F413998

General Info

Members Datasets Scaffolds Average Seq Length
339 196 262 190

Family's Representative Sequence

Representative Sequence 3300036647|Ga0316582_0000185|Ga0316582_0000185_15345_16031
Length 228
Sequence MSVARWATFTVYLRYRQLTTNHGHRAFLLGLKGGKMAAKKILLLAGDFVEDYEIMVPFQALQMVGHTVHAVCPDKKAGETVRTAVHDFEGDQTYSEKPGHNFTLNASFDEIKADDYDALVIPGGRAPEYIRLNNSVLKIVQHFAETQKPIAAICHGAQLLAAAGVLKSKSCSAYPAVGPDVKASGGEFVDIPVDQAHVDGNLVSAPAWPAHPDWLAKFLRVLGTKVEP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
5 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
6 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
7 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
8 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
9 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
10 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
11 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
12 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
13 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
14 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
15 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
16 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
17 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
18 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
19 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
20 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
21 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
22 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
23 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
24 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
25 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
26 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
27 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
28 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
29 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
30 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
31 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
32 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
33 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
34 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
35 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
36 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
37 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
38 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
39 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
40 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
41 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
42 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
43 2636415599 Klebsiella variicola DX120E Isolate Unclassified
44 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
45 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
46 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
47 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
48 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
49 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
50 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
51 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
52 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
53 2751185917 Enterobacter sp. HK169 Isolate Unclassified
54 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
55 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
56 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
57 2775507074 Klebsiella sp. D5A Isolate Unclassified
58 2821118458 Enterobacter asburiae 609 Isolate Unclassified
59 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
60 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
61 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
62 2885266251 Ralstonia sp. SET104 Isolate Nodule
63 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
64 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
65 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
66 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
67 2937967321 Serratia sp. YC16 Isolate Unclassified
68 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
69 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
70 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
71 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
72 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
73 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
74 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
75 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
76 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
77 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
105 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
106 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
107 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
118 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
125 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
126 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
127 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
128 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
129 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
130 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
131 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
132 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
139 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
140 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
144 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
145 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
146 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
147 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
148 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
149 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
150 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
172 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
173 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 8004592986 Serratia sp. S119 Isolate Unclassified
192 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
193 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
194 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
195 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
196 8055092621 Silvania confinis H4N4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.93
Metatranscriptomes 2.36
Isolates 22.71

