F414052

General Info

Members Datasets Scaffolds Average Seq Length
339 204 336 221

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0022040|Ga0495643_0022040_2069_2824
Length 251
Sequence MMAASPGLETLKRRMSMDDTLIDRRNLLTAGAMLTIGTAALPGIASAAQAAPGIAGYAPQPVPLPFDPKAITGLSEKLLTSHHDNNYVGAVKRLGAISGQIAALDPATVPGFALNGLKREELIAWNSMILHELYFAGLGAQTRPGRALAAAIERDFGSDARWRAEFAAMGKALGGGSGWVLLTYSHRDNRLVNQWAADHSMTLAGATPLLALDMYEHAYTIDYGAKAAAYVDAFMGAVNWSSADARFAKAA

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
3 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
132 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
137 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
138 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
151 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
152 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
153 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
154 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
167 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
168 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
171 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
176 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
177 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
182 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
183 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
184 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
185 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
186 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
187 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
188 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
189 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
190 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
191 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
192 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
193 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
194 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
195 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
196 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
197 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
198 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
199 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
202 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
203 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
204 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.53
Nodule 0
Rhizoplane 4.13
Rhizosphere 64.6
Stem 0
Stem Tuber 0
Unclassified 9.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1019460 3300001915 Bacteria 1075
2 JGI24740J21852_10005459 3300001979 Bacteria 5374
3 JGI24740J21852_10006077 3300001979 Bacteria 5045
4 JGI25157J39369_1008861 3300002741 Bacteria 1378
5 JGI25153J46596_10000070 3300003215 Bacteria 117125
6 JGI25153J46596_10050797 3300003215 Bacteria 1192
7 Ga0055537_1009749 3300003773 Bacteria 2087
8 Ga0055524_1000088 3300003775 Bacteria 116065
9 Ga0055530_10002348 3300003791 Bacteria 12319
10 Ga0055530_10040150 3300003791 Bacteria 1151
11 Ga0055530_10045218 3300003791 Bacteria 1052
12 Ga0055531_10005320 3300003794 Bacteria 7553
13 Ga0055531_10032841 3300003794 Bacteria 1686
14 Ga0055543_1009479 3300004625 Bacteria 2089
15 Ga0055543_1018097 3300004625 Bacteria 1318
16 Ga0065165_1000294 3300005262 Bacteria 84454
17 Ga0065165_1011455 3300005262 Bacteria 3696
18 Ga0065165_1012040 3300005262 Bacteria 3553
19 Ga0065707_10154903 3300005295 Bacteria 1619
20 Ga0070658_10009134 3300005327 Bacteria 7969
21 Ga0070658_10010242 3300005327 Bacteria 7518
22 Ga0070658_10028859 3300005327 Bacteria 4454
23 Ga0070658_10718317 3300005327 Bacteria 868
24 Ga0070660_100069992 3300005339 Bacteria 2737
25 Ga0070660_100114830 3300005339 Bacteria 2145
26 Ga0070691_10013554 3300005341 Bacteria 3734
27 Ga0070661_100037750 3300005344 Bacteria 3515
28 Ga0070674_100012706 3300005356 Bacteria 5178
29 Ga0070659_100000379 3300005366 Bacteria 33654
30 Ga0070667_100000016 3300005367 Bacteria 237028
31 Ga0070678_100050154 3300005456 Bacteria 3017
32 Ga0070679_100140127 3300005530 Bacteria 2398
33 Ga0068853_100010925 3300005539 Bacteria 7359
34 Ga0068853_100045519 3300005539 Bacteria 3758
35 Ga0068853_100056751 3300005539 Bacteria 3378
36 Ga0068853_100295662 3300005539 Bacteria 1495
37 Ga0070672_100117649 3300005543 Bacteria 2173
38 Ga0070665_100000136 3300005548 Bacteria 138094
39 Ga0068855_100000259 3300005563 Bacteria 66061
40 Ga0068855_100032745 3300005563 Bacteria 6206
41 Ga0068855_100234978 3300005563 Bacteria 2050
42 Ga0068857_100015947 3300005577 Bacteria 6580
43 Ga0068857_100097874 3300005577 Bacteria 2631
44 Ga0068854_100012559 3300005578 Bacteria 5549
45 Ga0068854_100020318 3300005578 Bacteria 4491
46 Ga0068854_100099808 3300005578 Bacteria 2175
47 Ga0068854_100234121 3300005578 Bacteria 1459
48 Ga0068856_100036527 3300005614 Bacteria 4817
49 Ga0068856_100074917 3300005614 Bacteria 3352
50 Ga0068856_100111601 3300005614 Bacteria 2732
51 Ga0068856_100760056 3300005614 Bacteria 989
52 Ga0068852_100000824 3300005616 Bacteria 20475
53 Ga0068852_100013483 3300005616 Bacteria 6257
