068857_10000088219 | 318 |
| 191 | 3300006946 | Ga0079104_1001793 | Ga0079104_10017939 | 318 |
| 192 | 3300006946 | Ga0079104_1002196 | Ga0079104_10021969 | 318 |
| 193 | 3300009011 | Ga0105251_10000585 | Ga0105251_1000058535 | 318 |
| 194 | 3300009011 | Ga0105251_10014129 | Ga0105251_100141296 | 318 |
| 195 | 3300009036 | Ga0105244_10049201 | Ga0105244_100492013 | 318 |
| 196 | 3300013100 | Ga0157373_10174673 | Ga0157373_101746732 | 318 |
| 197 | 3300013102 | Ga0157371_10007004 | Ga0157371_100070048 | 318 |
| 198 | 3300013104 | Ga0157370_10006034 | Ga0157370_100060347 | 318 |
| 199 | 3300025228 | Ga0209672_100005 | Ga0209672_100005630 | 318 |
| 200 | 3300025228 | Ga0209672_100112 | Ga0209672_10011273 | 318 |
| 201 | 3300025231 | Ga0207427_100055 | Ga0207427_10005572 | 318 |
| 202 | 3300025233 | Ga0209437_100127 | Ga0209437_1001274 | 318 |
| 203 | 3300025242 | Ga0209258_100006 | Ga0209258_100006630 | 318 |
| 204 | 3300025242 | Ga0209258_100139 | Ga0209258_100139139 | 318 |
| 205 | 3300025246 | Ga0209646_1001398 | Ga0209646_10013985 | 318 |
| 206 | 3300025250 | Ga0209026_1002581 | Ga0209026_10025816 | 318 |
| 207 | 3300025254 | Ga0209148_1000012 | Ga0209148_1000012630 | 318 |
| 208 | 3300025254 | Ga0209148_1000073 | Ga0209148_1000073155 | 318 |
| 209 | 3300025256 | Ga0209759_1007751 | Ga0209759_10077515 | 318 |
| 210 | 3300025261 | Ga0209233_1000063 | Ga0209233_1000063222 | 318 |
| 211 | 3300025272 | Ga0209455_1000008 | Ga0209455_1000008630 | 318 |
| 212 | 3300025272 | Ga0209455_1000018 | Ga0209455_1000018574 | 318 |
| 213 | 3300025728 | Ga0207655_1001330 | Ga0207655_100133012 | 318 |
| 214 | 3300025735 | Ga0207713_1000004 | Ga0207713_1000004699 | 318 |
| 215 | 3300025735 | Ga0207713_1004229 | Ga0207713_10042299 | 318 |
| 216 | 3300025735 | Ga0207713_1006656 | Ga0207713_10066563 | 318 |
| 217 | 3300025735 | Ga0207713_1023016 | Ga0207713_10230163 | 318 |
| 218 | 3300025735 | Ga0207713_1039725 | Ga0207713_10397252 | 318 |
| 219 | 3300025735 | Ga0207713_1058793 | Ga0207713_10587931 | 318 |
| 220 | 3300025932 | Ga0207690_10154359 | Ga0207690_101543591 | 318 |
| 221 | 3300026116 | Ga0207674_10002548 | Ga0207674_100025483 | 318 |
| 222 | 3300027111 | Ga0209281_1000143 | Ga0209281_1000143167 | 318 |
| 223 | 3300027111 | Ga0209281_1000222 | Ga0209281_10002226 | 318 |
| 224 | 3300027312 | Ga0209371_1000001 | Ga0209371_10000011496 | 318 |
| 225 | 3300027312 | Ga0209371_1001025 | Ga0209371_100102518 | 318 |
| 226 | 3300028379 | Ga0268266_10000902 | Ga0268266_1000090229 | 318 |
| 227 | 3300030500 | Ga0268256_1000001 | Ga0268256_10000011146 | 318 |
| 228 | 3300030500 | Ga0268256_1000866 | Ga0268256_10008664 | 318 |
| 229 | 3300042010 | Ga0439452_000014 | Ga0439452_000014_258297_259256 | 318 |
| 230 | 3300046471 | Ga0495650_0000005 | Ga0495650_0000005_298882_299841 | 318 |
| 231 | 3300048907 | Ga0496104_0001201 | Ga0496104_0001201_12971_13930 | 318 |
| 232 | 3300048908 | Ga0496105_0028754 | Ga0496105_0028754_2604_3563 | 318 |
| 233 | 3300048919 | Ga0496116_0000324 | Ga0496116_0000324_4627_5586 | 318 |
| 234 | 3300048919 | Ga0496116_0004836 | Ga0496116_0004836_3188_4147 | 318 |
| 235 | 3300048920 | Ga0496117_0000020 | Ga0496117_0000020_72929_73888 | 318 |