Biome Distribution

Category Percentage (%)
Aerial Root 0.59
Bulb 0
Endosphere 0.88
Nodule 1.47
Rhizoplane 13.86
Rhizosphere 58.11
Stem 0
Stem Tuber 0
Unclassified 25.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1795684 2162886007 Bacteria 7259
2 rootH2_10045982 3300003320 Bacteria 32690
3 rootH1_10198924 3300003323 Bacteria 1755
4 Ga0058692_1000981 3300003856 Bacteria 11231
5 Ga0065704_10000240 3300005289 Bacteria 56098
6 Ga0065704_10132798 3300005289 Bacteria 1608
7 Ga0070659_100077850 3300005366 Bacteria 2645
8 Ga0070665_100000600 3300005548 Bacteria 49830
9 Ga0070704_100326052 3300005549 Bacteria 1288
10 Ga0070704_101478938 3300005549 Bacteria 624
11 Ga0068856_100239401 3300005614 Bacteria 1830
12 Ga0068851_10255740 3300005834 Bacteria 995
13 Ga0081455_10228829 3300005937 Bacteria 1373
14 Ga0075364_10006172 3300006051 Bacteria 7020
15 Ga0075366_10048347 3300006195 Bacteria 2522
16 Ga0075430_100022673 3300006846 Bacteria 5342
17 Ga0075431_100113102 3300006847 Bacteria 2802
18 Ga0075431_100505467 3300006847 Bacteria 1199
19 Ga0079104_1000907 3300006946 Bacteria 24005
20 Ga0079104_1001643 3300006946 Bacteria 14483
21 Ga0105251_10000002 3300009011 Bacteria 350843
22 Ga0105251_10000539 3300009011 Bacteria 35683
23 Ga0105251_10000549 3300009011 Bacteria 35334
24 Ga0105251_10001544 3300009011 Bacteria 19757
25 Ga0105251_10004257 3300009011 Bacteria 9863
26 Ga0105251_10108360 3300009011 Bacteria 1266
27 Ga0105251_10108520 3300009011 Bacteria 1265
28 Ga0105244_10003460 3300009036 Bacteria 11247
29 Ga0105250_10000330 3300009092 Bacteria 36615
30 Ga0105250_10016516 3300009092 Bacteria 3005
31 Ga0105240_10539733 3300009093 Bacteria 1292
32 Ga0105247_10000045 3300009101 Bacteria 153175
33 Ga0114129_10027409 3300009147 Bacteria 8066
34 Ga0105241_10000002 3300009174 Bacteria 869480
35 Ga0105248_10181375 3300009177 Bacteria 2372
36 Ga0105248_10901747 3300009177 Bacteria 998
37 Ga0105238_10793996 3300009551 Bacteria 962
38 Ga0105239_10418226 3300010375 Bacteria 1518
39 Ga0157373_10001547 3300013100 Bacteria 17560
40 Ga0157370_10007177 3300013104 Bacteria 12157
41 Ga0157372_11463882 3300013307 Bacteria 787
42 Ga0163163_10139414 3300014325 Bacteria 2467
43 Ga0182008_10007764 3300014497 Bacteria 5903
44 Ga0182006_1164325 3300015261 Bacteria 746
45 Ga0183366_1001 3300015679 Bacteria 2743932
46 Ga0183370_1001 3300015680 Bacteria 2743932
47 Ga0183369_1001 3300015685 Bacteria 2743932
48 Ga0183368_1001 3300015687 Bacteria 2743932
49 Ga0163161_10000001 3300017792 Bacteria 2041488
50 Ga0207696_1000001 3300025711 Bacteria 2579611
51 Ga0207696_1000003 3300025711 Bacteria 860639
52 Ga0207696_1000446 3300025711 Bacteria 36487
53 Ga0207655_1000064 3300025728 Bacteria 255782
54 Ga0207713_1000002 3300025735 Bacteria 1061749
55 Ga0207713_1000004 3300025735 Bacteria 702781
56 Ga0207713_1000008 3300025735 Bacteria 553952
57 Ga0207713_1000016 3300025735 Bacteria 421689
58 Ga0207713_1000533 3300025735 Bacteria 38234
59 Ga0207713_1023132 3300025735 Bacteria 2933
60 Ga0207713_1032097 3300025735 Bacteria 2311
61 Ga0207713_1034477 3300025735 Bacteria 2198
62 Ga0207710_10000780 3300025900 Bacteria 17362
63 Ga0207654_10000005 3300025911 Bacteria 869492
64 Ga0207695_10423523 3300025913 Bacteria 1215
65 Ga0207690_10369269 3300025932 Bacteria 1138
66 Ga0207711_10210346 3300025941 Bacteria 1776
67 Ga0209281_1000003 3300027111 Bacteria 1260089
68 Ga0209281_1001032 3300027111 Bacteria 21394
69 Ga0209371_1000001 3300027312 Bacteria 2771503
70 Ga0209371_1000301 3300027312 Bacteria 55150
71 Ga0209371_1001883 3300027312 Bacteria 12871
72 Ga0209371_1006269 3300027312 Bacteria 4449
73 Ga0209371_1034932 3300027312 Bacteria 1062
74 Ga0268266_10000762 3300028379 Bacteria 43072
75 Ga0268256_1000001 3300030500 Bacteria 2771065
76 Ga0268256_1000266 3300030500 Bacteria 55130
77 Ga0268256_1001620 3300030500 Bacteria 13032
78 Ga0268256_1004974 3300030500 Bacteria 5356
79 Ga0268256_1047952 3300030500 Bacteria 916
80 Ga0265325_10000929 3300031241 Bacteria 21157
81 Ga0265316_10012559 3300031344 Bacteria 7586
82 Ga0265316_10028289 3300031344 Bacteria 4626
83 Ga0307408_100308582 3300031548 Bacteria 1328
84 Ga0316575_10002981 3300031665 Bacteria 5765
85 Ga0316575_10154997 3300031665 Bacteria 946
86 Ga0316579_10003530 3300031691 Bacteria 6120
87 Ga0316579_10016216 3300031691 Bacteria 3250
88 Ga0316579_10028775 3300031691 Bacteria 2531
89 Ga0316579_10032165 3300031691 Bacteria 2405
90 Ga0316579_10046542 3300031691 Bacteria 2024
91 Ga0316579_10101034 3300031691 Bacteria 1381
92 Ga0316576_10028189 3300031727 Bacteria 3956
93 Ga0316576_10043208 3300031727 Bacteria 3251
94 Ga0316576_10054909 3300031727 Bacteria 2906
95 Ga0316576_10137095 3300031727 Bacteria 1842
96 Ga0316576_10173452 3300031727 Bacteria 1627
97 Ga0316576_10345973 3300031727 Bacteria 1107
98 Ga0316578_10000782 3300031728 Bacteria 11736
99 Ga0316578_10110452 3300031728 Bacteria 1651
100 Ga0316578_10306299 3300031728 Bacteria 949
101 Ga0316578_10363968 3300031728 Bacteria 860
102 Ga0316577_10008192 3300031733 Bacteria 5595
103 Ga0316577_10010850 3300031733 Bacteria 4926
104 Ga0316577_10021227 3300031733 Bacteria 3602
105 Ga0316577_10040196 3300031733 Unclassified 2616
106 Ga0316577_10043995 3300031733 Bacteria 2497
107 Ga0316577_10089628 3300031733 Bacteria 1722
108 Ga0316577_10118314 3300031733 Bacteria 1488
109 Ga0316577_10153745 3300031733 Bacteria 1297
110 Ga0316577_10323171 3300031733 Bacteria 875
111 Ga0316583_10004616 3300032133 Bacteria 4914
112 Ga0316583_10017586 3300032133 Bacteria 2572
113 Ga0316583_10031337 3300032133 Bacteria 1893
114 Ga0316583_10142365 3300032133 Bacteria 835
115 Ga0316585_10036216 3300032137 Bacteria 1564
116 Ga0316585_10040219 3300032137 Bacteria 1488
117 Ga0316585_10064615 3300032137 Bacteria 1185
118 Ga0316580_10006681 3300032139 Bacteria 3410
119 Ga0316580_10081016 3300032139 Bacteria 993
120 Ga0316580_10158810 3300032139 Bacteria 694
121 Ga0316593_10030591 3300032168 Bacteria 1749
122 Ga0316593_10114883 3300032168 Bacteria 963
123 Ga0316593_10190893 3300032168 Bacteria 755
124 Ga0316592_1025859 3300033524 Bacteria 1266
125 Ga0316586_1028113 3300033527 Bacteria 955
126 Ga0316596_1036172 3300033541 Bacteria 1290
127 Ga0316596_1053267 3300033541 Bacteria 1073
128 Ga0316596_1134073 3300033541 Bacteria 677
129 Ga0316574_0003902 3300035398 Bacteria 7750