54 Ga0068852_100046565 3300005616 Bacteria 3696
55 Ga0068859_100173503 3300005617 Bacteria 2238
56 Ga0068859_100808018 3300005617 Bacteria 1025
57 Ga0068864_100005509 3300005618 Bacteria 10371
58 Ga0068863_100001872 3300005841 Bacteria 20915
59 Ga0068863_100033159 3300005841 Bacteria 4919
60 Ga0068858_100001972 3300005842 Bacteria 20980
61 Ga0068860_100000256 3300005843 Bacteria 78477
62 Ga0070717_10211088 3300006028 Bacteria 1704
63 Ga0075368_10000254 3300006042 Bacteria 15245
64 Ga0075363_100032079 3300006048 Bacteria 2727
65 Ga0075367_10000962 3300006178 Bacteria 11762
66 Ga0097621_100511115 3300006237 Bacteria 1089
67 Ga0075370_10130004 3300006353 Bacteria 1469
68 Ga0075370_10306977 3300006353 Bacteria 944
69 Ga0097620_100173495 3300006931 Bacteria 2238
70 Ga0097620_100807972 3300006931 Bacteria 1025
71 Ga0105240_10004776 3300009093 Bacteria 20437
72 Ga0105240_10015266 3300009093 Bacteria 10451
73 Ga0105240_10027006 3300009093 Bacteria 7525
74 Ga0105240_10632199 3300009093 Bacteria 1175
75 Ga0105245_10028520 3300009098 Bacteria 4925
76 Ga0105247_10011050 3300009101 Bacteria 5447
77 Ga0105243_10000913 3300009148 Bacteria 27723
78 Ga0105237_10027746 3300009545 Bacteria 5772
79 Ga0105237_10084499 3300009545 Bacteria 3165
80 Ga0105238_10091696 3300009551 Bacteria 3025
81 Ga0105238_10167765 3300009551 Bacteria 2171
82 Ga0105238_10187117 3300009551 Bacteria 2047
83 Ga0105238_10291248 3300009551 Bacteria 1615
84 Ga0105238_10954995 3300009551 Bacteria 877
85 Ga0105249_10139766 3300009553 Bacteria 2321
86 Ga0105239_10040102 3300010375 Bacteria 5130
87 Ga0105239_10315895 3300010375 Bacteria 1761
88 Ga0157373_10022841 3300013100 Bacteria 4536
89 Ga0157370_10023193 3300013104 Bacteria 6166
90 Ga0157378_10361563 3300013297 Bacteria 1420
91 Ga0157378_10665572 3300013297 Bacteria 1058
92 Ga0163162_10014801 3300013306 Bacteria 7620
93 Ga0163163_10066132 3300014325 Bacteria 3590
94 Ga0163163_10068196 3300014325 Bacteria 3539
95 Ga0163161_10650039 3300017792 Bacteria 874
96 Ga0209026_1004671 3300025250 Bacteria 3969
97 Ga0209565_1000010 3300025263 Bacteria 687724
98 Ga0209673_1001854 3300025273 Bacteria 17208
99 Ga0209675_1026042 3300025291 Bacteria 1463
100 Ga0209758_1000023 3300025297 Bacteria 612453
101 Ga0209758_1002455 3300025297 Bacteria 18916
102 Ga0209758_1002778 3300025297 Bacteria 17142
103 Ga0209050_1000053 3300025298 Bacteria 349521
104 Ga0209050_1001352 3300025298 Bacteria 26946
105 Ga0209256_1000034 3300025299 Bacteria 388475
106 Ga0207426_1053951 3300025302 Bacteria 1185
107 Ga0209257_1000316 3300025304 Bacteria 102171
108 Ga0209257_1000406 3300025304 Bacteria 83846
109 Ga0209257_1003218 3300025304 Bacteria 14400
110 Ga0207697_10076890 3300025315 Bacteria 1403
111 Ga0207647_10001658 3300025904 Bacteria 17144
112 Ga0207647_10008518 3300025904 Bacteria 7345
113 Ga0207647_10037190 3300025904 Bacteria 3088
114 Ga0207705_10000458 3300025909 Bacteria 34979
115 Ga0207705_10003962 3300025909 Bacteria 11259
116 Ga0207705_10006153 3300025909 Bacteria 8929
117 Ga0207705_10006553 3300025909 Bacteria 8623
118 Ga0207695_10000712 3300025913 Bacteria 64832
119 Ga0207695_10001112 3300025913 Bacteria 46803
120 Ga0207695_10016935 3300025913 Bacteria 8504
121 Ga0207695_10019296 3300025913 Bacteria 7852
122 Ga0207695_10034264 3300025913 Bacteria 5525
123 Ga0207671_10014109 3300025914 Bacteria 6330
124 Ga0207660_10318666 3300025917 Bacteria 1241
125 Ga0207657_10025032 3300025919 Bacteria 5513
126 Ga0207657_10282015 3300025919 Bacteria 1319
127 Ga0207652_10007639 3300025921 Bacteria 8700
128 Ga0207694_10024060 3300025924 Bacteria 4626
129 Ga0207694_10198257 3300025924 Bacteria 1632
130 Ga0207694_10631381 3300025924 Bacteria 902
131 Ga0207659_10290727 3300025926 Bacteria 1339
132 Ga0207687_10007954 3300025927 Bacteria 6942
133 Ga0207644_10142108 3300025931 Bacteria 1849
134 Ga0207690_10000180 3300025932 Bacteria 48788
135 Ga0207709_10000039 3300025935 Bacteria 260127
136 Ga0207709_10041409 3300025935 Bacteria 2763
137 Ga0207669_10000117 3300025937 Bacteria 39781
138 Ga0207691_10133501 3300025940 Bacteria 2191
139 Ga0207667_10000002 3300025949 Bacteria 895662
140 Ga0207667_10042269 3300025949 Bacteria 4846
141 Ga0207667_10052416 3300025949 Bacteria 4297
142 Ga0207667_10226712 3300025949 Bacteria 1914
143 Ga0207667_10252831 3300025949 Bacteria 1803
144 Ga0207667_10513840 3300025949 Bacteria 1214
145 Ga0207667_10530461 3300025949 Bacteria 1192
146 Ga0207651_10081400 3300025960 Bacteria 2334
147 Ga0207712_10101573 3300025961 Bacteria 2139
148 Ga0207640_10001182 3300025981 Bacteria 14277
149 Ga0207640_10032773 3300025981 Bacteria 3224
150 Ga0207658_10000075 3300025986 Bacteria 109004
151 Ga0207703_10000409 3300026035 Bacteria 45646
152 Ga0207639_10002462 3300026041 Bacteria 12418
153 Ga0207639_10011533 3300026041 Bacteria 6141
154 Ga0207639_10132190 3300026041 Bacteria 2067
155 Ga0207639_10393294 3300026041 Bacteria 1247
156 Ga0207639_10765301 3300026041 Bacteria 898
157 Ga0207678_10075670 3300026067 Bacteria 2884
158 Ga0207702_10005202 3300026078 Bacteria 11429
159 Ga0207702_10015393 3300026078 Bacteria 6338
160 Ga0207641_10005234 3300026088 Bacteria 11096
161 Ga0207676_10000150 3300026095 Bacteria 60517
