F413953

General Info

Members Datasets Scaffolds Average Seq Length
339 219 678 175

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10857665|Ga0207661_108576652
Length 195
Sequence MSDAISDTTGSDDSKTPLLADARLDALRARVRDIENFPKPGILFRDLTPLMGHGPSMRTCIDLLGERVARHNPDVIVAVESRGFIFGAPVAAALGVGFAPVRKPGKLPWRTNRQTYDLEYGTDSLEMHADAVKPGGRVVIVDDLLATGGTAKATADLVREQEGKIVAFVFVVELAALSGRGRLEEVAPVDALMRL

Samples

Sample ID Description Type Environment
1 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
114 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
115 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
116 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
117 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
120 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
121 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
122 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
123 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
126 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
136 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
137 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
138 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
139 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
140 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
141 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
142 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
143 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
151 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
163 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.54
Rhizosphere 94.1
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207661_10857665 3300025944 Bacteria 836
2 Ga0065707_10010534 3300005295 Bacteria 2048
3 Ga0065707_10293533 3300005295 Bacteria 1018
4 Ga0070658_10009890 3300005327 Bacteria 7664
5 Ga0070658_10799698 3300005327 Bacteria 819
6 Ga0070676_10035076 3300005328 Bacteria 2883
7 Ga0070683_100972146 3300005329 Bacteria 815
8 Ga0070690_100270010 3300005330 Bacteria 1209
9 Ga0070670_100000294 3300005331 Bacteria 43861
10 Ga0070670_100043190 3300005331 Bacteria 3875
11 Ga0070670_100248633 3300005331 Bacteria 1549
12 Ga0068869_100019402 3300005334 Bacteria 4646
13 Ga0068869_100695380 3300005334 Bacteria 867
14 Ga0070680_100021382 3300005336 Bacteria 5142
15 Ga0070680_100175868 3300005336 Bacteria 1802
16 Ga0068868_100005248 3300005338 Bacteria 9094
17 Ga0068868_100045380 3300005338 Bacteria 3438
18 Ga0070689_100000003 3300005340 Bacteria 579260
19 Ga0070691_10080949 3300005341 Bacteria 1590
20 Ga0070687_100130258 3300005343 Bacteria 1451
21 Ga0070692_10167497 3300005345 Bacteria 1264
22 Ga0070668_100038657 3300005347 Bacteria 3648
23 Ga0070669_100161462 3300005353 Bacteria 1741
24 Ga0070669_100205252 3300005353 Bacteria 1552
25 Ga0070675_100047520 3300005354 Bacteria 3517
26 Ga0070674_100490341 3300005356 Bacteria 1021
27 Ga0070688_100045787 3300005365 Bacteria 2705
28 Ga0070688_100249199 3300005365 Bacteria 1264
29 Ga0070659_100121621 3300005366 Bacteria 2115
30 Ga0070667_100861024 3300005367 Bacteria 843
31 Ga0070703_10007929 3300005406 Bacteria 2987
32 Ga0070713_100516033 3300005436 Bacteria 1129
33 Ga0070713_100941118 3300005436 Bacteria 832
34 Ga0070710_10362940 3300005437 Bacteria 962
35 Ga0070711_100142779 3300005439 Bacteria 1797
36 Ga0070705_100529579 3300005440 Bacteria 899
37 Ga0070705_100633718 3300005440 Bacteria 831