130 Ga0316574_0081649 3300035398 Bacteria 2053
131 Ga0316574_0302217 3300035398 Bacteria 1017
132 Ga0373937_0178125 3300036401 Bacteria 1996
133 Ga0373937_0217516 3300036401 Bacteria 1798
134 Ga0316582_0000113 3300036647 Bacteria 22888
135 Ga0316582_0000185 3300036647 Bacteria 19514
136 Ga0316582_0088384 3300036647 Bacteria 2035
137 Ga0316582_0116341 3300036647 Bacteria 1785
138 Ga0316582_0223736 3300036647 Bacteria 1287
139 Ga0316582_0235562 3300036647 Bacteria 1253
140 Ga0316582_0241485 3300036647 Bacteria 1237
141 Ga0316582_0271164 3300036647 Bacteria 1164
142 Ga0316582_0279900 3300036647 Bacteria 1145
143 Ga0316584_0002135 3300036712 Bacteria 12375
144 Ga0316584_0002655 3300036712 Bacteria 11408
145 Ga0316584_0009270 3300036712 Bacteria 6823
146 Ga0316584_0012858 3300036712 Bacteria 5908
147 Ga0316584_0015352 3300036712 Bacteria 5476
148 Ga0316584_0016776 3300036712 Bacteria 5254
149 Ga0316584_0188021 3300036712 Bacteria 1528
150 Ga0316584_0255428 3300036712 Bacteria 1279
151 Ga0316581_0021866 3300037588 Bacteria 1883
152 Ga0316581_0058154 3300037588 Bacteria 1186
153 Ga0316581_0084519 3300037588 Bacteria 976
154 Ga0436364_1305061 3300037853 Bacteria 2604
155 Ga0395901_0151560 3300038443 Bacteria 2436
156 Ga0400484_43724 3300038725 Bacteria 4379
157 Ga0400486_01879 3300038742 Bacteria 1018
158 Ga0400489_32209 3300039093 Bacteria 2699
159 Ga0400487_28351 3300039110 Bacteria 14795
160 Ga0439466_0048371 3300041411 Bacteria 1399
161 Ga0451795_0917145 3300041456 Unclassified 860
162 Ga0439432_014825 3300042006 Bacteria 2635
163 Ga0439452_000062 3300042010 Bacteria 100841
164 Ga0451577_0000271 3300042876 Bacteria 101284
165 Ga0451577_1200811 3300042876 Bacteria 676
166 Ga0466981_0000007 3300044669 Bacteria 155983
167 Ga0453684_0000005 3300044712 Bacteria 1431632
168 Ga0453684_0444555 3300044712 Bacteria 1444
169 Ga0451576_0015235 3300045051 Bacteria 8525
170 Ga0451576_0735103 3300045051 Bacteria 1037
171 Ga0451576_1524820 3300045051 Bacteria 694
172 Ga0495627_000020 3300046453 Bacteria 291866
173 Ga0495653_0238340 3300046463 Bacteria 1214
174 Ga0495650_0000005 3300046471 Bacteria 766553
175 Ga0495608_0025733 3300046511 Bacteria 4017
176 Ga0495652_0415351 3300046529 Bacteria 949
177 Ga0495609_0092677 3300046538 Bacteria 1313
178 Ga0495667_0000069 3300046559 Bacteria 79580
179 Ga0495667_0152985 3300046559 Bacteria 1485
180 Ga0495635_0063369 3300046663 Bacteria 2539
181 Ga0495613_0086475 3300046689 Bacteria 2273
182 Ga0495671_0171926 3300046692 Bacteria 1053
183 Ga0495600_0350299 3300046809 Bacteria 925
184 Ga0495684_0002646 3300047471 Bacteria 14221
185 Ga0496104_0000344 3300048907 Bacteria 41481
186 Ga0496104_0224265 3300048907 Bacteria 1792
187 Ga0496105_0005468 3300048908 Bacteria 9639
188 Ga0496105_0210930 3300048908 Bacteria 1583
189 Ga0496116_0000001 3300048919 Bacteria 1501681
190 Ga0496116_0000204 3300048919 Bacteria 113862
191 Ga0496116_0023838 3300048919 Bacteria 4545
192 Ga0496117_0000421 3300048920 Bacteria 71461
193 Ga0496117_0001549 3300048920 Bacteria 32639
194 Ga0496117_0007778 3300048920 Bacteria 10337
195 Ga0496117_0009216 3300048920 Bacteria 9231
196 Ga0496117_0062038 3300048920 Bacteria 2564
197 Ga0496117_0377498 3300048920 Bacteria 723
198 Ga0496118_0000527 3300048921 Bacteria 62722
199 Ga0496118_0001793 3300048921 Bacteria 31005
200 Ga0496118_0017893 3300048921 Bacteria 6428
201 Ga0496118_0047258 3300048921 Bacteria 3337
202 Ga0496118_0078847 3300048921 Bacteria 2328
203 Ga0496119_0000824 3300048922 Bacteria 41353
204 Ga0496119_0000909 3300048922 Bacteria 38357
205 Ga0496119_0002200 3300048922 Bacteria 21791
206 Ga0496119_0010676 3300048922 Bacteria 7695
207 Ga0496119_0019841 3300048922 Bacteria 4928
208 Ga0496119_0036648 3300048922 Bacteria 3199
209 Ga0496119_0111270 3300048922 Bacteria 1519
210 Ga0496119_0212167 3300048922 Bacteria 995
211 Ga0496120_0000096 3300048923 Bacteria 145880
212 Ga0496120_0000159 3300048923 Bacteria 112577
213 Ga0496120_0000233 3300048923 Bacteria 95589
214 Ga0496120_0001151 3300048923 Bacteria 33896
215 Ga0496120_0003117 3300048923 Bacteria 15560
216 Ga0496121_0001075 3300048924 Bacteria 48357
217 Ga0496121_0001447 3300048924 Bacteria 40045
218 Ga0496121_0003562 3300048924 Bacteria 22032
219 Ga0496121_0006060 3300048924 Bacteria 15221
220 Ga0496121_0020298 3300048924 Bacteria 6586
221 Ga0496122_0001110 3300048925 Bacteria 46499
222 Ga0496122_0007319 3300048925 Bacteria 12326
223 Ga0496122_0185595 3300048925 Bacteria 1234
224 Ga0496123_0000940 3300048926 Bacteria 45468
225 Ga0496123_0003650 3300048926 Bacteria 17021
226 Ga0496123_0004258 3300048926 Bacteria 15236
227 Ga0496123_0031279 3300048926 Bacteria 3874
228 Ga0496123_0079570 3300048926 Bacteria 2002
229 Ga0496123_0189431 3300048926 Bacteria 1065
230 Ga0496123_0193049 3300048926 Bacteria 1051
231 Ga0496124_0000008 3300048927 Bacteria 864372
232 Ga0496124_0002250 3300048927 Bacteria 25638
233 Ga0496124_0025430 3300048927 Bacteria 5362
234 Ga0496124_0101798 3300048927 Bacteria 2326
235 Ga0496125_0000122 3300048928 Bacteria 174898
236 Ga0496125_0000931 3300048928 Bacteria 45982
237 Ga0496125_0013668 3300048928 Bacteria 7964
238 Ga0496125_0013995 3300048928 Bacteria 7844
239 Ga0496125_0028005 3300048928 Bacteria 5096
240 Ga0496125_0061106 3300048928 Bacteria 3024
241 Ga0496125_0150219 3300048928 Bacteria 1601
242 Ga0496126_0000472 3300048929 Bacteria 79898
243 Ga0496126_0016761 3300048929 Bacteria 7317
244 Ga0496126_0045566 3300048929 Bacteria 4029
245 Ga0496126_0193667 3300048929 Bacteria 1720
246 Ga0496126_0512915 3300048929 Bacteria 956
247 Ga0501032_0025640 3300049569 Bacteria 4064
248 Ga0501034_0116344 3300049571 Bacteria 2662
249 Ga0501034_0258584 3300049571 Bacteria 1684
250 Ga0501034_0260152 3300049571 Bacteria 1678
251 Ga0501034_0388303 3300049571 Bacteria 1320
252 Ga0501036_0103802 3300049572 Bacteria 2404
253 Ga0501036_0388220 3300049572 Bacteria 1165
254 Ga0501037_0137078 3300049573 Bacteria 1753
255 Ga0501038_0164712 3300049574 Bacteria 1799
256 Ga0501039_0456492 3300049575 Bacteria 1004
257 Ga0501035_0265287 3300049822 Bacteria 1455
258 nmdc:mga0k408_11129_c1 3300050493 Bacteria 3560
259 nmdc:mga05p37_8493_c1 3300050507 Bacteria 12142
260 nmdc:mga0qj67_173457_c1 3300050509 Bacteria 1751
261 nmdc:mga06r32_111168_c1 3300050510 Bacteria 2696
262 nmdc:mga06r32_496394_c1 3300050510 Bacteria 1198