| 236 | 3300048921 | Ga0496118_0000015 | Ga0496118_0000015_88147_89106 | 318 |
| 237 | 3300048922 | Ga0496119_0001846 | Ga0496119_0001846_23198_24157 | 318 |
| 238 | 3300048922 | Ga0496119_0009249 | Ga0496119_0009249_6182_7141 | 318 |
| 239 | 3300048922 | Ga0496119_0015967 | Ga0496119_0015967_3643_4602 | 318 |
| 240 | 3300048922 | Ga0496119_0072665 | Ga0496119_0072665_162_1121 | 318 |
| 241 | 3300048923 | Ga0496120_0001141 | Ga0496120_0001141_4646_5605 | 318 |
| 242 | 3300048923 | Ga0496120_0003129 | Ga0496120_0003129_4598_5557 | 318 |
| 243 | 3300048923 | Ga0496120_0017533 | Ga0496120_0017533_1155_2114 | 318 |
| 244 | 3300048924 | Ga0496121_0008883 | Ga0496121_0008883_4627_5586 | 318 |
| 245 | 3300048924 | Ga0496121_0012458 | Ga0496121_0012458_6233_7192 | 318 |
| 246 | 3300048924 | Ga0496121_0055881 | Ga0496121_0055881_1557_2516 | 318 |
| 247 | 3300048925 | Ga0496122_0008783 | Ga0496122_0008783_1492_2451 | 318 |
| 248 | 3300048925 | Ga0496122_0010965 | Ga0496122_0010965_2150_3109 | 318 |
| 249 | 3300048926 | Ga0496123_0006963 | Ga0496123_0006963_1492_2451 | 318 |
| 250 | 3300048926 | Ga0496123_0019928 | Ga0496123_0019928_982_1941 | 318 |
| 251 | 3300048927 | Ga0496124_0000505 | Ga0496124_0000505_18890_19849 | 318 |
| 252 | 3300048927 | Ga0496124_0007031 | Ga0496124_0007031_3315_4274 | 318 |
| 253 | 3300048927 | Ga0496124_0144897 | Ga0496124_0144897_310_1269 | 318 |
| 254 | 3300048928 | Ga0496125_0069309 | Ga0496125_0069309_1293_2252 | 318 |
| 255 | 3300048929 | Ga0496126_0000349 | Ga0496126_0000349_7459_8418 | 318 |
| 256 | 3300048929 | Ga0496126_0002334 | Ga0496126_0002334_17118_18077 | 318 |
| 257 | 3300048929 | Ga0496126_0186914 | Ga0496126_0186914_582_1541 | 318 |
| 258 | 3300048929 | Ga0496126_0320297 | Ga0496126_0320297_171_1130 | 318 |
| 259 | 3300003320 | rootH2_10142869 | rootH2_101428695 | 319 |
| 260 | 3300003322 | rootL2_10156889 | rootL2_101568893 | 319 |
| 261 | 3300003323 | rootH1_10112374 | rootH1_101123742 | 319 |
| 262 | 3300003792 | Ga0055540_1001786 | Ga0055540_100178613 | 319 |
| 263 | 3300005334 | Ga0068869_100185576 | Ga0068869_1001855762 | 319 |
| 264 | 3300005354 | Ga0070675_100025058 | Ga0070675_1000250582 | 319 |
| 265 | 3300005356 | Ga0070674_100035621 | Ga0070674_1000356213 | 319 |
| 266 | 3300005456 | Ga0070678_100167842 | Ga0070678_1001678423 | 319 |
| 267 | 3300005548 | Ga0070665_100079461 | Ga0070665_1000794613 | 319 |
| 268 | 3300005840 | Ga0068870_10008305 | Ga0068870_100083054 | 319 |
| 269 | 3300009148 | Ga0105243_10002333 | Ga0105243_1000233315 | 319 |
| 270 | 3300009176 | Ga0105242_10077015 | Ga0105242_100770153 | 319 |
| 271 | 3300014326 | Ga0157380_10263424 | Ga0157380_102634242 | 319 |
| 272 | 3300025297 | Ga0209758_1043316 | Ga0209758_10433161 | 319 |
| 273 | 3300025893 | Ga0207682_10026825 | Ga0207682_100268253 | 319 |
| 274 | 3300025908 | Ga0207643_10009226 | Ga0207643_100092263 | 319 |
| 275 | 3300025926 | Ga0207659_10040110 | Ga0207659_100401103 | 319 |
| 276 | 3300025935 | Ga0207709_10034963 | Ga0207709_100349631 | 319 |
| 277 | 3300025937 | Ga0207669_10072258 | Ga0207669_100722582 | 319 |
| 278 | 3300025938 | Ga0207704_10203125 | Ga0207704_102031252 | 319 |
| 279 | 3300025940 | Ga0207691_10007572 | Ga0207691_100075728 | 319 |