38 Ga0070700_100016323 3300005441 Bacteria 4229
39 Ga0070700_100135761 3300005441 Bacteria 1665
40 Ga0070708_100133416 3300005445 Bacteria 2299
41 Ga0070681_10132363 3300005458 Bacteria 2426
42 Ga0070681_10137876 3300005458 Bacteria 2369
43 Ga0070685_10022657 3300005466 Bacteria 3428
44 Ga0070685_10078252 3300005466 Bacteria 1976
45 Ga0070685_10426845 3300005466 Bacteria 923
46 Ga0070707_100383932 3300005468 Bacteria 1364
47 Ga0070699_100357311 3300005518 Bacteria 1317
48 Ga0070679_100012048 3300005530 Bacteria 8254
49 Ga0070679_101072887 3300005530 Bacteria 750
50 Ga0070684_100192208 3300005535 Bacteria 1858
51 Ga0070697_100075377 3300005536 Bacteria 2773
52 Ga0068853_100314415 3300005539 Bacteria 1451
53 Ga0068853_101092757 3300005539 Bacteria 769
54 Ga0070672_100180639 3300005543 Bacteria 1758
55 Ga0070686_100096595 3300005544 Bacteria 1987
56 Ga0068857_100041956 3300005577 Bacteria 4057
57 Ga0068854_100397895 3300005578 Bacteria 1139
58 Ga0068852_100463153 3300005616 Bacteria 1257
59 Ga0068859_100016689 3300005617 Bacteria 7372
60 Ga0068859_100155579 3300005617 Bacteria 2363
61 Ga0068864_100629048 3300005618 Bacteria 1044
62 Ga0068866_10116650 3300005718 Bacteria 1498
63 Ga0068861_100084685 3300005719 Bacteria 2489
64 Ga0068861_101694325 3300005719 Bacteria 625
65 Ga0068870_10605542 3300005840 Bacteria 745
66 Ga0068858_100110041 3300005842 Bacteria 2572
67 Ga0068862_100108897 3300005844 Bacteria 2430
68 Ga0081455_10365303 3300005937 Bacteria 1013
69 Ga0070717_10251644 3300006028 Bacteria 1561
70 Ga0097621_100053944 3300006237 Bacteria 3277
71 Ga0097621_100205277 3300006237 Bacteria 1712
72 Ga0075428_100000893 3300006844 Bacteria 31443
73 Ga0075429_100161100 3300006880 Bacteria 1965
74 Ga0075436_100318080 3300006914 Bacteria 1118
75 Ga0097620_100016689 3300006931 Bacteria 7372
76 Ga0097620_100023346 3300006931 Bacteria 6208
77 Ga0097620_100155560 3300006931 Bacteria 2363
78 Ga0105240_10021687 3300009093 Bacteria 8540
79 Ga0111539_10114871 3300009094 Bacteria 3157
80 Ga0111539_10868136 3300009094 Bacteria 1050
81 Ga0105245_10000033 3300009098 Bacteria 148617
82 Ga0105245_10002631 3300009098 Bacteria 16154
83 Ga0105245_10372758 3300009098 Bacteria 1419
84 Ga0105245_11075316 3300009098 Bacteria 850
85 Ga0105245_12031376 3300009098 Bacteria 628
86 Ga0105243_10206702 3300009148 Bacteria 1726
87 Ga0105237_10000006 3300009545 Bacteria 380316
88 Ga0105238_10000005 3300009551 Bacteria 372840
89 Ga0105238_10012064 3300009551 Bacteria 8706
90 Ga0105249_10120674 3300009553 Bacteria 2491
91 Ga0105239_10412540 3300010375 Bacteria 1529
92 Ga0105246_10089502 3300011119 Bacteria 2215
93 Ga0105246_10740378 3300011119 Bacteria 866
94 Ga0157369_10000036 3300013105 Bacteria 190875
95 Ga0157374_10000006 3300013296 Bacteria 640284
96 Ga0157374_10058272 3300013296 Bacteria 3609
97 Ga0157378_10000374 3300013297 Bacteria 44264
98 Ga0157378_10004276 3300013297 Bacteria 12580
99 Ga0163162_10947749 3300013306 Bacteria 972
100 Ga0157372_11838334 3300013307 Bacteria 696
101 Ga0157375_10000064 3300013308 Bacteria 112951
102 Ga0157375_10019032 3300013308 Bacteria 6234
103 Ga0157375_10239651 3300013308 Bacteria 1973
104 Ga0157375_10912292 3300013308 Bacteria 1022
105 Ga0157380_10044316 3300014326 Bacteria 3486
106 Ga0157377_10000003 3300014745 Bacteria 435133
107 Ga0157377_10000114 3300014745 Bacteria 55008
108 Ga0157379_10065484 3300014968 Bacteria 3248
109 Ga0157376_10000009 3300014969 Bacteria 340244