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005937 Ga0081455_10228829 Ga0081455_102288292 180
2 3300009551 Ga0105238_10793996 Ga0105238_107939962 180
3 3300037853 Ga0436364_1305061 Ga0436364_1305061_493_1053 180
4 3300005549 Ga0070704_101478938 Ga0070704_1014789381 181
5 iso_pu_bacteria 2885266251 2885269050 182
6 iso_pu_bacteria 2939573065 2939575043 182
7 iso_pu_bacteria 2526164512 2526212177 183
8 iso_pu_bacteria 2547132416 2548649092 183
9 iso_pu_bacteria 2599185169 2599409731 183
10 iso_pu_bacteria 2600255254 2601521775 183
11 iso_pu_bacteria 2600255255 2601526800 183
12 iso_pu_bacteria 2600255280 2601613630 183
13 iso_pu_bacteria 2600255281 2601618353 183
14 iso_pu_bacteria 2600255287 2601643020 183
15 iso_pu_bacteria 2600255288 2601647890 183
16 iso_pu_bacteria 2600255289 2601651778 183
17 iso_pu_bacteria 2600255290 2601657105 183
18 iso_pu_bacteria 2600255291 2601662841 183
19 iso_pu_bacteria 2600255298 2601695800 183
20 iso_pu_bacteria 2600255299 2601700474 183
21 iso_pu_bacteria 2600255300 2601704902 183
22 iso_pu_bacteria 2600255301 2601709931 183
23 iso_pu_bacteria 2600255302 2601714943 183
24 iso_pu_bacteria 2600255303 2601720825 183
25 iso_pu_bacteria 2600255304 2601725349 183
26 iso_pu_bacteria 2600255305 2601729891 183
27 iso_pu_bacteria 2600255306 2601734908 183
28 iso_pu_bacteria 2600255307 2601739593 183
29 iso_pu_bacteria 2600255309 2601750082 183
30 iso_pu_bacteria 2600255392 2602017335 183
31 iso_pu_bacteria 2602042052 2603660216 183
32 iso_pu_bacteria 2602042053 2603665491 183
33 iso_pu_bacteria 2602042067 2603702723 183
34 iso_pu_bacteria 2602042103 2603837270 183
35 iso_pu_bacteria 2602042104 2603842346 183
36 iso_pu_bacteria 2602042105 2603847419 183
37 iso_pu_bacteria 2602042106 2603852490 183
38 iso_pu_bacteria 2602042109 2603867125 183
39 iso_pu_bacteria 2602042110 2603870544 183
40 iso_pu_bacteria 2602042111 2603875482 183
41 iso_pu_bacteria 2603880178 2606047734 183
42 iso_pu_bacteria 2603880184 2606069922 183
43 iso_pu_bacteria 2603880202 2606145761 183
44 iso_pu_bacteria 2603880211 2606175136 183
45 iso_pu_bacteria 2671180531 2673166666 183
46 iso_pu_bacteria 2675903046 2676406880 183
47 iso_pu_bacteria 2675903515 2678261910 183
48 iso_pu_bacteria 2681812866 2681998498 183
49 iso_pu_bacteria 2744054620 2745008258 183
50 iso_pu_bacteria 2751185917 2753856242 183
51 iso_pu_bacteria 2821118458 2821122714 183
52 iso_pu_bacteria 2823373977 2823374971 183
53 iso_pu_bacteria 2923634449 2923635149 183
54 iso_pu_bacteria 2927833300 2927833833 183
55 iso_pu_bacteria 8011350971 8011351360 183
56 iso_pu_bacteria 8055087960 8055090706 183
57 iso_pu_bacteria 8055092621 8055096653 183
58 iso_pu_bacteria 2506520007 2506578524 184
59 iso_pu_bacteria 2506520008 2506583663 184
60 iso_pu_bacteria 2602042047 2603642111 184
61 iso_pu_bacteria 2636415599 2637225659 184
62 iso_pu_bacteria 2654587920 2656279496 184
63 iso_pu_bacteria 2667528172 2671101881 184
64 iso_pu_bacteria 2681812869 2682005650 184
65 iso_pu_bacteria 2687453601 2689445071 184
66 iso_pu_bacteria 2765235842 2765589232 184
67 iso_pu_bacteria 2772190666 2772439050 184
68 iso_pu_bacteria 2775506706 2775539313 184
69 iso_pu_bacteria 2775507074 2777023518 184
70 iso_pu_bacteria 2844425489 2844427749 184
71 iso_pu_bacteria 2869551831 2869554491 184
72 iso_pu_bacteria 2888366609 2888369102 184
73 iso_pu_bacteria 2904513164 2904513479 184
74 iso_pu_bacteria 2937967321 2937967667 184
75 iso_pu_bacteria 2969079654 2969082649 184
76 iso_pu_bacteria 2974310843 2974311870 184
77 iso_pu_bacteria 2984559226 2984559726 184
78 iso_pu_bacteria 2984595703 2984597808 184
79 iso_pu_bacteria 8004592986 8004597305 184
80 iso_pu_bacteria 8015394850 8015395336 184
81 iso_pu_bacteria 8018405270 8018407556 184
82 3300032133 Ga0316583_10031337 Ga0316583_100313372 185
83 3300003323 rootH1_10198924 rootH1_101989241 186
84 3300006847 Ga0075431_100113102 Ga0075431_1001131022 186
85 3300009092 Ga0105250_10016516 Ga0105250_100165163 186
86 3300009147 Ga0114129_10027409 Ga0114129_100274096 186
87 3300025711 Ga0207696_1000003 Ga0207696_1000003139 186
88 3300031727 Ga0316576_10173452 Ga0316576_101734522 186
89 3300031733 Ga0316577_10008192 Ga0316577_100081922 186
90 3300032139 Ga0316580_10006681 Ga0316580_100066811 186
91 3300035398 Ga0316574_0003902 Ga0316574_0003902_7072_7650 186
92 3300036647 Ga0316582_0271164 Ga0316582_0271164_549_1127 186
93 3300036712 Ga0316584_0016776 Ga0316584_0016776_2443_3021 186
94 3300041456 Ga0451795_0917145 Ga0451795_0917145_185_763 186
95 3300046511 Ga0495608_0025733 Ga0495608_0025733_2161_2739 186
96 3300046538 Ga0495609_0092677 Ga0495609_0092677_684_1247 186
97 3300046559 Ga0495667_0000069 Ga0495667_0000069_45476_46054 186
98 3300048925 Ga0496122_0185595 Ga0496122_0185595_110_673 186
99 3300048926 Ga0496123_0079570 Ga0496123_0079570_140_703 186
100 3300048928 Ga0496125_0000122 Ga0496125_0000122_43511_44074 186