| 280 | 3300025942 | Ga0207689_10013289 | Ga0207689_100132896 | 319 |
| 281 | 3300026089 | Ga0207648_10575921 | Ga0207648_105759211 | 319 |
| 282 | 3300026121 | Ga0207683_10124321 | Ga0207683_101243213 | 319 |
| 283 | 3300028380 | Ga0268265_10030460 | Ga0268265_100304603 | 319 |
| 284 | 3300031995 | Ga0307409_100022511 | Ga0307409_1000225113 | 319 |
| 285 | 3300046460 | Ga0495638_0000790 | Ga0495638_0000790_25815_26777 | 319 |
| 286 | 3300046525 | Ga0495663_0021061 | Ga0495663_0021061_170_1141 | 319 |
| 287 | 3300047320 | Ga0495672_0034814 | Ga0495672_0034814_273_1235 | 319 |
| 288 | 3300048909 | Ga0496106_0002317 | Ga0496106_0002317_1210_2172 | 319 |
| 289 | 3300048919 | Ga0496116_0000022 | Ga0496116_0000022_455951_456910 | 319 |
| 290 | 3300048925 | Ga0496122_0011333 | Ga0496122_0011333_822_1787 | 319 |
| 291 | 3300048926 | Ga0496123_0035439 | Ga0496123_0035439_2401_3366 | 319 |
| 292 | 3300048927 | Ga0496124_0000287 | Ga0496124_0000287_66077_67036 | 319 |
| 293 | 3300049822 | Ga0501035_0253310 | Ga0501035_0253310_502_1464 | 319 |
| 294 | 3300053087 | Ga0500643_043203 | Ga0500643_043203_244_1218 | 319 |
| 295 | 3300053139 | Ga0500568_0001419 | Ga0500568_0001419_10559_11521 | 319 |
| 296 | 3300053153 | Ga0500616_0003746 | Ga0500616_0003746_9404_10366 | 319 |
| 297 | 3300005366 | Ga0070659_100004056 | Ga0070659_1000040569 | 320 |
| 298 | 3300025940 | Ga0207691_10007865 | Ga0207691_100078652 | 320 |
| 299 | 3300026121 | Ga0207683_10032836 | Ga0207683_100328362 | 320 |
| 300 | 3300046513 | Ga0495616_0032530 | Ga0495616_0032530_1667_2638 | 320 |
| 301 | 3300046542 | Ga0495597_0003388 | Ga0495597_0003388_684_1646 | 320 |
| 302 | 3300003187 | JGI25151J46595_10002293 | JGI25151J46595_1000229312 | 321 |
| 303 | 3300006195 | Ga0075366_10004447 | Ga0075366_100044478 | 321 |
| 304 | 3300006353 | Ga0075370_10003198 | Ga0075370_100031984 | 321 |
| 305 | 3300009148 | Ga0105243_10169019 | Ga0105243_101690192 | 321 |
| 306 | 3300025258 | Ga0209129_1002210 | Ga0209129_10022108 | 321 |
| 307 | 3300025294 | Ga0209025_1000168 | Ga0209025_100016888 | 321 |
| 308 | 3300044656 | Ga0466969_0011629 | Ga0466969_0011629_1634_2608 | 321 |
| 309 | 3300044684 | Ga0466966_0171421 | Ga0466966_0171421_61_1035 | 321 |
| 310 | 3300044693 | Ga0466961_0019590 | Ga0466961_0019590_1915_2889 | 321 |
| 311 | 3300044765 | Ga0466970_0012901 | Ga0466970_0012901_1919_2893 | 321 |
| 312 | 3300045049 | Ga0466959_0000042 | Ga0466959_0000042_86584_87558 | 321 |
| 313 | 3300045836 | Ga0466958_0127648 | Ga0466958_0127648_435_1409 | 321 |
| 314 | 3300050494 | nmdc:mga06z11_75473_c1 | nmdc:mga06z11_75473_c1_565_1572 | 321 |
| 315 | 3300050496 | nmdc:mga07m45_23981_c1 | nmdc:mga07m45_23981_c1_1657_2664 | 321 |
| 316 | 3300061719 | Ga0466962_0069659 | Ga0466962_0069659_153_1127 | 321 |
| 317 | 3300015261 | Ga0182006_1020775 | Ga0182006_10207752 | 323 |
| 318 | 3300015262 | Ga0182007_10006140 | Ga0182007_100061404 | 323 |
| 319 | 3300048925 | Ga0496122_0001579 | Ga0496122_0001579_3902_4909 | 323 |
| 320 | 3300048926 | Ga0496123_0004805 | Ga0496123_0004805_8795_9802 | 323 |
| 321 | 3300003794 | Ga0055531_10004540 | Ga0055531_100045407 | 324 |
| 322 | 3300025304 | Ga0209257_1000197 | Ga0209257_100019776 | 324 |