110 Ga0157376_10431718 3300014969 Bacteria 1281
111 Ga0157376_12255359 3300014969 Bacteria 583
112 Ga0213874_10018869 3300021377 Bacteria 1870
113 Ga0213876_10000028 3300021384 Bacteria 222108
114 Ga0207642_10028715 3300025899 Bacteria 2294
115 Ga0207645_10008708 3300025907 Bacteria 7064
116 Ga0207705_10004440 3300025909 Bacteria 10602
117 Ga0207705_10230384 3300025909 Bacteria 1409
118 Ga0207707_10039096 3300025912 Bacteria 4147
119 Ga0207695_10018273 3300025913 Bacteria 8113
120 Ga0207671_10000321 3300025914 Bacteria 70531
121 Ga0207660_10033753 3300025917 Bacteria 3542
122 Ga0207660_10101141 3300025917 Bacteria 2153
123 Ga0207660_10740050 3300025917 Bacteria 802
124 Ga0207662_10081458 3300025918 Bacteria 1976
125 Ga0207652_10002886 3300025921 Bacteria 14366
126 Ga0207652_10036634 3300025921 Bacteria 4147
127 Ga0207681_10142521 3300025923 Bacteria 1786
128 Ga0207681_10216412 3300025923 Bacteria 1479
129 Ga0207694_10000001 3300025924 Bacteria 4078485
130 Ga0207694_10010813 3300025924 Bacteria 6891
131 Ga0207650_10000091 3300025925 Bacteria 117116
132 Ga0207650_10115746 3300025925 Bacteria 2081
133 Ga0207659_10074349 3300025926 Bacteria 2490
134 Ga0207687_10000006 3300025927 Bacteria 641680
135 Ga0207687_10007402 3300025927 Bacteria 7227
136 Ga0207687_10126824 3300025927 Bacteria 1917
137 Ga0207700_10414776 3300025928 Bacteria 1182
138 Ga0207700_10842535 3300025928 Bacteria 820
139 Ga0207706_10070380 3300025933 Bacteria 3077
140 Ga0207709_10482577 3300025935 Bacteria 964
141 Ga0207670_10000006 3300025936 Bacteria 401723
142 Ga0207669_10140373 3300025937 Bacteria 1676
143 Ga0207665_10562449 3300025939 Bacteria 887
144 Ga0207691_10003458 3300025940 Bacteria 15365
145 Ga0207689_10011161 3300025942 Bacteria 7709
146 Ga0207689_10756876 3300025942 Bacteria 820
147 Ga0207661_10000006 3300025944 Bacteria 537727
148 Ga0207668_10230421 3300025972 Bacteria 1493
149 Ga0207640_10002698 3300025981 Bacteria 9504
150 Ga0207640_10068627 3300025981 Bacteria 2377
151 Ga0207640_10163678 3300025981 Bacteria 1649
152 Ga0207640_10249523 3300025981 Bacteria 1376
153 Ga0207658_10052188 3300025986 Bacteria 3017
154 Ga0207677_10000211 3300026023 Bacteria 46566
155 Ga0207703_10659192 3300026035 Bacteria 993
156 Ga0207639_10894047 3300026041 Bacteria 830
157 Ga0207639_11285488 3300026041 Bacteria 687
158 Ga0207708_10007971 3300026075 Bacteria 7848
159 Ga0207708_10023518 3300026075 Bacteria 4659
160 Ga0207648_10141594 3300026089 Bacteria 2119
161 Ga0207648_10323921 3300026089 Bacteria 1385
162 Ga0207676_10776356 3300026095 Bacteria 933
163 Ga0207676_11161039 3300026095 Bacteria 765
164 Ga0207674_10052304 3300026116 Bacteria 4166
165 Ga0207675_100025458 3300026118 Bacteria 5508
166 Ga0207675_100036949 3300026118 Bacteria 4556
167 Ga0207675_100138641 3300026118 Bacteria 2309
168 Ga0207675_101476923 3300026118 Bacteria 700
169 Ga0207428_10000862 3300027907 Bacteria 34168
170 Ga0268265_10076027 3300028380 Bacteria 2633
171 Ga0268265_10220947 3300028380 Bacteria 1658
172 Ga0268264_10159950 3300028381 Bacteria 2028
173 Ga0265337_1006082 3300028556 Bacteria 4700
174 Ga0265326_10021232 3300028558 Bacteria 1862
175 Ga0265326_10072256 3300028558 Bacteria 975
176 Ga0265319_1000599 3300028563 Bacteria 24076
177 Ga0265319_1007224 3300028563 Bacteria 5024
178 Ga0265334_10197590 3300028573 Bacteria 699
179 Ga0265318_10000452 3300028577 Bacteria 30845