101 3300048929 Ga0496126_0193667 Ga0496126_0193667_584_1147 186
102 3300050507 nmdc:mga05p37_8493_c1 nmdc:mga05p37_8493_c1_3997_4599 186
103 3300050510 nmdc:mga06r32_111168_c1 nmdc:mga06r32_111168_c1_317_919 186
104 3300003856 Ga0058692_1000981 Ga0058692_10009815 187
105 3300005549 Ga0070704_100326052 Ga0070704_1003260522 187
106 3300005614 Ga0068856_100239401 Ga0068856_1002394012 187
107 3300005834 Ga0068851_10255740 Ga0068851_102557402 187
108 3300006846 Ga0075430_100022673 Ga0075430_1000226737 187
109 3300006847 Ga0075431_100505467 Ga0075431_1005054672 187
110 3300006946 Ga0079104_1001643 Ga0079104_10016437 187
111 3300009011 Ga0105251_10000549 Ga0105251_100005493 187
112 3300009011 Ga0105251_10001544 Ga0105251_100015447 187
113 3300009036 Ga0105244_10003460 Ga0105244_100034602 187
114 3300009092 Ga0105250_10000330 Ga0105250_1000033033 187
115 3300009177 Ga0105248_10181375 Ga0105248_101813752 187
116 3300009177 Ga0105248_10901747 Ga0105248_109017472 187
117 3300010375 Ga0105239_10418226 Ga0105239_104182262 187
118 3300013307 Ga0157372_11463882 Ga0157372_114638821 187
119 3300014325 Ga0163163_10139414 Ga0163163_101394142 187
120 3300015679 Ga0183366_1001 Ga0183366_10011687 187
121 3300015680 Ga0183370_1001 Ga0183370_10011687 187
122 3300015685 Ga0183369_1001 Ga0183369_10011687 187
123 3300015687 Ga0183368_1001 Ga0183368_10011687 187
124 3300025711 Ga0207696_1000446 Ga0207696_10004469 187
125 3300025735 Ga0207713_1000002 Ga0207713_1000002870 187
126 3300025735 Ga0207713_1000004 Ga0207713_1000004548 187
127 3300025913 Ga0207695_10423523 Ga0207695_104235233 187
128 3300025941 Ga0207711_10210346 Ga0207711_102103462 187
129 3300027111 Ga0209281_1001032 Ga0209281_100103210 187
130 3300027312 Ga0209371_1000301 Ga0209371_10003014 187
131 3300027312 Ga0209371_1001883 Ga0209371_10018833 187
132 3300027312 Ga0209371_1006269 Ga0209371_10062694 187
133 3300027312 Ga0209371_1034932 Ga0209371_10349322 187
134 3300030500 Ga0268256_1000266 Ga0268256_100026650 187
135 3300030500 Ga0268256_1001620 Ga0268256_10016209 187
136 3300030500 Ga0268256_1004974 Ga0268256_10049744 187
137 3300030500 Ga0268256_1047952 Ga0268256_10479521 187
138 3300031241 Ga0265325_10000929 Ga0265325_100009294 187
139 3300031344 Ga0265316_10012559 Ga0265316_100125598 187
140 3300031344 Ga0265316_10028289 Ga0265316_100282896 187
141 3300031548 Ga0307408_100308582 Ga0307408_1003085821 187
142 3300031665 Ga0316575_10002981 Ga0316575_100029813 187
143 3300031665 Ga0316575_10154997 Ga0316575_101549972 187
144 3300031691 Ga0316579_10003530 Ga0316579_100035305 187
145 3300031691 Ga0316579_10016216 Ga0316579_100162163 187
146 3300031691 Ga0316579_10028775 Ga0316579_100287752 187
147 3300031691 Ga0316579_10032165 Ga0316579_100321653 187
148 3300031691 Ga0316579_10046542 Ga0316579_100465422 187
149 3300031691 Ga0316579_10101034 Ga0316579_101010341 187
150 3300031727 Ga0316576_10028189 Ga0316576_100281892 187
151 3300031727 Ga0316576_10043208 Ga0316576_100432083 187
152 3300031727 Ga0316576_10054909 Ga0316576_100549092 187
153 3300031727 Ga0316576_10137095 Ga0316576_101370951 187
154 3300031727 Ga0316576_10345973 Ga0316576_103459732 187
155 3300031728 Ga0316578_10000782 Ga0316578_1000078210 187
156 3300031728 Ga0316578_10110452 Ga0316578_101104522 187
157 3300031728 Ga0316578_10306299 Ga0316578_103062991 187
158 3300031728 Ga0316578_10363968 Ga0316578_103639681 187
159 3300031733 Ga0316577_10010850 Ga0316577_100108503 187
160 3300031733 Ga0316577_10021227 Ga0316577_100212274 187
161 3300031733 Ga0316577_10040196 Ga0316577_100401962 187
162 3300031733 Ga0316577_10043995 Ga0316577_100439952 187
163 3300031733 Ga0316577_10089628 Ga0316577_100896282 187
164 3300031733 Ga0316577_10118314 Ga0316577_101183143 187
165 3300031733 Ga0316577_10153745 Ga0316577_101537451 187
166 3300031733 Ga0316577_10323171 Ga0316577_103231712 187
167 3300032133 Ga0316583_10004616 Ga0316583_100046166 187
168 3300032133 Ga0316583_10017586 Ga0316583_100175862 187
169 3300032133 Ga0316583_10142365 Ga0316583_101423652 187
170 3300032137 Ga0316585_10036216 Ga0316585_100362162 187
171 3300032137 Ga0316585_10040219 Ga0316585_100402192 187
172 3300032137 Ga0316585_10064615 Ga0316585_100646152 187
173 3300032139 Ga0316580_10081016 Ga0316580_100810162 187
174 3300032139 Ga0316580_10158810 Ga0316580_101588101 187
175 3300032168 Ga0316593_10030591 Ga0316593_100305913 187
176 3300032168 Ga0316593_10114883 Ga0316593_101148832 187
177 3300032168 Ga0316593_10190893 Ga0316593_101908931 187
178 3300033524 Ga0316592_1025859 Ga0316592_10258592 187
179 3300033527 Ga0316586_1028113 Ga0316586_10281131 187
180 3300033541 Ga0316596_1036172 Ga0316596_10361723 187
181 3300033541 Ga0316596_1053267 Ga0316596_10532672 187
182 3300033541 Ga0316596_1134073 Ga0316596_11340731 187
183 3300035398 Ga0316574_0081649 Ga0316574_0081649_1059_1664 187
184 3300035398 Ga0316574_0302217 Ga0316574_0302217_380_961 187
185 3300036401 Ga0373937_0178125 Ga0373937_0178125_1398_1979 187