162 Ga0207674_10009458 3300026116 Bacteria 11136
163 Ga0207674_10073726 3300026116 Bacteria 3426
164 Ga0207683_10000751 3300026121 Bacteria 29427
165 Ga0207683_10020748 3300026121 Bacteria 5621
166 Ga0207698_10000005 3300026142 Bacteria 295687
167 Ga0207698_10010061 3300026142 Bacteria 6058
168 Ga0207698_10227621 3300026142 Bacteria 1690
169 Ga0209813_10000050 3300027866 Bacteria 48358
170 Ga0268266_10000003 3300028379 Bacteria 1701703
171 Ga0268265_10480570 3300028380 Bacteria 1167
172 Ga0268264_10000087 3300028381 Bacteria 236696
173 Ga0307511_10075941 3300030521 Bacteria 2407
174 Ga0265327_10000140 3300031251 Bacteria 158935
175 Ga0265327_10102621 3300031251 Bacteria 1378
176 Ga0307513_10003469 3300031456 Bacteria 21333
177 Ga0307513_10006337 3300031456 Bacteria 15488
178 Ga0307513_10018519 3300031456 Bacteria 8316
179 Ga0307509_10244714 3300031507 Bacteria 1583
180 Ga0307408_100242052 3300031548 Bacteria 1483
181 Ga0307508_10017720 3300031616 Bacteria 6477
182 Ga0307516_10000020 3300031730 Bacteria 195931
183 Ga0307516_10559837 3300031730 Bacteria 797
184 Ga0307405_10008301 3300031731 Bacteria 5254
185 Ga0307413_10225302 3300031824 Bacteria 1372
186 Ga0307413_10309983 3300031824 Bacteria 1201
187 Ga0307413_10820918 3300031824 Bacteria 783
188 Ga0307413_10855274 3300031824 Bacteria 769
189 Ga0307410_10018866 3300031852 Bacteria 4179
190 Ga0307406_10027459 3300031901 Bacteria 3430
191 Ga0307407_10041392 3300031903 Bacteria 2576
192 Ga0307412_10004424 3300031911 Bacteria 7825
193 Ga0307412_10007983 3300031911 Bacteria 6033
194 Ga0307412_10192403 3300031911 Bacteria 1543
195 Ga0307409_100037542 3300031995 Bacteria 3572
196 Ga0307416_100118643 3300032002 Bacteria 2351
197 Ga0307416_100310375 3300032002 Bacteria 1573
198 Ga0307414_10008329 3300032004 Bacteria 5873
199 Ga0307414_10068272 3300032004 Bacteria 2550
200 Ga0307414_10701329 3300032004 Bacteria 916
201 Ga0307411_10133847 3300032005 Bacteria 1816
202 Ga0307510_10010837 3300033180 Bacteria 10837
203 Ga0307510_10034620 3300033180 Bacteria 5653
204 Ga0307510_10035530 3300033180 Bacteria 5563
205 Ga0307510_10231547 3300033180 Bacteria 1350
206 Ga0373936_0000872 3300035113 Bacteria 10762
207 Ga0373935_0064783 3300035692 Bacteria 2344
208 Ga0373927_0017681 3300035695 Bacteria 4690
209 Ga0373925_0000807 3300037068 Bacteria 28851
210 Ga0373925_0519507 3300037068 Bacteria 978
211 Ga0395905_0400012 3300037471 Bacteria 1268
212 Ga0439446_0065623 3300042156 Bacteria 1103
213 Ga0495638_0023631 3300046460 Bacteria 4017
214 Ga0495638_0053579 3300046460 Bacteria 2510
215 Ga0495638_0336876 3300046460 Bacteria 801
216 Ga0495650_0040638 3300046471 Bacteria 1995
217 Ga0495585_0001756 3300046492 Bacteria 16497
218 Ga0495585_0104116 3300046492 Bacteria 1515
219 Ga0495585_0214332 3300046492 Bacteria 974
220 Ga0495585_0246428 3300046492 Bacteria 893
221 Ga0495596_0116343 3300046500 Bacteria 1038
222 Ga0495583_0000154 3300046506 Bacteria 115360
223 Ga0495583_0002824 3300046506 Bacteria 14177
224 Ga0495583_0010407 3300046506 Bacteria 5428
225 Ga0495606_0000092 3300046507 Bacteria 152369
226 Ga0495606_0076283 3300046507 Bacteria 2095
227 Ga0495631_0026136 3300046518 Bacteria 2683
228 Ga0495637_0022151 3300046520 Bacteria 2901
229 Ga0495643_0000943 3300046522 Bacteria 30130
230 Ga0495643_0014657 3300046522 Bacteria 4658
231 Ga0495643_0022040 3300046522 Bacteria 3642
232 Ga0495648_0119664 3300046524 Bacteria 1418
233 Ga0495648_0171746 3300046524 Bacteria 1110
234 Ga0495642_0002900 3300046528 Bacteria 6833
235 Ga0495621_0120545 3300046539 Bacteria 1013
236 Ga0495597_0135186 3300046542 Bacteria 1020
237 Ga0495622_0008347 3300046557 Bacteria 4798
238 Ga0495633_0044447 3300046558 Bacteria 2105
239 Ga0495668_0006525 3300046616 Bacteria 7627
240 Ga0495668_0026330 3300046616 Bacteria 3301
241 Ga0495668_0032408 3300046616 Bacteria 2940
242 Ga0495668_0098391 3300046616 Bacteria 1601
243 Ga0495611_0002587 3300046648 Bacteria 8195
244 Ga0495625_0001610 3300046660 Bacteria 26640
245 Ga0495625_0020206 3300046660 Bacteria 5147
246 Ga0495625_0021830 3300046660 Bacteria 4917
247 Ga0495625_0022496 3300046660 Bacteria 4833
248 Ga0495625_0038746 3300046660 Bacteria 3486
249 Ga0495669_0000155 3300046684 Bacteria 43475
250 Ga0495613_0001442 3300046689 Bacteria 18175
251 Ga0495670_0013775 3300046691 Bacteria 3976
252 Ga0495649_0113234 3300046694 Bacteria 1438
253 Ga0495600_0005871 3300046809 Bacteria 7426
254 Ga0495660_0157015 3300046810 Bacteria 1119
255 Ga0495672_0120763 3300047320 Bacteria 1393
256 Ga0495683_0017026 3300047323 Bacteria 3770
257 Ga0495687_000109 3300047443 Bacteria 125648
258 Ga0495687_000353 3300047443 Bacteria 58833
259 Ga0495677_0006155 3300047445 Bacteria 4538
260 Ga0495673_0000056 3300047469 Bacteria 245918
261 Ga0495681_0003604 3300047470 Bacteria 10774
262 Ga0496100_0221404 3300048903 Bacteria 1389
263 Ga0496102_0000010 3300048905 Bacteria 324617
264 Ga0496102_0000163 3300048905 Bacteria 89673
265 Ga0496103_0000052 3300048906 Bacteria 149437
266 Ga0496103_0000082 3300048906 Bacteria 109451
267 Ga0496105_0001251 3300048908 Bacteria 17732
268 Ga0496105_0067936 3300048908 Bacteria 2944