180 Ga0265318_10106365 3300028577 Unclassified 1032
181 Ga0265318_10165769 3300028577 Bacteria 810
182 Ga0265338_10005258 3300028800 Bacteria 16959
183 Ga0265338_10016867 3300028800 Bacteria 7907
184 Ga0265330_10011156 3300031235 Bacteria 4217
185 Ga0265330_10016440 3300031235 Bacteria 3413
186 Ga0265332_10000313 3300031238 Bacteria 37191
187 Ga0265332_10143291 3300031238 Bacteria 1001
188 Ga0265328_10000338 3300031239 Bacteria 21980
189 Ga0265328_10002345 3300031239 Bacteria 8536
190 Ga0265320_10012305 3300031240 Bacteria 4990
191 Ga0265320_10023571 3300031240 Bacteria 3273
192 Ga0265329_10000494 3300031242 Bacteria 20456
193 Ga0265329_10141020 3300031242 Bacteria 778
194 Ga0265340_10177692 3300031247 Bacteria 963
195 Ga0265339_10006033 3300031249 Bacteria 8006
196 Ga0265339_10045349 3300031249 Bacteria 2420
197 Ga0265339_10090351 3300031249 Bacteria 1606
198 Ga0265339_10107496 3300031249 Bacteria 1446
199 Ga0265331_10006159 3300031250 Bacteria 7130
200 Ga0265316_10016233 3300031344 Bacteria 6465
201 Ga0265316_10182050 3300031344 Bacteria 1564
202 Ga0265316_10292997 3300031344 Bacteria 1187
203 Ga0307513_10102226 3300031456 Bacteria 2886
204 Ga0307509_10537862 3300031507 Bacteria 848
205 Ga0265313_10015325 3300031595 Bacteria 4472
206 Ga0265313_10021006 3300031595 Bacteria 3582
207 Ga0265313_10137685 3300031595 Bacteria 1052
208 Ga0265314_10016263 3300031711 Bacteria 5885
209 Ga0265314_10040008 3300031711 Bacteria 3370
210 Ga0265342_10000884 3300031712 Bacteria 29870
211 Ga0265342_10007219 3300031712 Bacteria 8167
212 Ga0265342_10059750 3300031712 Bacteria 2251
213 Ga0316576_10116164 3300031727 Bacteria 2008
214 Ga0307409_100452950 3300031995 Bacteria 1239
215 Ga0373948_0008356 3300034817 Bacteria 1761
216 Ga0373950_0050298 3300034818 Bacteria 817
217 Ga0373959_0016643 3300034820 Bacteria 1365
218 Ga0373938_0000388 3300034957 Bacteria 7068
219 Ga0373928_0024908 3300035084 Bacteria 1286
220 Ga0373929_0006751 3300035085 Bacteria 2080
221 Ga0373929_0097619 3300035085 Bacteria 737
222 Ga0373940_0021095 3300035088 Bacteria 1661
223 Ga0373949_0056131 3300035090 Bacteria 1003
224 Ga0373951_0003586 3300035091 Bacteria 3744
225 Ga0373932_0001599 3300035112 Bacteria 6236
226 Ga0373932_0037425 3300035112 Bacteria 1382
227 Ga0373939_0001091 3300035114 Bacteria 6670
228 Ga0373954_0334053 3300035118 Bacteria 748
229 Ga0373957_0092619 3300035120 Bacteria 1203
230 Ga0373957_0103320 3300035120 Bacteria 1142
231 Ga0373960_0027972 3300035121 Bacteria 1552
232 Ga0373960_0243581 3300035121 Bacteria 651
233 Ga0373943_0114202 3300035170 Bacteria 1428
234 Ga0373942_0003815 3300035207 Bacteria 3524
235 Ga0373942_0226255 3300035207 Bacteria 628
236 Ga0373942_0238204 3300035207 Bacteria 615
237 Ga0373961_0001070 3300035241 Bacteria 8781
238 Ga0373931_0008213 3300035691 Bacteria 4945
239 Ga0373931_0067851 3300035691 Bacteria 1939
240 Ga0373931_0150230 3300035691 Bacteria 1357
241 Ga0373935_0861088 3300035692 Bacteria 670
242 Ga0373933_0002109 3300035724 Bacteria 11418
243 Ga0373933_0426369 3300035724 Bacteria 866
244 Ga0373947_0384468 3300035725 Bacteria 945
245 Ga0373937_0022031 3300036401 Bacteria 5722
246 Ga0373937_0035056 3300036401 Bacteria 4565
247 Ga0373937_0115526 3300036401 Bacteria 2499
248 Ga0373937_0818759 3300036401 Bacteria 879
249 Ga0373925_0491942 3300037068 Bacteria 1007
250 Ga0436365_0510114 3300039437 Bacteria 55431
251 Ga0436361_0533732 3300039447 Bacteria 947
252 Ga0436363_0015999 3300039450 Bacteria 742
253 Ga0436362_0430309 3300039453 Bacteria 4292
254 Ga0451839_0067642 3300041496 Bacteria 1141
255 Ga0439435_0207441 3300042436 Unclassified 648
256 Ga0451577_0316358 3300042876 Bacteria 1415
257 Ga0451577_0838153 3300042876 Bacteria 830
258 Ga0453684_0151410 3300044712 Bacteria 2756
259 Ga0453684_0197304 3300044712 Bacteria 2349
260 Ga0453684_0585609 3300044712 Bacteria 1225
261 Ga0451576_0038500 3300045051 Bacteria 5060
262 Ga0451576_0854273 3300045051 Bacteria 955
263 Ga0495629_0008397 3300046459 Bacteria 7598
264 Ga0495582_0010272 3300046473 Bacteria 5151
265 Ga0495639_0074734 3300046475 Bacteria 1570
266 Ga0495594_0221267 3300046499 Bacteria 1079
267 Ga0495618_0388431 3300046514 Bacteria 855
268 Ga0495628_0204519 3300046516 Bacteria 1487
269 Ga0495628_0442162 3300046516 Bacteria 945
270 Ga0495586_0232109 3300046535 Bacteria 1050
271 Ga0495621_0096807 3300046539 Bacteria 1119
272 Ga0495622_0182677 3300046557 Bacteria 940
273 Ga0495622_0202685 3300046557 Bacteria 884
274 Ga0495667_0037762 3300046559 Bacteria 3218
275 Ga0495634_0177467 3300046642 Bacteria 1336
276 Ga0495634_0332250 3300046642 Bacteria 913
277 Ga0495635_0100412 3300046663 Bacteria 1978
278 Ga0495647_0011277 3300046681 Bacteria 3060
279 Ga0495658_0000040 3300046683 Bacteria 65429
280 Ga0495613_0021600 3300046689 Bacteria 4795
281 Ga0495649_0421102 3300046694 Bacteria 669
282 Ga0495581_0007759 3300047315 Bacteria 6211
283 Ga0495680_0087954 3300047322 Bacteria 2336
284 Ga0495680_0268822 3300047322 Bacteria 1204
285 Ga0495680_0696531 3300047322 Bacteria 671
286 Ga0495679_030679 3300047446 Bacteria 1742
287 Ga0496100_0016052 3300048903 Bacteria 4388
288 Ga0496101_0099568 3300048904 Bacteria 2173
289 Ga0496104_0233519 3300048907 Bacteria 1751
290 Ga0496105_0106992 3300048908 Bacteria 2309
291 Ga0496106_0054888 3300048909 Bacteria 3011
292 Ga0496106_0415421 3300048909 Bacteria 1081
293 Ga0496108_0292465 3300048911 Bacteria 1418
294 Ga0496112_0276844 3300048915 Bacteria 1626
295 Ga0496114_0000572 3300048917 Bacteria 27230
296 Ga0496114_0157111 3300048917 Bacteria 1975
297 Ga0496115_0005371 3300048918 Bacteria 9325
298 Ga0496115_0168336 3300048918 Bacteria 1812
299 Ga0496126_0394434 3300048929 Bacteria 1124
300 Ga0501032_0693742 3300049569 Bacteria 645
301 Ga0501034_0000063 3300049571 Bacteria 190847
302 Ga0501036_0038263 3300049572 Bacteria 4060
303 Ga0501043_0000813 3300049579 Bacteria 27753
304 Ga0501046_0000661 3300049580 Bacteria 33427
305 Ga0501047_0000060 3300049581 Bacteria 137972
306 Ga0501048_0004299 3300049582 Bacteria 10860
307 Ga0501068_0025470 3300049584 Bacteria 3479
308 Ga0501068_0177263 3300049584 Bacteria 1347
309 Ga0501069_0029542 3300049585 Bacteria 3008
310 Ga0501070_0000064 3300049586 Bacteria 89114
311 Ga0501070_0000845 3300049586 Bacteria 27799
312 Ga0501070_0266008 3300049586 Bacteria 1401
313 Ga0501072_0002367 3300049588 Bacteria 14143
314 Ga0501072_0625826 3300049588 Bacteria 848
315 Ga0501073_0000698 3300049589 Bacteria 23640
316 Ga0501073_0002189 3300049589 Bacteria 14614
317 Ga0501073_0002294 3300049589 Bacteria 14307
318 Ga0501074_0002786 3300049590 Bacteria 12230
319 Ga0501074_0106508 3300049590 Bacteria 2007
320 Ga0501074_0135949 3300049590 Bacteria 1758
321 Ga0501079_0000046 3300049741 Bacteria 52282
322 Ga0501079_0318097 3300049741 Bacteria 1218
323 Ga0501080_0022976 3300049742 Bacteria 5782
324 Ga0501080_0046307 3300049742 Bacteria 4049
325 Ga0501080_0204553 3300049742 Bacteria 1811
326 Ga0501080_0957625 3300049742 Bacteria 744
327 Ga0501083_0001517 3300049744 Bacteria 15868
328 Ga0501083_0031536 3300049744 Bacteria 3638
329 Ga0501083_0047368 3300049744 Bacteria 2904
330 Ga0501044_0387835 3300049823 Bacteria 1311
331 Ga0501045_0941334 3300049824 Bacteria 634
332 nmdc:mga08y16_226788_c1 3300050511 Bacteria 1933
333 nmdc:mga08y16_367618_c1 3300050511 Bacteria 1476
334 nmdc:mga08x19_609350_c1 3300050514 Bacteria 774
335 Ga0495619_0026079 3300053085 Bacteria 3758
336 Ga0501084_0000030 3300054114 Bacteria 119336
337 Ga0501082_0000843 3300060353 Bacteria 27036
338 Ga0501082_0003780 3300060353 Bacteria 13231
339 Ga0530510_0011705 3300061734 Bacteria 6157
340 Ga0207661_10857665
341 Ga0065707_10010534
342 Ga0065707_10293533
343 Ga0070658_10009890
344 Ga0070658_10799698
345 Ga0070676_10035076
346 Ga0070683_100972146
347 Ga0070690_100270010
348 Ga0070670_100000294
349 Ga0070670_100043190
350 Ga0070670_100248633
351 Ga0068869_100019402
352 Ga0068869_100695380
353 Ga0070680_100021382
354 Ga0070680_100175868
355 Ga0068868_100005248
356 Ga0068868_100045380
357 Ga0070689_100000003
358 Ga0070691_10080949
359 Ga0070687_100130258
360 Ga0070692_10167497
361 Ga0070668_100038657
362 Ga0070669_100161462
363 Ga0070669_100205252
364 Ga0070675_100047520
365 Ga0070674_100490341
366 Ga0070688_100045787
367 Ga0070688_100249199
368 Ga0070659_100121621
369 Ga0070667_100861024
370 Ga0070703_10007929
371 Ga0070713_100516033
372 Ga0070713_100941118
373 Ga0070710_10362940
374 Ga0070711_100142779
375 Ga0070705_100529579
376 Ga0070705_100633718
377 Ga0070700_100016323
378 Ga0070700_100135761
379 Ga0070708_100133416
380 Ga0070681_10132363
381 Ga0070681_10137876
382 Ga0070685_10022657
383 Ga0070685_10078252
384 Ga0070685_10426845
385 Ga0070707_100383932
386 Ga0070699_100357311
387 Ga0070679_100012048
388 Ga0070679_101072887
389 Ga0070684_100192208
390 Ga0070697_100075377
391 Ga0068853_100314415
392 Ga0068853_101092757
393 Ga0070672_100180639
394 Ga0070686_100096595
395 Ga0068857_100041956
396 Ga0068854_100397895
397 Ga0068852_100463153
398 Ga0068859_100016689
399 Ga0068859_100155579
400 Ga0068864_100629048
401 Ga0068866_10116650
402 Ga0068861_100084685
403 Ga0068861_101694325
404 Ga0068870_10605542
405 Ga0068858_100110041
406 Ga0068862_100108897
407 Ga0081455_10365303
408 Ga0070717_10251644
409 Ga0097621_100053944
410 Ga0097621_100205277
411 Ga0075428_100000893
412 Ga0075429_100161100
413 Ga0075436_100318080
414 Ga0097620_100016689
415 Ga0097620_100023346
416 Ga0097620_100155560
417 Ga0105240_10021687
418 Ga0111539_10114871
419 Ga0111539_10868136
420 Ga0105245_10000033
421 Ga0105245_10002631
422 Ga0105245_10372758
423 Ga0105245_11075316
424 Ga0105245_12031376
425 Ga0105243_10206702
426 Ga0105237_10000006
427 Ga0105238_10000005
428 Ga0105238_10012064
429 Ga0105249_10120674
430 Ga0105239_10412540
431 Ga0105246_10089502
432 Ga0105246_10740378
433 Ga0157369_10000036
434 Ga0157374_10000006
435 Ga0157374_10058272
436 Ga0157378_10000374
437 Ga0157378_10004276
438 Ga0163162_10947749
439 Ga0157372_11838334
440 Ga0157375_10000064
441 Ga0157375_10019032
442 Ga0157375_10239651
443 Ga0157375_10912292
444 Ga0157380_10044316
445 Ga0157377_10000003
446 Ga0157377_10000114
447 Ga0157379_10065484
448 Ga0157376_10000009
449 Ga0157376_10431718
450 Ga0157376_12255359
451 Ga0213874_10018869
452 Ga0213876_10000028
453 Ga0207642_10028715
454 Ga0207645_10008708
455 Ga0207705_10004440
456 Ga0207705_10230384
457 Ga0207707_10039096
458 Ga0207695_10018273
459 Ga0207671_10000321
460 Ga0207660_10033753
461 Ga0207660_10101141
462 Ga0207660_10740050
463 Ga0207662_10081458
464 Ga0207652_10002886
465 Ga0207652_10036634
466 Ga0207681_10142521
467 Ga0207681_10216412
468 Ga0207694_10000001
469 Ga0207694_10010813
470 Ga0207650_10000091
471 Ga0207650_10115746
472 Ga0207659_10074349
473 Ga0207687_10000006
474 Ga0207687_10007402
475 Ga0207687_10126824
476 Ga0207700_10414776
477 Ga0207700_10842535
478 Ga0207706_10070380
479 Ga0207709_10482577
480 Ga0207670_10000006
481 Ga0207669_10140373
482 Ga0207665_10562449
483 Ga0207691_10003458
484 Ga0207689_10011161
485 Ga0207689_10756876
486 Ga0207661_10000006
487 Ga0207668_10230421
488 Ga0207640_10002698
489 Ga0207640_10068627
490 Ga0207640_10163678
491 Ga0207640_10249523
492 Ga0207658_10052188
493 Ga0207677_10000211
494 Ga0207703_10659192
495 Ga0207639_10894047
496 Ga0207639_11285488
497 Ga0207708_10007971
498 Ga0207708_10023518
499 Ga0207648_10141594
500 Ga0207648_10323921
501 Ga0207676_10776356
502 Ga0207676_11161039
503 Ga0207674_10052304
504 Ga0207675_100025458
505 Ga0207675_100036949
506 Ga0207675_100138641
507 Ga0207675_101476923
508 Ga0207428_10000862
509 Ga0268265_10076027
510 Ga0268265_10220947
511 Ga0268264_10159950
512 Ga0265337_1006082
513 Ga0265326_10021232
514 Ga0265326_10072256
515 Ga0265319_1000599
516 Ga0265319_1007224
517 Ga0265334_10197590
518 Ga0265318_10000452
519 Ga0265318_10106365
520 Ga0265318_10165769
521 Ga0265338_10005258
522 Ga0265338_10016867
523 Ga0265330_10011156
524 Ga0265330_10016440
525 Ga0265332_10000313
526 Ga0265332_10143291
527 Ga0265328_10000338
528 Ga0265328_10002345
529 Ga0265320_10012305
530 Ga0265320_10023571
531 Ga0265329_10000494
532 Ga0265329_10141020
533 Ga0265340_10177692
534 Ga0265339_10006033
535 Ga0265339_10045349
536 Ga0265339_10090351
537 Ga0265339_10107496
538 Ga0265331_10006159
539 Ga0265316_10016233
540 Ga0265316_10182050
541 Ga0265316_10292997
542 Ga0307513_10102226
543 Ga0307509_10537862
544 Ga0265313_10015325
545 Ga0265313_10021006
546 Ga0265313_10137685
547 Ga0265314_10016263
548 Ga0265314_10040008
549 Ga0265342_10000884
550 Ga0265342_10007219
551 Ga0265342_10059750
552 Ga0316576_10116164
553 Ga0307409_100452950
554 Ga0373948_0008356
555 Ga0373950_0050298
556 Ga0373959_0016643
557 Ga0373938_0000388
558 Ga0373928_0024908
559 Ga0373929_0006751
560 Ga0373929_0097619
561 Ga0373940_0021095
562 Ga0373949_0056131
563 Ga0373951_0003586
564 Ga0373932_0001599
565 Ga0373932_0037425
566 Ga0373939_0001091
567 Ga0373954_0334053
568 Ga0373957_0092619
569 Ga0373957_0103320
570 Ga0373960_0027972
571 Ga0373960_0243581
572 Ga0373943_0114202
573 Ga0373942_0003815
574 Ga0373942_0226255
575 Ga0373942_0238204
576 Ga0373961_0001070
577 Ga0373931_0008213
578 Ga0373931_0067851
579 Ga0373931_0150230
580 Ga0373935_0861088
581 Ga0373933_0002109
582 Ga0373933_0426369
583 Ga0373947_0384468
584 Ga0373937_0022031
585 Ga0373937_0035056
586 Ga0373937_0115526
587 Ga0373937_0818759
588 Ga0373925_0491942
589 Ga0436365_0510114
590 Ga0436361_0533732
591 Ga0436363_0015999
592 Ga0436362_0430309
593 Ga0451839_0067642
594 Ga0439435_0207441
595 Ga0451577_0316358
596 Ga0451577_0838153
597 Ga0453684_0151410
598 Ga0453684_0197304
599 Ga0453684_0585609
600 Ga0451576_0038500
601 Ga0451576_0854273
602 Ga0495629_0008397
603 Ga0495582_0010272
604 Ga0495639_0074734
605 Ga0495594_0221267
606 Ga0495618_0388431
607 Ga0495628_0204519
608 Ga0495628_0442162
609 Ga0495586_0232109
610 Ga0495621_0096807
611 Ga0495622_0182677
612 Ga0495622_0202685
613 Ga0495667_0037762
614 Ga0495634_0177467
615 Ga0495634_0332250
616 Ga0495635_0100412
617 Ga0495647_0011277
618 Ga0495658_0000040
619 Ga0495613_0021600
620 Ga0495649_0421102
621 Ga0495581_0007759
622 Ga0495680_0087954
623 Ga0495680_0268822
624 Ga0495680_0696531
625 Ga0495679_030679
626 Ga0496100_0016052
627 Ga0496101_0099568
628 Ga0496104_0233519
629 Ga0496105_0106992
630 Ga0496106_0054888
631 Ga0496106_0415421
632 Ga0496108_0292465
633 Ga0496112_0276844
634 Ga0496114_0000572
635 Ga0496114_0157111
636 Ga0496115_0005371
637 Ga0496115_0168336
638 Ga0496126_0394434
639 Ga0501032_0693742
640 Ga0501034_0000063
641 Ga0501036_0038263
642 Ga0501043_0000813
643 Ga0501046_0000661
644 Ga0501047_0000060
645 Ga0501048_0004299
646 Ga0501068_0025470
647 Ga0501068_0177263
648 Ga0501069_0029542
649 Ga0501070_0000064
650 Ga0501070_0000845
651 Ga0501070_0266008
652 Ga0501072_0002367
653 Ga0501072_0625826
654 Ga0501073_0000698
655 Ga0501073_0002189
656 Ga0501073_0002294
657 Ga0501074_0002786
658 Ga0501074_0106508
659 Ga0501074_0135949
660 Ga0501079_0000046
661 Ga0501079_0318097
662 Ga0501080_0022976
663 Ga0501080_0046307
664 Ga0501080_0204553
665 Ga0501080_0957625
666 Ga0501083_0001517
667 Ga0501083_0031536
668 Ga0501083_0047368
669 Ga0501044_0387835
670 Ga0501045_0941334
671 nmdc:mga08y16_226788_c1
672 nmdc:mga08y16_367618_c1
673 nmdc:mga08x19_609350_c1
674 Ga0495619_0026079
675 Ga0501084_0000030
676 Ga0501082_0000843
677 Ga0501082_0003780
678 Ga0530510_0011705

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

50

190

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9792 2 173
4lza-assembly1.cif.gz_A crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9764 2 173
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9737 2 173
4lza-assembly1.cif.gz_A crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9707 2 173
6fd6-assembly1.cif.gz_B crystal structure of human aprt-tyr105phe variant in complex with adenine, prpp and mg2+, 30 days post crystallization (with amp and ppi products fully generated) 0.9681 3 174
ID Description Score Start End Superfamily
af_P69503_1_183_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9776 3 173 3.40.50.2020
af_A0A0P0WCD3_31_176_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9705 3 137 3.40.50.2020
af_P91455_5_184_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.964 3 173 3.40.50.2020
af_P12426_6_182_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9634 3 173 3.40.50.2020
af_P69503_1_183_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9556 3 173 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A3D0D0R3-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.992 4 173 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A0M9UDG2-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.9897 3 173 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A3S4JTL9-F1-model_v4 Adenine phosphoribosyltransferase (EC 2.4.2.7) 0.989 3 79 GO:0003999
GO:0005829
GO:0006166
AF-A0A522NML7-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.9876 1 173 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-X1RES4-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9876 6 104 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209

Map