186 3300036401 Ga0373937_0217516 Ga0373937_0217516_1104_1685 187
187 3300036647 Ga0316582_0000113 Ga0316582_0000113_10934_11539 187
188 3300036647 Ga0316582_0000185 Ga0316582_0000185_15345_16031 187
189 3300036647 Ga0316582_0088384 Ga0316582_0088384_179_760 187
190 3300036647 Ga0316582_0116341 Ga0316582_0116341_1153_1734 187
191 3300036647 Ga0316582_0223736 Ga0316582_0223736_77_658 187
192 3300036647 Ga0316582_0235562 Ga0316582_0235562_307_888 187
193 3300036647 Ga0316582_0241485 Ga0316582_0241485_509_1090 187
194 3300036647 Ga0316582_0279900 Ga0316582_0279900_319_954 187
195 3300036712 Ga0316584_0002135 Ga0316584_0002135_331_936 187
196 3300036712 Ga0316584_0002655 Ga0316584_0002655_6700_7386 187
197 3300036712 Ga0316584_0009270 Ga0316584_0009270_2229_2810 187
198 3300036712 Ga0316584_0012858 Ga0316584_0012858_1537_2190 187
199 3300036712 Ga0316584_0015352 Ga0316584_0015352_680_1261 187
200 3300036712 Ga0316584_0188021 Ga0316584_0188021_262_843 187
201 3300036712 Ga0316584_0255428 Ga0316584_0255428_409_990 187
202 3300037588 Ga0316581_0021866 Ga0316581_0021866_499_1185 187
203 3300037588 Ga0316581_0058154 Ga0316581_0058154_549_1130 187
204 3300037588 Ga0316581_0084519 Ga0316581_0084519_360_941 187
205 3300038443 Ga0395901_0151560 Ga0395901_0151560_483_1088 187
206 3300038725 Ga0400484_43724 Ga0400484_43724_2561_3142 187
207 3300038742 Ga0400486_01879 Ga0400486_01879_216_875 187
208 3300039093 Ga0400489_32209 Ga0400489_32209_562_1143 187
209 3300039110 Ga0400487_28351 Ga0400487_28351_5207_5788 187
210 3300042876 Ga0451577_0000271 Ga0451577_0000271_10892_11473 187
211 3300042876 Ga0451577_1200811 Ga0451577_1200811_39_620 187
212 3300044712 Ga0453684_0000005 Ga0453684_0000005_87369_87950 187
213 3300044712 Ga0453684_0444555 Ga0453684_0444555_482_1063 187
214 3300045051 Ga0451576_0015235 Ga0451576_0015235_533_1165 187
215 3300045051 Ga0451576_0735103 Ga0451576_0735103_428_1009 187
216 3300045051 Ga0451576_1524820 Ga0451576_1524820_15_596 187
217 3300046463 Ga0495653_0238340 Ga0495653_0238340_514_1095 187
218 3300046529 Ga0495652_0415351 Ga0495652_0415351_322_903 187
219 3300046559 Ga0495667_0152985 Ga0495667_0152985_336_917 187
220 3300046663 Ga0495635_0063369 Ga0495635_0063369_155_736 187
221 3300046689 Ga0495613_0086475 Ga0495613_0086475_290_871 187
222 3300046809 Ga0495600_0350299 Ga0495600_0350299_233_814 187
223 3300047471 Ga0495684_0002646 Ga0495684_0002646_11692_12273 187
224 3300048907 Ga0496104_0224265 Ga0496104_0224265_367_930 187
225 3300048908 Ga0496105_0210930 Ga0496105_0210930_307_870 187
226 3300048920 Ga0496117_0007778 Ga0496117_0007778_6176_6739 187
227 3300048920 Ga0496117_0062038 Ga0496117_0062038_1049_1612 187
228 3300048921 Ga0496118_0017893 Ga0496118_0017893_5697_6260 187
229 3300048921 Ga0496118_0078847 Ga0496118_0078847_916_1497 187
230 3300048922 Ga0496119_0019841 Ga0496119_0019841_4112_4675 187
231 3300048922 Ga0496119_0111270 Ga0496119_0111270_27_590 187
232 3300048923 Ga0496120_0003117 Ga0496120_0003117_958_1521 187
233 3300048924 Ga0496121_0006060 Ga0496121_0006060_9807_10370 187
234 3300048924 Ga0496121_0020298 Ga0496121_0020298_2345_2908 187
235 3300048926 Ga0496123_0031279 Ga0496123_0031279_175_738 187
236 3300048926 Ga0496123_0189431 Ga0496123_0189431_56_619 187
237 3300048926 Ga0496123_0193049 Ga0496123_0193049_41_604 187
238 3300048927 Ga0496124_0002250 Ga0496124_0002250_9779_10342 187
239 3300048928 Ga0496125_0013668 Ga0496125_0013668_3813_4376 187
240 3300048928 Ga0496125_0061106 Ga0496125_0061106_1834_2400 187
241 3300048928 Ga0496125_0150219 Ga0496125_0150219_906_1469 187
242 3300048929 Ga0496126_0512915 Ga0496126_0512915_258_824 187
243 3300049569 Ga0501032_0025640 Ga0501032_0025640_786_1367 187
244 3300049571 Ga0501034_0116344 Ga0501034_0116344_417_998 187
245 3300049571 Ga0501034_0258584 Ga0501034_0258584_11_601 187
246 3300049571 Ga0501034_0260152 Ga0501034_0260152_966_1550 187
247 3300049571 Ga0501034_0388303 Ga0501034_0388303_62_643 187
248 3300049572 Ga0501036_0103802 Ga0501036_0103802_21_608 187
249 3300049572 Ga0501036_0388220 Ga0501036_0388220_426_1019 187
250 3300049573 Ga0501037_0137078 Ga0501037_0137078_389_970 187
251 3300049574 Ga0501038_0164712 Ga0501038_0164712_113_694 187
252 3300049575 Ga0501039_0456492 Ga0501039_0456492_283_864 187
253 3300049822 Ga0501035_0265287 Ga0501035_0265287_457_1038 187
254 3300050509 nmdc:mga0qj67_173457_c1 nmdc:mga0qj67_173457_c1_442_1023 187
255 3300050510 nmdc:mga06r32_496394_c1 nmdc:mga06r32_496394_c1_416_997 187
256 2162886007 SwRhRL2b_contig_1795684 SwRhRL2b_0913.00006660 188
257 3300003320 rootH2_10045982 rootH2_1004598227 188
258 3300005289 Ga0065704_10000240 Ga0065704_1000024018 188
259 3300005289 Ga0065704_10132798 Ga0065704_101327982 188
260 3300005366 Ga0070659_100077850 Ga0070659_1000778503 188
261 3300005548 Ga0070665_100000600 Ga0070665_10000060049 188
262 3300006051 Ga0075364_10006172 Ga0075364_100061727 188