269 Ga0496107_0308754 3300048910 Bacteria 1177
270 Ga0496110_0043775 3300048913 Bacteria 3909
271 Ga0496111_0003061 3300048914 Bacteria 10269
272 Ga0496114_0012274 3300048917 Bacteria 6855
273 Ga0496115_0000078 3300048918 Bacteria 89817
274 Ga0496115_0000166 3300048918 Bacteria 61341
275 Ga0496115_0001836 3300048918 Bacteria 15209
276 Ga0496116_0003807 3300048919 Bacteria 14745
277 Ga0496116_0014790 3300048919 Bacteria 6206
278 Ga0496117_0000037 3300048920 Bacteria 324960
279 Ga0496117_0000141 3300048920 Bacteria 158041
280 Ga0496118_0000034 3300048921 Bacteria 322764
281 Ga0496118_0000103 3300048921 Bacteria 158099
282 Ga0496119_0007042 3300048922 Bacteria 10233
283 Ga0496120_0021114 3300048923 Bacteria 4120
284 Ga0496121_0000078 3300048924 Bacteria 233455
285 Ga0496121_0000156 3300048924 Bacteria 149376
286 Ga0496122_0004210 3300048925 Bacteria 18088
287 Ga0496123_0001099 3300048926 Bacteria 40612
288 Ga0496124_0000033 3300048927 Bacteria 330586
289 Ga0496124_0000041 3300048927 Bacteria 303887
290 Ga0496125_0106874 3300048928 Bacteria 2041
291 Ga0496126_0000155 3300048929 Bacteria 158816
292 Ga0496126_0002366 3300048929 Bacteria 25723
293 Ga0496126_0026264 3300048929 Bacteria 5586
294 Ga0495682_0053784 3300049460 Bacteria 1462
295 Ga0501249_087292 3300049679 Bacteria 737
296 Ga0501257_022629 3300049686 Bacteria 1488
297 nmdc:mga06z11_54_c1 3300050494 Bacteria 48385
298 nmdc:mga04h51_32_c1 3300050495 Bacteria 48953
299 nmdc:mga07m45_38817_c1 3300050496 Bacteria 2659
300 Ga0500610_0000144 3300053079 Bacteria 21374
301 Ga0500643_002493 3300053087 Bacteria 9445
302 Ga0500643_005235 3300053087 Bacteria 5638
303 Ga0500643_011141 3300053087 Bacteria 3299
304 Ga0500644_0000084 3300053088 Bacteria 57829
305 Ga0500647_0107573 3300053091 Bacteria 1328
306 Ga0500583_0174106 3300053092 Bacteria 1072
307 Ga0500555_000512 3300053103 Bacteria 15626
308 Ga0500556_0000053 3300053104 Bacteria 117389
309 Ga0500556_0000579 3300053104 Bacteria 24337
310 Ga0500562_043402 3300053108 Bacteria 1197
311 Ga0500594_0014831 3300053118 Bacteria 1871
312 Ga0500595_001777 3300053119 Bacteria 11219
313 Ga0500595_012917 3300053119 Bacteria 3213
314 Ga0500597_129909 3300053120 Bacteria 1089
315 Ga0500608_000153 3300053122 Bacteria 28720
316 Ga0500608_076602 3300053122 Bacteria 1584
317 Ga0500614_018509 3300053123 Bacteria 1586
318 Ga0500617_108614 3300053124 Bacteria 1163
319 Ga0500642_0000001 3300053130 Bacteria 1468402
320 Ga0500655_003032 3300053133 Bacteria 3050
321 Ga0500559_0000006 3300053136 Bacteria 229895
322 Ga0500559_0103079 3300053136 Bacteria 1316
323 Ga0500559_0229613 3300053136 Bacteria 875
324 Ga0500564_014795 3300053138 Bacteria 3515
325 Ga0500568_0048239 3300053139 Bacteria 1685
326 Ga0500616_0038807 3300053153 Bacteria 2570
327 Ga0500616_0108222 3300053153 Bacteria 1347
328 Ga0500619_140862 3300053154 Bacteria 821
329 Ga0500622_0003179 3300053156 Bacteria 11207
330 Ga0500622_0157519 3300053156 Bacteria 1068
331 Ga0500625_000005 3300053729 Bacteria 209509
332 Ga0500645_000001 3300053730 Bacteria 455558
333 Ga0500645_000236 3300053730 Bacteria 41553
334 Ga0500645_002019 3300053730 Bacteria 9485
335 Ga0500645_017065 3300053730 Bacteria 2279
336 Ga0500645_054540 3300053730 Bacteria 1162

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005341 Ga0070691_10013554 Ga0070691_100135543 201
2 3300005530 Ga0070679_100140127 Ga0070679_1001401272 201
3 3300005539 Ga0068853_100295662 Ga0068853_1002956622 201
4 3300005563 Ga0068855_100234978 Ga0068855_1002349782 201
5 3300005578 Ga0068854_100099808 Ga0068854_1000998082 201
6 3300009551 Ga0105238_10187117 Ga0105238_101871172 201
7 3300017792 Ga0163161_10650039 Ga0163161_106500392 201
8 3300025913 Ga0207695_10000712 Ga0207695_1000071223 201
9 3300025913 Ga0207695_10001112 Ga0207695_100011122 201
10 3300025917 Ga0207660_10318666 Ga0207660_103186662 201
11 3300030521 Ga0307511_10075941 Ga0307511_100759413 201
12 3300037471 Ga0395905_0400012 Ga0395905_0400012_88_771 201
13 3300053088 Ga0500644_0000084 Ga0500644_0000084_3638_4327 201
14 3300053091 Ga0500647_0107573 Ga0500647_0107573_44_724 201
15 3300053119 Ga0500595_012917 Ga0500595_012917_1667_2347 201
16 3300053122 Ga0500608_000153 Ga0500608_000153_10786_11466 201
17 3300053123 Ga0500614_018509 Ga0500614_018509_674_1354 201
18 3300053136 Ga0500559_0103079 Ga0500559_0103079_61_741 201
19 3300053138 Ga0500564_014795 Ga0500564_014795_1711_2391 201
20 3300053154 Ga0500619_140862 Ga0500619_140862_72_752 201
21 3300053729 Ga0500625_000005 Ga0500625_000005_103321_104001 201
22 3300005339 Ga0070660_100069992 Ga0070660_1000699922 202
23 3300005366 Ga0070659_100000379 Ga0070659_10000037910 202
24 3300006028 Ga0070717_10211088 Ga0070717_102110882 202
25 3300025304 Ga0209257_1000406 Ga0209257_100040686 202
26 3300025919 Ga0207657_10282015 Ga0207657_102820152 202
27 3300025932 Ga0207690_10000180 Ga0207690_1000018028 202
28 3300046471 Ga0495650_0040638 Ga0495650_0040638_146_835 202
29 3300047320 Ga0495672_0120763 Ga0495672_0120763_68_760 202
30 3300048928 Ga0496125_0106874 Ga0496125_0106874_1298_2008 202
31 3300003791 Ga0055530_10002348 Ga0055530_100023486 204
32 3300003794 Ga0055531_10005320 Ga0055531_100053203 204
33 3300025297 Ga0209758_1002455 Ga0209758_100245511 204
34 3300025298 Ga0209050_1000053 Ga0209050_1000053290 204
35 3300025304 Ga0209257_1000316 Ga0209257_100031668 204
36 3300031251 Ga0265327_10102621 Ga0265327_101026213 204
37 3300031456 Ga0307513_10003469 Ga0307513_100034696 204
38 3300031616 Ga0307508_10017720 Ga0307508_100177202 204
39 3300031730 Ga0307516_10000020 Ga0307516_1000002034 204
40 3300031730 Ga0307516_10559837 Ga0307516_105598371 204
41 3300046492 Ga0495585_0104116 Ga0495585_0104116_749_1456 204
42 3300046500 Ga0495596_0116343 Ga0495596_0116343_204_890 204
43 3300046539 Ga0495621_0120545 Ga0495621_0120545_103_795 204
44 3300046616 Ga0495668_0026330 Ga0495668_0026330_135_812 204
45 3300014325 Ga0163163_10066132 Ga0163163_100661322 205
46 3300031456 Ga0307513_10018519 Ga0307513_100185198 205
47 3300046492 Ga0495585_0001756 Ga0495585_0001756_4368_5075 205
48 3300046689 Ga0495613_0001442 Ga0495613_0001442_13924_14613 205
49 3300047469 Ga0495673_0000056 Ga0495673_0000056_101735_102445 205
50 3300053153 Ga0500616_0038807 Ga0500616_0038807_1503_2210 205
51 3300053156 Ga0500622_0003179 Ga0500622_0003179_9791_10513 205
52 3300005262 Ga0065165_1012040 Ga0065165_10120402 206
53 3300005327 Ga0070658_10010242 Ga0070658_100102426 206
54 3300005327 Ga0070658_10718317 Ga0070658_107183171 206
55 3300005578 Ga0068854_100234121 Ga0068854_1002341211 206
56 3300005841 Ga0068863_100033159 Ga0068863_1000331593 206
57 3300014325 Ga0163163_10068196 Ga0163163_100681962 206
58 3300025909 Ga0207705_10006153 Ga0207705_100061536 206
59 3300028380 Ga0268265_10480570 Ga0268265_104805701 206
60 3300031824 Ga0307413_10855274 Ga0307413_108552741 207
61 3300035113 Ga0373936_0000872 Ga0373936_0000872_5990_6691 207
62 3300046524 Ga0495648_0119664 Ga0495648_0119664_463_1170 207
63 3300046616 Ga0495668_0098391 Ga0495668_0098391_134_826 207
64 3300025931 Ga0207644_10142108 Ga0207644_101421082 208
65 3300031251 Ga0265327_10000140 Ga0265327_10000140130 208
66 3300032004 Ga0307414_10701329 Ga0307414_107013292 208
67 3300053730 Ga0500645_000236 Ga0500645_000236_9247_9936 208
68 3300053730 Ga0500645_054540 Ga0500645_054540_183_878 208
69 3300005539 Ga0068853_100045519 Ga0068853_1000455196 209
70 3300025949 Ga0207667_10530461 Ga0207667_105304611 209
71 3300026041 Ga0207639_10765301 Ga0207639_107653011 209
72 3300032004 Ga0307414_10008329 Ga0307414_100083292 209
73 3300033180 Ga0307510_10035530 Ga0307510_100355302 209
74 3300035692 Ga0373935_0064783 Ga0373935_0064783_921_1613 209
75 3300046460 Ga0495638_0336876 Ga0495638_0336876_51_773 209
76 3300048924 Ga0496121_0000078 Ga0496121_0000078_21598_22296 209
77 3300048929 Ga0496126_0002366 Ga0496126_0002366_15534_16232 209
78 3300053087 Ga0500643_002493 Ga0500643_002493_5350_5997 209
79 3300053104 Ga0500556_0000579 Ga0500556_0000579_23161_23865 209
80 3300053730 Ga0500645_002019 Ga0500645_002019_51_755 209
81 3300005618 Ga0068864_100005509 Ga0068864_10000550912 210
82 3300009093 Ga0105240_10027006 Ga0105240_100270064 210
83 3300009551 Ga0105238_10291248 Ga0105238_102912482 210
84 3300025913 Ga0207695_10016935 Ga0207695_100169356 210
85 3300025949 Ga0207667_10226712 Ga0207667_102267122 210
86 3300025949 Ga0207667_10513840 Ga0207667_105138402 210
87 3300037068 Ga0373925_0519507 Ga0373925_0519507_259_954 210
88 3300046492 Ga0495585_0214332 Ga0495585_0214332_172_879 210
89 3300005367 Ga0070667_100000016 Ga0070667_100000016186 211
90 3300005614 Ga0068856_100760056 Ga0068856_1007600561 211
91 3300005617 Ga0068859_100808018 Ga0068859_1008080182 211
92 3300005841 Ga0068863_100001872 Ga0068863_10000187217 211
93 3300005843 Ga0068860_100000256 Ga0068860_10000025614 211
94 3300006931 Ga0097620_100807972 Ga0097620_1008079722 211
95 3300009553 Ga0105249_10139766 Ga0105249_101397663 211
96 3300013306 Ga0163162_10014801 Ga0163162_100148019 211
97 3300025315 Ga0207697_10076890 Ga0207697_100768902 211
98 3300025961 Ga0207712_10101573 Ga0207712_101015733 211
99 3300025986 Ga0207658_10000075 Ga0207658_10000075102 211
100 3300026088 Ga0207641_10005234 Ga0207641_100052347 211
101 3300028381 Ga0268264_10000087 Ga0268264_10000087187 211
102 3300046694 Ga0495649_0113234 Ga0495649_0113234_296_967 211
103 3300053120 Ga0500597_129909 Ga0500597_129909_151_846 211
104 3300053130 Ga0500642_0000001 Ga0500642_0000001_246030_246722 211
105 3300005339 Ga0070660_100114830 Ga0070660_1001148302 212
106 3300005543 Ga0070672_100117649 Ga0070672_1001176492 212
107 3300005617 Ga0068859_100173503 Ga0068859_1001735033 212
108 3300006931 Ga0097620_100173495 Ga0097620_1001734952 212
109 3300009101 Ga0105247_10011050 Ga0105247_100110503 212
110 3300009551 Ga0105238_10167765 Ga0105238_101677652 212
111 3300013297 Ga0157378_10361563 Ga0157378_103615632 212
112 3300025919 Ga0207657_10025032 Ga0207657_100250322 212
113 3300025924 Ga0207694_10198257 Ga0207694_101982572 212
114 3300025940 Ga0207691_10133501 Ga0207691_101335012 212
115 3300033180 Ga0307510_10231547 Ga0307510_102315472 212
116 3300053122 Ga0500608_076602 Ga0500608_076602_176_874 212
117 3300005344 Ga0070661_100037750 Ga0070661_1000377505 213
118 3300005563 Ga0068855_100000259 Ga0068855_10000025912 213
119 3300005614 Ga0068856_100074917 Ga0068856_1000749173 213
120 3300009093 Ga0105240_10015266 Ga0105240_100152669 213
121 3300025904 Ga0207647_10001658 Ga0207647_100016587 213
122 3300025913 Ga0207695_10034264 Ga0207695_100342644 213
123 3300025949 Ga0207667_10042269 Ga0207667_100422695 213
124 3300046460 Ga0495638_0053579 Ga0495638_0053579_1527_2222 213
125 3300046506 Ga0495583_0010407 Ga0495583_0010407_3072_3773 213
126 3300046524 Ga0495648_0171746 Ga0495648_0171746_137_838 213
127 3300046660 Ga0495625_0021830 Ga0495625_0021830_2860_3561 213
128 3300048905 Ga0496102_0000163 Ga0496102_0000163_51020_51721 213
129 3300048906 Ga0496103_0000052 Ga0496103_0000052_119419_120120 213
130 3300048908 Ga0496105_0001251 Ga0496105_0001251_7756_8457 213
131 3300048910 Ga0496107_0308754 Ga0496107_0308754_158_859 213
132 3300048913 Ga0496110_0043775 Ga0496110_0043775_2218_2919 213
133 3300048914 Ga0496111_0003061 Ga0496111_0003061_874_1575 213
134 3300048917 Ga0496114_0012274 Ga0496114_0012274_3052_3753 213
135 3300048918 Ga0496115_0000078 Ga0496115_0000078_37986_38687 213
136 3300048919 Ga0496116_0003807 Ga0496116_0003807_9252_9953 213
137 3300048920 Ga0496117_0000141 Ga0496117_0000141_37921_38622 213
138 3300048921 Ga0496118_0000103 Ga0496118_0000103_37979_38680 213
139 3300048923 Ga0496120_0021114 Ga0496120_0021114_2299_3000 213
140 3300048924 Ga0496121_0000156 Ga0496121_0000156_119401_120102 213
141 3300048927 Ga0496124_0000041 Ga0496124_0000041_121292_121993 213
142 3300048929 Ga0496126_0000155 Ga0496126_0000155_37973_38674 213
143 3300049679 Ga0501249_087292 Ga0501249_087292_33_716 213
144 3300053124 Ga0500617_108614 Ga0500617_108614_360_1040 213
145 3300053156 Ga0500622_0157519 Ga0500622_0157519_198_905 213
146 3300005327 Ga0070658_10028859 Ga0070658_100288596 214
147 3300005539 Ga0068853_100056751 Ga0068853_1000567515 214
148 3300005548 Ga0070665_100000136 Ga0070665_10000013638 214
149 3300009093 Ga0105240_10632199 Ga0105240_106321991 214
150 3300009551 Ga0105238_10954995 Ga0105238_109549951 214
151 3300010375 Ga0105239_10315895 Ga0105239_103158952 214
152 3300025909 Ga0207705_10006553 Ga0207705_100065533 214
153 3300025921 Ga0207652_10007639 Ga0207652_1000763912 214
154 3300025924 Ga0207694_10631381 Ga0207694_106313811 214
155 3300026041 Ga0207639_10132190 Ga0207639_101321902 214
156 3300026041 Ga0207639_10393294 Ga0207639_103932942 214
157 3300028379 Ga0268266_10000003 Ga0268266_10000003642 214
158 3300031507 Ga0307509_10244714 Ga0307509_102447142 214
159 3300048918 Ga0496115_0000166 Ga0496115_0000166_11771_12469 214
160 3300048918 Ga0496115_0001836 Ga0496115_0001836_13663_14388 214
161 3300053153 Ga0500616_0108222 Ga0500616_0108222_102_803 214
162 3300006042 Ga0075368_10000254 Ga0075368_100002542 215
163 3300006048 Ga0075363_100032079 Ga0075363_1000320793 215
164 3300006178 Ga0075367_10000962 Ga0075367_100009629 215
165 3300006353 Ga0075370_10306977 Ga0075370_103069771 215
166 3300027866 Ga0209813_10000050 Ga0209813_1000005038 215
167 3300031824 Ga0307413_10309983 Ga0307413_103099832 215
168 3300032004 Ga0307414_10068272 Ga0307414_100682722 215
169 3300046558 Ga0495633_0044447 Ga0495633_0044447_1276_1983 215
170 3300046809 Ga0495600_0005871 Ga0495600_0005871_386_1093 215
171 3300050494 nmdc:mga06z11_54_c1 nmdc:mga06z11_54_c1_9566_10276 215
172 3300050495 nmdc:mga04h51_32_c1 nmdc:mga04h51_32_c1_38110_38820 215
173 3300050496 nmdc:mga07m45_38817_c1 nmdc:mga07m45_38817_c1_89_799 215
174 3300053119 Ga0500595_001777 Ga0500595_001777_267_974 215
175 3300031824 Ga0307413_10820918 Ga0307413_108209181 216
176 3300032002 Ga0307416_100310375 Ga0307416_1003103752 216
177 3300047470 Ga0495681_0003604 Ga0495681_0003604_7660_8361 216
178 3300053136 Ga0500559_0229613 Ga0500559_0229613_133_837 216
179 3300005577 Ga0068857_100097874 Ga0068857_1000978743 217
180 3300026041 Ga0207639_10011533 Ga0207639_100115337 217
181 3300026116 Ga0207674_10073726 Ga0207674_100737263 217
182 3300031548 Ga0307408_100242052 Ga0307408_1002420522 217
183 3300031731 Ga0307405_10008301 Ga0307405_100083013 217
184 3300031824 Ga0307413_10225302 Ga0307413_102253022 217
185 3300031852 Ga0307410_10018866 Ga0307410_100188662 217
186 3300031903 Ga0307407_10041392 Ga0307407_100413923 217
187 3300031911 Ga0307412_10192403 Ga0307412_101924032 217
188 3300031995 Ga0307409_100037542 Ga0307409_1000375423 217
189 3300032002 Ga0307416_100118643 Ga0307416_1001186433 217
190 3300032005 Ga0307411_10133847 Ga0307411_101338472 217
191 3300033180 Ga0307510_10034620 Ga0307510_100346201 217
192 3300042156 Ga0439446_0065623 Ga0439446_0065623_59_742 217
193 3300047443 Ga0495687_000353 Ga0495687_000353_18516_19217 217
194 3300053136 Ga0500559_0000006 Ga0500559_0000006_2034_2741 217
195 iso_pu_bacteria 2643221598 2644000509 217
196 3300033180 Ga0307510_10010837 Ga0307510_100108377 218
197 3300046460 Ga0495638_0023631 Ga0495638_0023631_3191_3868 218
198 3300046506 Ga0495583_0002824 Ga0495583_0002824_12785_13462 218
199 3300046616 Ga0495668_0006525 Ga0495668_0006525_1965_2642 218
200 3300046660 Ga0495625_0020206 Ga0495625_0020206_225_902 218
201 3300047445 Ga0495677_0006155 Ga0495677_0006155_2408_3085 218
202 3300053104 Ga0500556_0000053 Ga0500556_0000053_43143_43835 218
203 3300053108 Ga0500562_043402 Ga0500562_043402_65_757 218
204 3300004625 Ga0055543_1009479 Ga0055543_10094794 220
205 3300005262 Ga0065165_1000294 Ga0065165_100029455 220
206 3300005456 Ga0070678_100050154 Ga0070678_1000501542 220
207 3300026121 Ga0207683_10020748 Ga0207683_100207482 220
208 3300046506 Ga0495583_0000154 Ga0495583_0000154_40823_41506 220
209 3300046557 Ga0495622_0008347 Ga0495622_0008347_2163_2861 220
210 3300046691 Ga0495670_0013775 Ga0495670_0013775_2355_3038 220
211 3300049686 Ga0501257_022629 Ga0501257_022629_289_984 220
212 3300053103 Ga0500555_000512 Ga0500555_000512_5232_5915 220
213 3300002741 JGI25157J39369_1008861 JGI25157J39369_10088611 221
214 3300003791 Ga0055530_10040150 Ga0055530_100401501 221
215 3300009098 Ga0105245_10028520 Ga0105245_100285207 221
216 3300013297 Ga0157378_10665572 Ga0157378_106655721 221
217 3300025250 Ga0209026_1004671 Ga0209026_10046715 221
218 3300025924 Ga0207694_10024060 Ga0207694_100240605 221
219 3300025927 Ga0207687_10007954 Ga0207687_100079542 221
220 3300025935 Ga0207709_10041409 Ga0207709_100414092 221
221 3300025949 Ga0207667_10252831 Ga0207667_102528311 221
222 3300031911 Ga0307412_10007983 Ga0307412_100079833 221
223 3300035695 Ga0373927_0017681 Ga0373927_0017681_3598_4290 221
224 3300037068 Ga0373925_0000807 Ga0373925_0000807_3598_4290 221
225 3300053139 Ga0500568_0048239 Ga0500568_0048239_737_1426 221
226 3300053730 Ga0500645_017065 Ga0500645_017065_201_965 221
227 iso_pu_bacteria 2791355048 2792462305 221
228 3300005616 Ga0068852_100046565 Ga0068852_1000465652 222
229 3300006353 Ga0075370_10130004 Ga0075370_101300042 222
230 3300026142 Ga0207698_10227621 Ga0207698_102276212 222
231 3300046616 Ga0495668_0032408 Ga0495668_0032408_1313_2002 222
232 3300046660 Ga0495625_0038746 Ga0495625_0038746_2338_3027 222
233 3300053087 Ga0500643_011141 Ga0500643_011141_1415_2107 222
234 3300003215 JGI25153J46596_10050797 JGI25153J46596_100507972 223
235 3300003773 Ga0055537_1009749 Ga0055537_10097492 223
236 3300003775 Ga0055524_1000088 Ga0055524_100008851 223
237 3300003791 Ga0055530_10045218 Ga0055530_100452181 223
238 3300003794 Ga0055531_10032841 Ga0055531_100328412 223
239 3300004625 Ga0055543_1018097 Ga0055543_10180972 223
240 3300005262 Ga0065165_1011455 Ga0065165_10114554 223
241 3300025263 Ga0209565_1000010 Ga0209565_1000010429 223
242 3300025273 Ga0209673_1001854 Ga0209673_100185410 223
243 3300025291 Ga0209675_1026042 Ga0209675_10260421 223
244 3300025297 Ga0209758_1002778 Ga0209758_10027782 223
245 3300025298 Ga0209050_1001352 Ga0209050_100135220 223
246 3300025299 Ga0209256_1000034 Ga0209256_1000034285 223
247 3300025302 Ga0207426_1053951 Ga0207426_10539512 223
248 3300025304 Ga0209257_1003218 Ga0209257_10032184 223
249 iso_pu_bacteria 2582581305 2585259706 223
250 3300053118 Ga0500594_0014831 Ga0500594_0014831_85_783 224
251 3300005842 Ga0068858_100001972 Ga0068858_1000019727 225
252 3300026035 Ga0207703_10000409 Ga0207703_100004098 225
253 3300026095 Ga0207676_10000150 Ga0207676_1000015020 225
254 3300031901 Ga0307406_10027459 Ga0307406_100274593 225
255 3300031911 Ga0307412_10004424 Ga0307412_100044245 225
256 3300046660 Ga0495625_0001610 Ga0495625_0001610_8493_9212 225
257 3300048925 Ga0496122_0004210 Ga0496122_0004210_1670_2377 225
258 3300048926 Ga0496123_0001099 Ga0496123_0001099_1750_2457 225
259 3300048929 Ga0496126_0026264 Ga0496126_0026264_4357_5064 225
260 3300046492 Ga0495585_0246428 Ga0495585_0246428_32_733 226
261 3300001915 JGI24741J21665_1019460 JGI24741J21665_10194601 227
262 3300001979 JGI24740J21852_10005459 JGI24740J21852_100054597 227
263 3300001979 JGI24740J21852_10006077 JGI24740J21852_100060774 227
264 3300003215 JGI25153J46596_10000070 JGI25153J46596_1000007037 227
265 3300005295 Ga0065707_10154903 Ga0065707_101549032 227
266 3300005327 Ga0070658_10009134 Ga0070658_100091346 227
267 3300005356 Ga0070674_100012706 Ga0070674_1000127065 227
268 3300005539 Ga0068853_100010925 Ga0068853_1000109257 227
269 3300005563 Ga0068855_100032745 Ga0068855_1000327455 227
270 3300005577 Ga0068857_100015947 Ga0068857_1000159475 227
271 3300005578 Ga0068854_100012559 Ga0068854_1000125594 227
272 3300005578 Ga0068854_100020318 Ga0068854_1000203184 227
273 3300005614 Ga0068856_100036527 Ga0068856_1000365275 227
274 3300005614 Ga0068856_100111601 Ga0068856_1001116013 227
275 3300005616 Ga0068852_100000824 Ga0068852_10000082411 227
276 3300005616 Ga0068852_100013483 Ga0068852_1000134835 227
277 3300006237 Ga0097621_100511115 Ga0097621_1005111152 227
278 3300009093 Ga0105240_10004776 Ga0105240_100047764 227
279 3300009148 Ga0105243_10000913 Ga0105243_100009137 227
280 3300009545 Ga0105237_10027746 Ga0105237_100277466 227
281 3300009545 Ga0105237_10084499 Ga0105237_100844993 227
282 3300009551 Ga0105238_10091696 Ga0105238_100916964 227
283 3300010375 Ga0105239_10040102 Ga0105239_100401024 227
284 3300013100 Ga0157373_10022841 Ga0157373_100228412 227
285 3300013104 Ga0157370_10023193 Ga0157370_100231936 227
286 3300025297 Ga0209758_1000023 Ga0209758_1000023414 227
287 3300025904 Ga0207647_10008518 Ga0207647_100085184 227
288 3300025904 Ga0207647_10037190 Ga0207647_100371904 227
289 3300025909 Ga0207705_10000458 Ga0207705_1000045831 227
290 3300025909 Ga0207705_10003962 Ga0207705_100039629 227
291 3300025913 Ga0207695_10019296 Ga0207695_100192966 227
292 3300025914 Ga0207671_10014109 Ga0207671_100141096 227
293 3300025926 Ga0207659_10290727 Ga0207659_102907272 227
294 3300025935 Ga0207709_10000039 Ga0207709_10000039169 227
295 3300025937 Ga0207669_10000117 Ga0207669_1000011720 227
296 3300025949 Ga0207667_10000002 Ga0207667_10000002880 227
297 3300025949 Ga0207667_10052416 Ga0207667_100524163 227
298 3300025960 Ga0207651_10081400 Ga0207651_100814002 227
299 3300025981 Ga0207640_10001182 Ga0207640_1000118214 227
300 3300025981 Ga0207640_10032773 Ga0207640_100327734 227
301 3300026041 Ga0207639_10002462 Ga0207639_1000246211 227
302 3300026067 Ga0207678_10075670 Ga0207678_100756702 227
303 3300026078 Ga0207702_10005202 Ga0207702_1000520212 227
304 3300026078 Ga0207702_10015393 Ga0207702_100153936 227
305 3300026116 Ga0207674_10009458 Ga0207674_100094586 227
306 3300026121 Ga0207683_10000751 Ga0207683_1000075111 227
307 3300026142 Ga0207698_10000005 Ga0207698_10000005257 227
308 3300026142 Ga0207698_10010061 Ga0207698_100100616 227
309 3300031456 Ga0307513_10006337 Ga0307513_100063379 227
310 3300046507 Ga0495606_0000092 Ga0495606_0000092_104663_105364 227
311 3300046507 Ga0495606_0076283 Ga0495606_0076283_1012_1713 227
312 3300046518 Ga0495631_0026136 Ga0495631_0026136_1328_2029 227
313 3300046520 Ga0495637_0022151 Ga0495637_0022151_844_1545 227
314 3300046522 Ga0495643_0000943 Ga0495643_0000943_16962_17663 227
315 3300046522 Ga0495643_0014657 Ga0495643_0014657_1600_2301 227
316 3300046522 Ga0495643_0022040 Ga0495643_0022040_2069_2824 227
317 3300046528 Ga0495642_0002900 Ga0495642_0002900_3461_4162 227
318 3300046542 Ga0495597_0135186 Ga0495597_0135186_31_732 227
319 3300046648 Ga0495611_0002587 Ga0495611_0002587_6288_6989 227
320 3300046660 Ga0495625_0022496 Ga0495625_0022496_2549_3250 227
321 3300046684 Ga0495669_0000155 Ga0495669_0000155_14560_15261 227
322 3300046810 Ga0495660_0157015 Ga0495660_0157015_74_775 227
323 3300047323 Ga0495683_0017026 Ga0495683_0017026_844_1545 227
324 3300047443 Ga0495687_000109 Ga0495687_000109_122854_123552 227
325 3300048903 Ga0496100_0221404 Ga0496100_0221404_584_1297 227
326 3300048905 Ga0496102_0000010 Ga0496102_0000010_5904_6617 227
327 3300048906 Ga0496103_0000082 Ga0496103_0000082_104483_105196 227
328 3300048908 Ga0496105_0067936 Ga0496105_0067936_1049_1762 227
329 3300048919 Ga0496116_0014790 Ga0496116_0014790_1410_2123 227
330 3300048920 Ga0496117_0000037 Ga0496117_0000037_6494_7207 227
331 3300048921 Ga0496118_0000034 Ga0496118_0000034_4298_5011 227
332 3300048922 Ga0496119_0007042 Ga0496119_0007042_5287_6000 227
333 3300048927 Ga0496124_0000033 Ga0496124_0000033_4298_5011 227
334 3300049460 Ga0495682_0053784 Ga0495682_0053784_481_1182 227
335 3300053079 Ga0500610_0000144 Ga0500610_0000144_1987_2688 227
336 3300053087 Ga0500643_005235 Ga0500643_005235_2337_3050 227
337 3300053092 Ga0500583_0174106 Ga0500583_0174106_229_930 227
338 3300053133 Ga0500655_003032 Ga0500655_003032_84_791 227
339 3300053730 Ga0500645_000001 Ga0500645_000001_329517_330218 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02777

Sod_Fe_C

Iron/manganese superoxide dismutases, C-terminal domain

144

246

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gn6-assembly1.cif.gz_A g152a mutant of mycobacterium tuberculosis iron-superoxide dismutase. 0.9279 36 226
8bhx-assembly1.cif.gz_A high resolution structure of the iron superoxide dismutase from thermobifida fusca 0.927 33 226
1gn3-assembly1.cif.gz_A h145q mutant of mycobacterium tuberculosis iron-superoxide dismutase. 0.9234 37 226
1ma1-assembly1.cif.gz_A structure and properties of the atypical iron superoxide dismutase from methanobacterium thermoautotrophicum 0.9216 33 225
1szx-assembly1.cif.gz_A role of hydrogen bonding in the active site of human manganese superoxide dismutase 0.9187 36 226
ID Description Score Start End Superfamily
af_P41980_114_231_3.55.40.20 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.9336 118 225 3.55.40.20
1gn4D02 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.9307 115 226 3.55.40.20
5ag2C02 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.9253 118 226 3.55.40.20
3ak3B02 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.9205 116 226 3.55.40.20
3ceiB02 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.9199 115 226 3.55.40.20
ID Description Score Start End GO Terms
AF-A0A0W1DRR9-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9939 41 226 GO:0004784
GO:0046872
AF-A0A0S9SFG2-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9895 50 226 GO:0004784
GO:0046872
AF-A0A7L8S6C9-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9857 33 226 GO:0004784
GO:0046872
AF-A0A531B659-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9833 58 226 GO:0004784
GO:0046872
AF-A0A1C3Y3U3-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9826 36 225 GO:0004784
GO:0046872

Feature Viewer

pLDDT pTM Quality
86.81 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map