| 323 | 3300028800 | Ga0265338_10073700 | Ga0265338_100737002 | 324 |
| 324 | iso_pu_bacteria | 2585428183 | 2588213418 | 324 |
| 325 | iso_pu_bacteria | 2585428184 | 2588220020 | 324 |
| 326 | iso_pu_bacteria | 2585428185 | 2588223682 | 324 |
| 327 | 3300049579 | Ga0501043_0118753 | Ga0501043_0118753_374_1471 | 325 |
| 328 | 3300009093 | Ga0105240_10071157 | Ga0105240_100711572 | 326 |
| 329 | 3300025913 | Ga0207695_10079616 | Ga0207695_100796162 | 326 |
| 330 | 3300048924 | Ga0496121_0019887 | Ga0496121_0019887_4072_5115 | 326 |
| 331 | 3300001915 | JGI24741J21665_1009531 | JGI24741J21665_10095312 | 328 |
| 332 | 3300046492 | Ga0495585_0154875 | Ga0495585_0154875_153_1169 | 328 |
| 333 | 3300046500 | Ga0495596_0011948 | Ga0495596_0011948_573_1559 | 328 |
| 334 | 3300048920 | Ga0496117_0000064 | Ga0496117_0000064_221691_222677 | 328 |
| 335 | 3300048921 | Ga0496118_0002371 | Ga0496118_0002371_15215_16201 | 328 |
| 336 | 3300048922 | Ga0496119_0000025 | Ga0496119_0000025_34264_35250 | 328 |
| 337 | 3300048925 | Ga0496122_0001362 | Ga0496122_0001362_8950_9936 | 328 |
| 338 | 3300048926 | Ga0496123_0000897 | Ga0496123_0000897_16346_17332 | 328 |
| 339 | 3300048928 | Ga0496125_0010764 | Ga0496125_0010764_4343_5329 | 328 |
| 340 | 3300048929 | Ga0496126_0001868 | Ga0496126_0001868_26566_27552 | 328 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1es9-assembly1.cif.gz_A-2 | x-ray crystal structure of r22k mutant of the mammalian brain platelet-activating factor acetylhydrolases (paf-ah) | 0.7094 | 170 | 219 |
| 2bnj-assembly1.cif.gz_A | the xylanase ta from thermoascus aurantiacus utilizes arabinose decorations of xylan as significant substrate specificity determinants. | 0.7012 | 28 | 319 |
| 1i1x-assembly1.cif.gz_A | 1.11 a atomic resolution structure of a thermostable xylanase from thermoascus aurantiacus | 0.6966 | 30 | 319 |
| 8usj-assembly3.cif.gz_C | crystal structure of kemp eliminase hg198 with bound transition state analogue, 280 k | 0.6917 | 30 | 319 |
| 3wug-assembly1.cif.gz_A | the mutant crystal structure of b-1,4-xylanase (xynas9_v43p/g44e) with xylobiose from streptomyces sp. 9 | 0.691 | 30 | 283 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8VYW2_77_527_3.20.20.80 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.6826 | 31 | 319 | 3.20.20.80 |
| 4k9sB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase | 0.6792 | 160 | 219 | 3.40.50.1110 |
| 3oa3B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.6762 | 31 | 322 | 3.20.20.70 |
| af_K7LG54_258_704_3.20.20.80 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.6671 | 32 | 328 | 3.20.20.80 |
| af_K7WC35_80_528_3.20.20.80 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.6635 | 31 | 328 | 3.20.20.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Y2SH56-F1-model_v4 | Uncharacterized protein | 0.9895 | 52 | 325 |
|
| AF-A0A1C0U503-F1-model_v4 | Uncharacterized protein | 0.9864 | 152 | 326 |
|
| AF-A0A1I3LPG4-F1-model_v4 | deleted | 0.9864 | 234 | 328 |
|
| AF-A0A6N6VXA7-F1-model_v4 | Glycoside hydrolase family 42 N-terminal domain-containing protein | 0.9832 | 33 | 325 |
|
| AF-A0A455VZK4-F1-model_v4 | Uncharacterized protein | 0.9822 | 61 | 328 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar