F414105

General Info

Members Datasets Scaffolds Average Seq Length
339 245 678 150

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_1346810_c1|nmdc:mga06r32_1346810_c1_32_520
Length 162
Sequence MSRHIQVTFDAHDPRALSSFWRDVLGYVHPGPPGVDLPEGADPLAAWDEFLARVGVPEEQRNTRSAIEDPDGHGPRLFFQQVPEGTGIQERTSSERKNRWVHLDVRATPGLEGEERMAALEAECDRLVALGATRVRRYEPEPPLDAGHIVMSDPEGNVFCLD

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
110 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
111 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
130 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
131 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
132 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
133 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
141 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
142 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
149 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
162 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
163 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
164 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
169 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
170 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
175 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
208 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
209 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
212 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
213 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
214 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
215 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
216 2643221692 Nocardia sp. Root136 Isolate Unclassified
217 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
218 2738541305 Nocardioides sp. CF167 Isolate Unclassified
219 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
220 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
221 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
222 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
223 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
224 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
225 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
226 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
227 2862574272 Streptomyces sp. AcE210 Isolate Nodule
228 2867369537 Streptomyces sp. Z26 Isolate Unclassified
229 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
230 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
231 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
232 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
233 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
234 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
235 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
236 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
237 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
238 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
239 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
240 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
241 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
242 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
243 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
244 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
245 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.5
Metatranscriptomes 1.47
Isolates 10.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.65
Nodule 0.29
Rhizoplane 2.65
Rhizosphere 82.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_1346810_c1 3300050510 Bacteria 657
2 JGI24739J22299_10105245 3300001989 Bacteria 849
3 JGI25407J50210_10017864 3300003373 Bacteria 1843
4 Ga0070658_10008427 3300005327 Bacteria 8293
5 Ga0070658_10176300 3300005327 Bacteria 1798
6 Ga0070683_100005113 3300005329 Bacteria 10908
7 Ga0070683_100088441 3300005329 Bacteria 2906
8 Ga0070677_10294700 3300005333 Bacteria 822
9 Ga0068869_100047781 3300005334 Bacteria 3092
10 Ga0070682_100150457 3300005337 Bacteria 1596
11 Ga0070660_100025772 3300005339 Bacteria 4373
12 Ga0070661_100052314 3300005344 Bacteria 2989
13 Ga0070661_100214930 3300005344 Bacteria 1473
14 Ga0070661_100922819 3300005344 Bacteria 722
15 Ga0070668_101223659 3300005347 Bacteria 681
16 Ga0070668_101363005 3300005347 Bacteria 646
17 Ga0070671_100001796 3300005355 Bacteria 16283
18 Ga0070674_101496255 3300005356 Bacteria 607
19 Ga0070659_100202066 3300005366 Bacteria 1636
20 Ga0070659_101039367 3300005366 Bacteria 720
21 Ga0070667_100157073 3300005367 Bacteria 2001
22 Ga0070709_10352213 3300005434 Bacteria 1088
23 Ga0070714_100822453 3300005435 Bacteria 900
24 Ga0070710_11035213 3300005437 Bacteria 600
25 Ga0070663_100175211 3300005455 Bacteria 1660
26 Ga0070681_10139022 3300005458 Bacteria 2358
27 Ga0070685_10498580 3300005466 Bacteria 861
28 Ga0070707_101156946 3300005468 Bacteria 740
29 Ga0070698_100071472 3300005471 Bacteria 3480
30 Ga0070679_100178644 3300005530 Bacteria 2095
31 Ga0070684_100000737 3300005535 Bacteria 22677
32 Ga0070684_100136038 3300005535 Bacteria 2220
33 Ga0070684_100645222 3300005535 Bacteria 985
34 Ga0068853_100281616 3300005539 Bacteria 1533
35 Ga0070665_100006876 3300005548 Bacteria 11562
36 Ga0070665_100150166 3300005548 Bacteria 2333
37 Ga0068855_100069407 3300005563 Bacteria 4101
38 Ga0068857_100008385 3300005577 Bacteria 8931
39 Ga0070702_100019436 3300005615 Bacteria 3544
40 Ga0070702_100341567 3300005615 Bacteria 1051
41 Ga0068859_100386008 3300005617 Bacteria 1496
42 Ga0068859_102188815 3300005617 Bacteria 610
43 Ga0068864_100056738 3300005618 Bacteria 3383
44 Ga0068864_101828065 3300005618 Bacteria 613
45 Ga0068866_10112255 3300005718 Bacteria 1523
46 Ga0068861_100109109 3300005719 Bacteria 2215
47 Ga0068863_100186937 3300005841 Bacteria 1990
48 Ga0068863_100213169 3300005841 Bacteria 1860
49 Ga0068858_100239441 3300005842 Bacteria 1721
50 Ga0068860_100012237 3300005843 Bacteria 8456
51 Ga0068862_100480250 3300005844 Bacteria 1176
52 Ga0081455_10001241 3300005937 Bacteria 31870
53 Ga0081455_10003411 3300005937 Bacteria 18277
54 Ga0081455_10122971 3300005937 Bacteria 2042
55 Ga0081538_10000036 3300005981 Bacteria 119944
56 Ga0081538_10089822 3300005981 Bacteria 1593
57 Ga0081538_10134828 3300005981 Bacteria 1152
58 Ga0070717_10198389 3300006028 Bacteria 1757
59 Ga0075365_10036942 3300006038 Bacteria 3169
60 Ga0075368_10095863 3300006042 Bacteria 1216
61 Ga0075363_100277600 3300006048 Bacteria 969
62 Ga0075427_10065594 3300006194 Bacteria 641
63 Ga0075370_10342310 3300006353 Bacteria 892
64 Ga0075428_100000025 3300006844 Bacteria 124293
65 Ga0075428_100025361 3300006844 Bacteria 6561
66 Ga0075430_100004448 3300006846 Bacteria 11825
67 Ga0075430_100091907 3300006846 Bacteria 2538
68 Ga0075430_100162276 3300006846 Bacteria 1860
69 Ga0075430_100692763 3300006846 Bacteria 840
70 Ga0075430_100722938 3300006846 Bacteria 821
71 Ga0075431_100021268 3300006847 Bacteria 6630
72 Ga0075431_100027658 3300006847 Bacteria 5820
73 Ga0075431_100063486 3300006847 Bacteria 3812
74 Ga0075431_100279389 3300006847 Bacteria 1691
75 Ga0075433_10002538 3300006852 Bacteria 13904
76 Ga0075434_100006698 3300006871 Bacteria 10582
77 Ga0075429_100008568 3300006880 Bacteria 8896
78 Ga0075429_100018459 3300006880 Bacteria 6042
79 Ga0075429_100035142 3300006880 Bacteria 4357
80 Ga0068865_100038019 3300006881 Bacteria 3255
81 Ga0075436_100202188 3300006914 Bacteria 1407
82 Ga0097620_100386022 3300006931 Bacteria 1496
83 Ga0097620_102189411 3300006931 Bacteria 610
84 Ga0075435_100007618 3300007076 Bacteria 7731
85 Ga0111539_10085644 3300009094 Bacteria 3703
86 Ga0111539_11380927 3300009094 Bacteria 817
87 Ga0105245_10013427 3300009098 Bacteria 7135
88 Ga0105245_10599183 3300009098 Bacteria 1128
89 Ga0105247_10221158 3300009101 Bacteria 1282
90 Ga0114129_10001752 3300009147 Bacteria 29550
91 Ga0114129_10745355 3300009147 Bacteria 1254
92 Ga0114129_10782263 3300009147 Bacteria 1219
93 Ga0114129_11066330 3300009147 Bacteria 1013
94 Ga0105243_10019351 3300009148 Bacteria 5161
95 Ga0105243_10034279 3300009148 Bacteria 3928
96 Ga0105243_10580201 3300009148 Bacteria 1076
97 Ga0105241_10528162 3300009174 Bacteria 1056
98 Ga0105242_10672336 3300009176 Bacteria 1010
99 Ga0105248_10040401 3300009177 Bacteria 5229
100 Ga0105248_12296928 3300009177 Bacteria 614
101 Ga0105249_10011025 3300009553 Bacteria 7941
102 Ga0105028_121799 3300009993 Bacteria 697
103 Ga0105239_10004470 3300010375 Bacteria 16713
104 Ga0105239_10438969 3300010375 Bacteria 1480
105 Ga0105246_10006225 3300011119 Bacteria 7283
106 Ga0157371_10309243 3300013102 Bacteria 1145
107 Ga0157369_10021666 3300013105 Bacteria 7187
108 Ga0157369_10311309 3300013105 Bacteria 1637
109 Ga0157374_10195262 3300013296 Bacteria 1981
110 Ga0163162_10013358 3300013306 Bacteria 8019
111 Ga0163162_11662121 3300013306 Bacteria 729
112 Ga0163162_11735632 3300013306 Bacteria 713
113 Ga0157372_10002781 3300013307 Bacteria 18903
114 Ga0157375_11746307 3300013308 Bacteria 737
115 Ga0157375_13271108 3300013308 Bacteria 540
116 Ga0163163_10310174 3300014325 Bacteria 1631
117 Ga0157380_11859162 3300014326 Bacteria 662
118 Ga0157380_11935017 3300014326 Bacteria 651
119 Ga0157379_10018461 3300014968 Bacteria 6151
120 Ga0157379_10038442 3300014968 Bacteria 4270
121 Ga0157379_11384212 3300014968 Bacteria 681
122 Ga0206356_11763013 3300020070 Bacteria 2323
123 Ga0206354_10473631 3300020081 Bacteria 1088
124 Ga0206353_10275756 3300020082 Bacteria 1190
125 Ga0206353_11903412 3300020082 Bacteria 2870
126 Ga0207682_10122448 3300025893 Bacteria 1155
127 Ga0207710_10058563 3300025900 Bacteria 1742
128 Ga0207647_10043706 3300025904 Bacteria 2802
129 Ga0207647_10220944 3300025904 Bacteria 1092
130 Ga0207705_10077413 3300025909 Bacteria 2419
131 Ga0207707_10073896 3300025912 Bacteria 2973
132 Ga0207707_10259215 3300025912 Bacteria 1509
133 Ga0207660_10937375 3300025917 Bacteria 706
134 Ga0207660_11149347 3300025917 Bacteria 632
135 Ga0207657_10769991 3300025919 Bacteria 745
136 Ga0207649_10125526 3300025920 Bacteria 1736
137 Ga0207652_10068545 3300025921 Bacteria 3078
138 Ga0207652_10245256 3300025921 Bacteria 1615
139 Ga0207687_10923462 3300025927 Bacteria 747
140 Ga0207700_10407118 3300025928 Bacteria 1193
141 Ga0207644_10027379 3300025931 Bacteria 3937
142 Ga0207686_11014539 3300025934 Bacteria 674
143 Ga0207709_10370331 3300025935 Bacteria 1087
144 Ga0207691_10144303 3300025940 Bacteria 2096
145 Ga0207689_10062953 3300025942 Bacteria 3051
146 Ga0207661_10054857 3300025944 Bacteria 3194
147 Ga0207661_10108626 3300025944 Bacteria 2342
148 Ga0207668_10406147 3300025972 Bacteria 1153
149 Ga0207668_10917109 3300025972 Bacteria 780
150 Ga0207678_10002462 3300026067 Bacteria 16818
151 Ga0207678_10369136 3300026067 Bacteria 1239
152 Ga0207702_11209206 3300026078 Bacteria 750
153 Ga0207641_10030302 3300026088 Bacteria 4482
154 Ga0207676_10658609 3300026095 Bacteria 1011
155 Ga0207675_100146241 3300026118 Bacteria 2247
156 Ga0207675_100537696 3300026118 Bacteria 1167
157 Ga0207675_101965727 3300026118 Bacteria 603
158 Ga0207675_102285119 3300026118 Bacteria 555
159 Ga0207683_10776171 3300026121 Bacteria 889
160 Ga0207428_10006649 3300027907 Bacteria 10615
161 Ga0207428_10126518 3300027907 Bacteria 1957
162 Ga0268266_10039396 3300028379 Bacteria 4025
163 Ga0268266_10728040 3300028379 Bacteria 957
164 Ga0268264_10004760 3300028381 Bacteria 11523
165 Ga0307515_10000192 3300028794 Bacteria 149030
166 Ga0307512_10025211 3300030522 Bacteria 5275
167 Ga0316177_1211027 3300030731 Bacteria 712
168 Ga0316181_1194554 3300030744 Bacteria 891
169 Ga0307513_10015902 3300031456 Bacteria 9100
170 Ga0307513_10163508 3300031456 Bacteria 2114
171 Ga0307508_10057964 3300031616 Bacteria 3427
172 Ga0307508_10408664 3300031616 Bacteria 949
173 Ga0307516_10013261 3300031730 Bacteria 8795
174 Ga0307516_10059139 3300031730 Bacteria 3728
175 Ga0307516_10406930 3300031730 Bacteria 1019
176 Ga0307405_10208988 3300031731 Bacteria 1423
177 Ga0307410_10378970 3300031852 Bacteria 1138
178 Ga0307410_10485045 3300031852 Bacteria 1015
179 Ga0307409_100541881 3300031995 Bacteria 1141
180 Ga0307416_101160489 3300032002 Bacteria 878
181 Ga0307416_103406288 3300032002 Bacteria 532
182 Ga0307414_10747272 3300032004 Bacteria 889
183 Ga0307411_10027113 3300032005 Bacteria 3461
184 Ga0307415_100274086 3300032126 Bacteria 1384
185 Ga0307415_100506041 3300032126 Bacteria 1057
186 Ga0307415_100874801 3300032126 Bacteria 826
187 Ga0373937_0895744 3300036401 Bacteria 836
188 Ga0372808_016648 3300036459 Bacteria 1054
189 Ga0395899_0063164 3300037312 Bacteria 2725
190 Ga0395900_0342492 3300037418 Bacteria 1470
191 Ga0395898_0332277 3300037466 Bacteria 1449
192 Ga0395898_0522865 3300037466 Bacteria 1128
193 Ga0436364_0682056 3300037853 Bacteria 2495
194 Ga0395901_0014948 3300038443 Bacteria 7888
195 Ga0395901_0178728 3300038443 Bacteria 2225
196 Ga0451807_0910310 3300041486 Bacteria 1201
197 Ga0451837_1736463 3300041494 Bacteria 1539
198 Ga0451839_0033971 3300041496 Bacteria 640
199 Ga0451849_0308100 3300041505 Bacteria 956
200 Ga0451843_0705991 3300041509 Bacteria 731
201 Ga0451843_1433927 3300041509 Bacteria 654
202 Ga0451853_1126400 3300041512 Bacteria 1994
203 Ga0466965_0037511 3300044683 Bacteria 2380
204 Ga0466963_0155991 3300044694 Bacteria 1587
205 Ga0466963_0285210 3300044694 Bacteria 1161
206 Ga0466963_0524511 3300044694 Bacteria 836
207 Ga0466964_0043137 3300044706 Bacteria 1829
208 Ga0466964_0351107 3300044706 Bacteria 758
209 Ga0466970_0076278 3300044765 Bacteria 1806
210 Ga0466967_0006726 3300045976 Bacteria 8180
211 Ga0466967_0154119 3300045976 Bacteria 2150
212 Ga0466967_0319097 3300045976 Bacteria 1498
213 Ga0495603_0005980 3300046455 Bacteria 7274
214 Ga0495603_0006367 3300046455 Bacteria 7062
215 Ga0495590_0140763 3300046457 Bacteria 871
216 Ga0495605_0013579 3300046474 Bacteria 4482
217 Ga0495664_0083411 3300046477 Bacteria 1918
218 Ga0495594_0161237 3300046499 Bacteria 1275
219 Ga0495607_0095191 3300046501 Bacteria 1605
220 Ga0495583_0024103 3300046506 Bacteria 3064
221 Ga0495606_0004450 3300046507 Bacteria 13996
222 Ga0495616_0045527 3300046513 Bacteria 2220
223 Ga0495620_0000455 3300046515 Bacteria 27164
224 Ga0495631_0004590 3300046518 Bacteria 7320
225 Ga0495648_0008009 3300046524 Bacteria 8379
226 Ga0495648_0156287 3300046524 Bacteria 1184
227 Ga0495666_0023180 3300046526 Bacteria 3070
228 Ga0495622_0024746 3300046557 Bacteria 2803
229 Ga0495668_0024142 3300046616 Bacteria 3459
230 Ga0495634_0386679 3300046642 Bacteria 833
231 Ga0495611_0057991 3300046648 Bacteria 1755
232 Ga0495625_0017009 3300046660 Bacteria 5702
233 Ga0495661_0295223 3300046665 Bacteria 813
234 Ga0495599_0162437 3300046678 Bacteria 1380
235 Ga0495624_0049885 3300046690 Bacteria 2653
236 Ga0495671_0505262 3300046692 Bacteria 577
237 Ga0495649_0177263 3300046694 Bacteria 1113
238 Ga0495589_0008769 3300046794 Bacteria 5263
239 Ga0495660_0029511 3300046810 Bacteria 3093
240 Ga0495581_0563530 3300047315 Bacteria 661
241 Ga0495672_0110891 3300047320 Bacteria 1473
242 Ga0495676_0015915 3300047321 Bacteria 6683
243 Ga0495676_0027846 3300047321 Bacteria 4840
244 Ga0495683_0060480 3300047323 Bacteria 1877
245 Ga0495687_010594 3300047443 Bacteria 5046
246 Ga0495687_065883 3300047443 Bacteria 1473
247 Ga0495685_004320 3300047447 Bacteria 4583
248 Ga0495684_0046961 3300047471 Bacteria 3303
249 Ga0495686_0241321 3300047472 Bacteria 1019
250 Ga0495602_0006883 3300048088 Bacteria 11950
251 Ga0495614_0083046 3300048089 Bacteria 1389
252 Ga0495626_0101177 3300048091 Bacteria 1256
253 Ga0496103_0025480 3300048906 Bacteria 3575
254 Ga0496103_0640629 3300048906 Bacteria 676
255 Ga0496104_0098106 3300048907 Bacteria 2805
256 Ga0496108_0630246 3300048911 Bacteria 933
257 Ga0496111_0201381 3300048914 Bacteria 1480
258 Ga0496112_0291730 3300048915 Bacteria 1577
259 Ga0496114_0028934 3300048917 Bacteria 4552
260 Ga0496119_0014608 3300048922 Bacteria 6124
261 Ga0496120_0006161 3300048923 Bacteria 9285
262 Ga0496124_0027370 3300048927 Bacteria 5118
263 Ga0495682_0261690 3300049460 Bacteria 611
264 Ga0501032_0552950 3300049569 Bacteria 734
265 Ga0501038_0539648 3300049574 Bacteria 888
266 Ga0501041_0066107 3300049577 Bacteria 2215
267 Ga0501042_0012115 3300049578 Bacteria 5834
268 Ga0501046_0244274 3300049580 Bacteria 1323
269 Ga0501047_0229996 3300049581 Bacteria 1708
270 Ga0501068_0239213 3300049584 Bacteria 1155
271 Ga0501071_0033942 3300049587 Bacteria 3628
272 Ga0501072_0026461 3300049588 Bacteria 4523
273 Ga0501075_0014031 3300049591 Bacteria 5736
274 Ga0501077_0158491 3300049593 Bacteria 1437
275 Ga0501044_0164840 3300049823 Bacteria 2191
276 nmdc:mga0yw44_554857_c1 3300050492 Bacteria 780
277 nmdc:mga07m45_55540_c1 3300050496 Bacteria 2238
278 nmdc:mga05p37_300457_c1 3300050507 Bacteria 1908
279 nmdc:mga05p37_47731_c1 3300050507 Bacteria 5266
280 nmdc:mga05p37_794127_c1 3300050507 Bacteria 1037
281 nmdc:mga05p37_9790_c1 3300050507 Bacteria 11373
282 nmdc:mga09592_19520_c1 3300050508 Bacteria 5568
283 nmdc:mga09592_314636_c1 3300050508 Bacteria 1357
284 nmdc:mga09592_65941_c1 3300050508 Bacteria 3068
285 nmdc:mga09592_79946_c1 3300050508 Bacteria 2784
286 nmdc:mga0qj67_129795_c1 3300050509 Bacteria 2041
287 nmdc:mga0qj67_190960_c1 3300050509 Bacteria 1665
288 nmdc:mga0qj67_364050_c1 3300050509 Bacteria 1168
289 nmdc:mga0qj67_7051_c1 3300050509 Bacteria 8288
290 nmdc:mga06r32_128814_c1 3300050510 Bacteria 2501
291 nmdc:mga06r32_288399_c1 3300050510 Bacteria 1628
292 nmdc:mga06r32_322352_c1 3300050510 Bacteria 1530
293 nmdc:mga06r32_64036_c1 3300050510 Bacteria 3545
294 nmdc:mga06r32_896333_c1 3300050510 Bacteria 844
295 nmdc:mga06r32_974913_c1 3300050510 Bacteria 801
296 nmdc:mga08y16_2723_c2 3300050511 Bacteria 6485
297 nmdc:mga08y16_707562_c1 3300050511 Bacteria 1007
298 nmdc:mga0n895_341451_c1 3300050512 Bacteria 1517
299 nmdc:mga0rr50_10250_c1 3300050513 Bacteria 5938
300 nmdc:mga0a205_1437_c1 3300050515 Bacteria 20263
301 Ga0500579_142578 3300053143 Bacteria 1076
302 Ga0500589_151851 3300053147 Bacteria 942
303 Ga0500620_225797 3300053155 Bacteria 631
304 Ga0501082_0093210 3300060353 Bacteria 2602
305 Ga0530510_0007947 3300061734 Bacteria 7402
306 2515853775 2515154155 Bacteria 7985436
307 2586063440 2585427649 Bacteria 9053857
308 2643944984 2643221587 Bacteria 7586415
309 2644431883 2643221677 Bacteria 7584031
310 2644517645 2643221692 Bacteria 7282860
311 2686538146 2684623035 Bacteria 8032739
312 2738868420 2738541305 Bacteria 4910150
313 2753075717 2751185734 Bacteria 8863695
314 2774392681 2773857762 Bacteria 5971770
315 2793983943 2791355406 Bacteria 11364898
316 2795796324 2795385472 Bacteria 6627535
317 2809196481 2808606439 Bacteria 5952208
318 2809587403 2808606522 Bacteria 9488490
319 2812351363 2811994878 Bacteria 5992952
320 2831936804 2831935698 Bacteria 5963223
321 2862576643 2862574272 Bacteria 10567477
322 2867372749 2867369537 Bacteria 6501581
323 2870725295 2870721527 Bacteria 9689237
324 2887444084 2887443736 Bacteria 4426037
325 2891971018 2891968417 Bacteria 5821697
326 2895888387 2895880812 Bacteria 11255272
327 2899368812 2899359706 Bacteria 10940472
328 2915774856 2915768154 Bacteria 8424322
329 2918503394 2918501144 Bacteria 8668083
330 2929224045 2929219909 Bacteria 6984360
331 2996228389 2996221748 Bacteria 6799777
332 8047903120 8047893842 Bacteria 11723082
333 8048365700 8048356638 Bacteria 11044339
334 8048379439 8048369669 Bacteria 11666822
335 8048389964 8048379754 Bacteria 11877923
336 8054475382 8054472261 Bacteria 7464355
337 8055068017 8055066027 Bacteria 9479577
338 8055179100 8055172936 Bacteria 9305943
339 8056208373 8056207758 Bacteria 8639239
340 nmdc:mga06r32_1346810_c1
341 JGI24739J22299_10105245
342 JGI25407J50210_10017864
343 Ga0070658_10008427
344 Ga0070658_10176300
345 Ga0070683_100005113
346 Ga0070683_100088441
347 Ga0070677_10294700
348 Ga0068869_100047781
349 Ga0070682_100150457
350 Ga0070660_100025772
351 Ga0070661_100052314
352 Ga0070661_100214930
353 Ga0070661_100922819
354 Ga0070668_101223659
355 Ga0070668_101363005
356 Ga0070671_100001796
357 Ga0070674_101496255
358 Ga0070659_100202066
359 Ga0070659_101039367
360 Ga0070667_100157073
361 Ga0070709_10352213
362 Ga0070714_100822453
363 Ga0070710_11035213
364 Ga0070663_100175211
365 Ga0070681_10139022
366 Ga0070685_10498580
367 Ga0070707_101156946
368 Ga0070698_100071472
369 Ga0070679_100178644
370 Ga0070684_100000737
371 Ga0070684_100136038
372 Ga0070684_100645222
373 Ga0068853_100281616
374 Ga0070665_100006876
375 Ga0070665_100150166
376 Ga0068855_100069407
377 Ga0068857_100008385
378 Ga0070702_100019436
379 Ga0070702_100341567
380 Ga0068859_100386008
381 Ga0068859_102188815
382 Ga0068864_100056738
383 Ga0068864_101828065
384 Ga0068866_10112255
385 Ga0068861_100109109
386 Ga0068863_100186937
387 Ga0068863_100213169
388 Ga0068858_100239441
389 Ga0068860_100012237
390 Ga0068862_100480250
391 Ga0081455_10001241
392 Ga0081455_10003411
393 Ga0081455_10122971
394 Ga0081538_10000036
395 Ga0081538_10089822
396 Ga0081538_10134828
397 Ga0070717_10198389
398 Ga0075365_10036942
399 Ga0075368_10095863
400 Ga0075363_100277600
401 Ga0075427_10065594
402 Ga0075370_10342310
403 Ga0075428_100000025
404 Ga0075428_100025361
405 Ga0075430_100004448
406 Ga0075430_100091907
407 Ga0075430_100162276
408 Ga0075430_100692763
409 Ga0075430_100722938
410 Ga0075431_100021268
411 Ga0075431_100027658
412 Ga0075431_100063486
413 Ga0075431_100279389
414 Ga0075433_10002538
415 Ga0075434_100006698
416 Ga0075429_100008568
417 Ga0075429_100018459
418 Ga0075429_100035142
419 Ga0068865_100038019
420 Ga0075436_100202188
421 Ga0097620_100386022
422 Ga0097620_102189411
423 Ga0075435_100007618
424 Ga0111539_10085644
425 Ga0111539_11380927
426 Ga0105245_10013427
427 Ga0105245_10599183
428 Ga0105247_10221158
429 Ga0114129_10001752
430 Ga0114129_10745355
431 Ga0114129_10782263
432 Ga0114129_11066330
433 Ga0105243_10019351
434 Ga0105243_10034279
435 Ga0105243_10580201
436 Ga0105241_10528162
437 Ga0105242_10672336
438 Ga0105248_10040401
439 Ga0105248_12296928
440 Ga0105249_10011025
441 Ga0105028_121799
442 Ga0105239_10004470
443 Ga0105239_10438969
444 Ga0105246_10006225
445 Ga0157371_10309243
446 Ga0157369_10021666
447 Ga0157369_10311309
448 Ga0157374_10195262
449 Ga0163162_10013358
450 Ga0163162_11662121
451 Ga0163162_11735632
452 Ga0157372_10002781
453 Ga0157375_11746307
454 Ga0157375_13271108
455 Ga0163163_10310174
456 Ga0157380_11859162
457 Ga0157380_11935017
458 Ga0157379_10018461
459 Ga0157379_10038442
460 Ga0157379_11384212
461 Ga0206356_11763013
462 Ga0206354_10473631
463 Ga0206353_10275756
464 Ga0206353_11903412
465 Ga0207682_10122448
466 Ga0207710_10058563
467 Ga0207647_10043706
468 Ga0207647_10220944
469 Ga0207705_10077413
470 Ga0207707_10073896
471 Ga0207707_10259215
472 Ga0207660_10937375
473 Ga0207660_11149347
474 Ga0207657_10769991
475 Ga0207649_10125526
476 Ga0207652_10068545
477 Ga0207652_10245256
478 Ga0207687_10923462
479 Ga0207700_10407118
480 Ga0207644_10027379
481 Ga0207686_11014539
482 Ga0207709_10370331
483 Ga0207691_10144303
484 Ga0207689_10062953
485 Ga0207661_10054857
486 Ga0207661_10108626
487 Ga0207668_10406147
488 Ga0207668_10917109
489 Ga0207678_10002462
490 Ga0207678_10369136
491 Ga0207702_11209206
492 Ga0207641_10030302
493 Ga0207676_10658609
494 Ga0207675_100146241
495 Ga0207675_100537696
496 Ga0207675_101965727
497 Ga0207675_102285119
498 Ga0207683_10776171
499 Ga0207428_10006649
500 Ga0207428_10126518
501 Ga0268266_10039396
502 Ga0268266_10728040
503 Ga0268264_10004760
504 Ga0307515_10000192
505 Ga0307512_10025211
506 Ga0316177_1211027
507 Ga0316181_1194554
508 Ga0307513_10015902
509 Ga0307513_10163508
510 Ga0307508_10057964
511 Ga0307508_10408664
512 Ga0307516_10013261
513 Ga0307516_10059139
514 Ga0307516_10406930
515 Ga0307405_10208988
516 Ga0307410_10378970
517 Ga0307410_10485045
518 Ga0307409_100541881
519 Ga0307416_101160489
520 Ga0307416_103406288
521 Ga0307414_10747272
522 Ga0307411_10027113
523 Ga0307415_100274086
524 Ga0307415_100506041
525 Ga0307415_100874801
526 Ga0373937_0895744
527 Ga0372808_016648
528 Ga0395899_0063164
529 Ga0395900_0342492
530 Ga0395898_0332277
531 Ga0395898_0522865
532 Ga0436364_0682056
533 Ga0395901_0014948
534 Ga0395901_0178728
535 Ga0451807_0910310
536 Ga0451837_1736463
537 Ga0451839_0033971
538 Ga0451849_0308100
539 Ga0451843_0705991
540 Ga0451843_1433927
541 Ga0451853_1126400
542 Ga0466965_0037511
543 Ga0466963_0155991
544 Ga0466963_0285210
545 Ga0466963_0524511
546 Ga0466964_0043137
547 Ga0466964_0351107
548 Ga0466970_0076278
549 Ga0466967_0006726
550 Ga0466967_0154119
551 Ga0466967_0319097
552 Ga0495603_0005980
553 Ga0495603_0006367
554 Ga0495590_0140763
555 Ga0495605_0013579
556 Ga0495664_0083411
557 Ga0495594_0161237
558 Ga0495607_0095191
559 Ga0495583_0024103
560 Ga0495606_0004450
561 Ga0495616_0045527
562 Ga0495620_0000455
563 Ga0495631_0004590
564 Ga0495648_0008009
565 Ga0495648_0156287
566 Ga0495666_0023180
567 Ga0495622_0024746
568 Ga0495668_0024142
569 Ga0495634_0386679
570 Ga0495611_0057991
571 Ga0495625_0017009
572 Ga0495661_0295223
573 Ga0495599_0162437
574 Ga0495624_0049885
575 Ga0495671_0505262
576 Ga0495649_0177263
577 Ga0495589_0008769
578 Ga0495660_0029511
579 Ga0495581_0563530
580 Ga0495672_0110891
581 Ga0495676_0015915
582 Ga0495676_0027846
583 Ga0495683_0060480
584 Ga0495687_010594
585 Ga0495687_065883
586 Ga0495685_004320
587 Ga0495684_0046961
588 Ga0495686_0241321
589 Ga0495602_0006883
590 Ga0495614_0083046
591 Ga0495626_0101177
592 Ga0496103_0025480
593 Ga0496103_0640629
594 Ga0496104_0098106
595 Ga0496108_0630246
596 Ga0496111_0201381
597 Ga0496112_0291730
598 Ga0496114_0028934
599 Ga0496119_0014608
600 Ga0496120_0006161
601 Ga0496124_0027370
602 Ga0495682_0261690
603 Ga0501032_0552950
604 Ga0501038_0539648
605 Ga0501041_0066107
606 Ga0501042_0012115
607 Ga0501046_0244274
608 Ga0501047_0229996
609 Ga0501068_0239213
610 Ga0501071_0033942
611 Ga0501072_0026461
612 Ga0501075_0014031
613 Ga0501077_0158491
614 Ga0501044_0164840
615 nmdc:mga0yw44_554857_c1
616 nmdc:mga07m45_55540_c1
617 nmdc:mga05p37_300457_c1
618 nmdc:mga05p37_47731_c1
619 nmdc:mga05p37_794127_c1
620 nmdc:mga05p37_9790_c1
621 nmdc:mga09592_19520_c1
622 nmdc:mga09592_314636_c1
623 nmdc:mga09592_65941_c1
624 nmdc:mga09592_79946_c1
625 nmdc:mga0qj67_129795_c1
626 nmdc:mga0qj67_190960_c1
627 nmdc:mga0qj67_364050_c1
628 nmdc:mga0qj67_7051_c1
629 nmdc:mga06r32_128814_c1
630 nmdc:mga06r32_288399_c1
631 nmdc:mga06r32_322352_c1
632 nmdc:mga06r32_64036_c1
633 nmdc:mga06r32_896333_c1
634 nmdc:mga06r32_974913_c1
635 nmdc:mga08y16_2723_c2
636 nmdc:mga08y16_707562_c1
637 nmdc:mga0n895_341451_c1
638 nmdc:mga0rr50_10250_c1
639 nmdc:mga0a205_1437_c1
640 Ga0500579_142578
641 Ga0500589_151851
642 Ga0500620_225797
643 Ga0501082_0093210
644 Ga0530510_0007947
645 2515853775
646 2586063440
647 2643944984
648 2644431883
649 2644517645
650 2686538146
651 2738868420
652 2753075717
653 2774392681
654 2793983943
655 2795796324
656 2809196481
657 2809587403
658 2812351363
659 2831936804
660 2862576643
661 2867372749
662 2870725295
663 2887444084
664 2891971018
665 2895888387
666 2899368812
667 2915774856
668 2918503394
669 2929224045
670 2996228389
671 8047903120
672 8048365700
673 8048379439
674 8048389964
675 8054475382
676 8055068017
677 8055179100
678 8056208373

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

6

161

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p7p-assembly2.cif.gz_D crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion 0.7234 1 151
2p7m-assembly4.cif.gz_D-2 crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 6.5 0.7192 1 151
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.7131 1 151
2rbb-assembly1.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase family enzyme from burkholderia phytofirmans psjn 0.7107 6 151
2p7q-assembly4.cif.gz_A crystal structure of e126q mutant of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and 1s,2s-dihydroxypropylphosphonic acid 0.7052 1 151
ID Description Score Start End Superfamily
af_O06633_2_115_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8127 1 151 3.10.180.10
af_O06633_2_115_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7869 1 151 3.10.180.10
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7635 7 151 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7512 92 151 3.30.720.110
af_Q4DY51_38_295_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7417 122 151 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A543FB83-F1-model_v4 Glyoxalase-like domain-containing protein 0.9348 3 152
AF-A0A6A8RF46-F1-model_v4 deleted 0.9255 98 152
AF-A0A553K515-F1-model_v4 VOC family protein 0.9224 1 152
AF-A0A2N3WVV2-F1-model_v4 Glyoxalase-like domain-containing protein 0.9205 1 152
AF-A0A553K515-F1-model_v4 VOC family protein 0.9166 1 152

Map