263 3300006195 Ga0075366_10048347 Ga0075366_100483473 188
264 3300006946 Ga0079104_1000907 Ga0079104_100090718 188
265 3300009011 Ga0105251_10000002 Ga0105251_1000000263 188
266 3300009011 Ga0105251_10000539 Ga0105251_1000053929 188
267 3300009011 Ga0105251_10004257 Ga0105251_100042575 188
268 3300009011 Ga0105251_10108360 Ga0105251_101083602 188
269 3300009011 Ga0105251_10108520 Ga0105251_101085202 188
270 3300009093 Ga0105240_10539733 Ga0105240_105397332 188
271 3300009101 Ga0105247_10000045 Ga0105247_10000045136 188
272 3300009174 Ga0105241_10000002 Ga0105241_10000002250 188
273 3300013100 Ga0157373_10001547 Ga0157373_100015479 188
274 3300013104 Ga0157370_10007177 Ga0157370_100071775 188
275 3300014497 Ga0182008_10007764 Ga0182008_100077644 188
276 3300015261 Ga0182006_1164325 Ga0182006_11643251 188
277 3300017792 Ga0163161_10000001 Ga0163161_100000011289 188
278 3300025711 Ga0207696_1000001 Ga0207696_10000011358 188
279 3300025728 Ga0207655_1000064 Ga0207655_100006492 188
280 3300025735 Ga0207713_1000008 Ga0207713_1000008282 188
281 3300025735 Ga0207713_1000016 Ga0207713_1000016324 188
282 3300025735 Ga0207713_1000533 Ga0207713_100053314 188
283 3300025735 Ga0207713_1023132 Ga0207713_10231323 188
284 3300025735 Ga0207713_1032097 Ga0207713_10320972 188
285 3300025735 Ga0207713_1034477 Ga0207713_10344773 188
286 3300025900 Ga0207710_10000780 Ga0207710_1000078015 188
287 3300025911 Ga0207654_10000005 Ga0207654_10000005249 188
288 3300025932 Ga0207690_10369269 Ga0207690_103692692 188
289 3300027111 Ga0209281_1000003 Ga0209281_1000003465 188
290 3300027312 Ga0209371_1000001 Ga0209371_10000011700 188
291 3300028379 Ga0268266_10000762 Ga0268266_1000076214 188
292 3300030500 Ga0268256_1000001 Ga0268256_1000001942 188
293 3300041411 Ga0439466_0048371 Ga0439466_0048371_665_1234 188
294 3300042006 Ga0439432_014825 Ga0439432_014825_1651_2220 188
295 3300042010 Ga0439452_000062 Ga0439452_000062_59694_60260 188
296 3300044669 Ga0466981_0000007 Ga0466981_0000007_112337_112906 188
297 3300046453 Ga0495627_000020 Ga0495627_000020_136367_136972 188
298 3300046471 Ga0495650_0000005 Ga0495650_0000005_205206_205772 188
299 3300046692 Ga0495671_0171926 Ga0495671_0171926_134_709 188
300 3300048907 Ga0496104_0000344 Ga0496104_0000344_9806_10372 188
301 3300048908 Ga0496105_0005468 Ga0496105_0005468_6302_6868 188
302 3300048919 Ga0496116_0000001 Ga0496116_0000001_786983_787588 188
303 3300048919 Ga0496116_0000204 Ga0496116_0000204_24797_25363 188
304 3300048919 Ga0496116_0023838 Ga0496116_0023838_828_1394 188
305 3300048920 Ga0496117_0000421 Ga0496117_0000421_48639_49205 188
306 3300048920 Ga0496117_0001549 Ga0496117_0001549_26702_27307 188
307 3300048920 Ga0496117_0009216 Ga0496117_0009216_5668_6234 188
308 3300048920 Ga0496117_0377498 Ga0496117_0377498_127_696 188
309 3300048921 Ga0496118_0000527 Ga0496118_0000527_55284_55850 188
310 3300048921 Ga0496118_0001793 Ga0496118_0001793_4632_5237 188
311 3300048921 Ga0496118_0047258 Ga0496118_0047258_2283_2849 188
312 3300048922 Ga0496119_0000824 Ga0496119_0000824_2568_3137 188
313 3300048922 Ga0496119_0000909 Ga0496119_0000909_34809_35378 188
314 3300048922 Ga0496119_0002200 Ga0496119_0002200_2066_2632 188
315 3300048922 Ga0496119_0010676 Ga0496119_0010676_139_708 188
316 3300048922 Ga0496119_0036648 Ga0496119_0036648_2181_2750 188
317 3300048922 Ga0496119_0212167 Ga0496119_0212167_342_908 188
318 3300048923 Ga0496120_0000096 Ga0496120_0000096_44173_44739 188
319 3300048923 Ga0496120_0000159 Ga0496120_0000159_70627_71196 188
320 3300048923 Ga0496120_0000233 Ga0496120_0000233_50543_51112 188
321 3300048923 Ga0496120_0001151 Ga0496120_0001151_19428_19994 188
322 3300048924 Ga0496121_0001075 Ga0496121_0001075_42707_43273 188
323 3300048924 Ga0496121_0001447 Ga0496121_0001447_35380_35949 188
324 3300048924 Ga0496121_0003562 Ga0496121_0003562_4444_5010 188
325 3300048925 Ga0496122_0001110 Ga0496122_0001110_36627_37193 188
326 3300048925 Ga0496122_0007319 Ga0496122_0007319_6672_7238 188
327 3300048926 Ga0496123_0000940 Ga0496123_0000940_8276_8842 188
328 3300048926 Ga0496123_0003650 Ga0496123_0003650_12630_13196 188
329 3300048926 Ga0496123_0004258 Ga0496123_0004258_8419_8985 188
330 3300048927 Ga0496124_0000008 Ga0496124_0000008_138239_138808 188
331 3300048927 Ga0496124_0025430 Ga0496124_0025430_3670_4236 188
332 3300048927 Ga0496124_0101798 Ga0496124_0101798_447_1013 188
333 3300048928 Ga0496125_0000931 Ga0496125_0000931_6953_7522 188
334 3300048928 Ga0496125_0013995 Ga0496125_0013995_30_596 188
335 3300048928 Ga0496125_0028005 Ga0496125_0028005_4501_5067 188
336 3300048929 Ga0496126_0000472 Ga0496126_0000472_44038_44604 188
337 3300048929 Ga0496126_0016761 Ga0496126_0016761_3600_4166 188
338 3300048929 Ga0496126_0045566 Ga0496126_0045566_498_1064 188
339 3300050493 nmdc:mga0k408_11129_c1 nmdc:mga0k408_11129_c1_721_1287 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

39

221

0.98

PF00117

GATase

Glutamine amidotransferase class-I

94

191

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ofw-assembly2.cif.gz_F crystal structure of arabidopsis thaliana dj-1d 0.9797 3 187
3uk7-assembly1.cif.gz_C crystal structure of arabidopsis thaliana dj-1d 0.977 3 187
4ogg-assembly1.cif.gz_A crystal structure of arabidopsis thaliana dj-1d with glyoxylate as substrate analog 0.9728 3 187
4ofw-assembly2.cif.gz_F crystal structure of arabidopsis thaliana dj-1d 0.9593 3 187
3uk7-assembly1.cif.gz_C crystal structure of arabidopsis thaliana dj-1d 0.9566 3 187
ID Description Score Start End Superfamily
af_K7LRD9_234_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9857 131 187 3.40.50.720
af_Q869N4_1_194_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9777 2 187 3.40.50.880
af_K7LRD9_139_233_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9751 3 104 3.40.50.880
4oggA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9691 4 187 3.40.50.880
af_Q869N4_1_194_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9624 2 187 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7U3R3L3-F1-model_v4 deleted 1.005 102 188
AF-A0A645I3M4-F1-model_v4 DJ-1/PfpI domain-containing protein 1.005 114 187
AF-A0A1C7Z0C6-F1-model_v4 Glutamine amidotransferase 1.004 102 187 GO:0016740
AF-A0A352IP49-F1-model_v4 Protease 1.004 96 181 GO:0006508
GO:0008233
AF-A0A2S8K2R1-F1-model_v4 deleted 1.003 89 181

Feature Viewer

pLDDT pTM Quality
95.48 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map