F413753

General Info

Members Datasets Scaffolds Average Seq Length
338 200 676 265

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8005282627|8005289000
Length 289
Sequence LNAATSAEKAQVVEALRPFHPLDGLLALSGLARSTFYYQQKALSRPDRHGVLKERIKSIFDTHKGRYGYRRVTAALRGLGETVNHKTVQRLMVESGLKSKVRPKKYRSYRGEEGRVAPDLLKRQFTAERANQKWVTDVTEFNVAGEKLYLSPIMDLFNGEIIAFETARRPVFKLVENMLTKAVSRLQDDDRPILHSDQGWHYQMPAWQRMLQKRHINQSMSRKGNCLDNAAIESFFAILKSEFFHPNDFDSVKSLQDGVADYINYYNHQRIKLKLKGLSPVQYRTQPLN

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
10 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
11 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
12 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
13 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
14 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
15 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
16 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
17 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
18 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
19 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
20 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
21 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
24 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
30 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
31 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
32 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
33 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
34 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
35 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
36 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
37 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
38 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
39 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
40 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
41 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
42 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
43 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
44 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
45 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
46 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
47 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
48 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
49 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
50 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
51 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
52 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
53 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
54 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
55 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
56 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
57 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
58 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
59 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
60 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
61 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
62 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
63 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
64 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
65 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
66 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
67 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
68 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
69 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
70 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
71 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
72 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
73 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
74 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
75 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
76 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
77 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
78 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
79 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
80 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
81 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
82 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
83 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
84 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
85 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
86 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
87 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
88 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
89 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
90 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
91 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
95 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
96 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
97 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
98 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
99 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
100 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
104 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
105 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
109 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
110 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
117 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
124 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
125 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
126 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
127 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
128 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
129 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
130 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
131 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
132 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
133 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
134 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
135 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
136 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
137 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
138 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
139 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
140 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
141 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
142 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
143 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
144 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
145 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
146 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
147 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
148 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
149 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
150 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
151 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
152 2519899620 Rhizobium sp. Pop5 Isolate Nodule
153 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
154 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
155 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
156 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
157 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
158 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
159 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
160 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
161 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
162 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
163 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
164 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
165 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
166 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
167 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
168 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
169 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
170 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
171 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
172 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
173 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
174 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
175 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
176 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
177 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
178 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
179 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
180 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
181 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
182 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
183 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
184 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
185 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
186 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
187 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
188 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
189 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
190 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
191 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
192 2933599457 Rhizobium phaseoli M3 Isolate Nodule
193 2938917290 Bacillus sp. CR71 Isolate Unclassified
194 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
195 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
196 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
197 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
198 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
199 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
200 8023444577 Bacillus sp. BH32 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 64.5
Metatranscriptomes 0.3
Isolates 35.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.95
Nodule 26.63
Rhizoplane 1.18
Rhizosphere 47.04
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10031610 3300003187 Bacteria 2064
2 rootH1_10043984 3300003316 Bacteria 1171
3 rootH1_10351537 3300003323 Bacteria 1667
4 Ga0055542_1009075 3300003762 Bacteria 1898
5 Ga0065714_10101184 3300005288 Bacteria 1649
6 Ga0070658_10215881 3300005327 Bacteria 1621
7 Ga0070670_100208927 3300005331 Bacteria 1697
8 Ga0081455_10082170 3300005937 Bacteria 2636
9 Ga0099826_10133961 3300006948 Bacteria 1441
10 Ga0105251_10016814 3300009011 Bacteria 3938
11 Ga0105244_10071407 3300009036 Bacteria 1731
12 Ga0105244_10089023 3300009036 Bacteria 1520
13 Ga0105237_10097385 3300009545 Bacteria 2932
14 Ga0105246_10077271 3300011119 Bacteria 2361
15 Ga0157371_10022170 3300013102 Bacteria 4658
16 Ga0157371_10193058 3300013102 Bacteria 1458
17 Ga0157375_10311197 3300013308 Bacteria 1739
18 Ga0182008_10001486 3300014497 Bacteria 15652
19 Ga0182006_1029354 3300015261 Bacteria 2229
20 Ga0182007_10000982 3300015262 Bacteria 15642
21 Ga0182005_1005078 3300015265 Bacteria 4153
22 Ga0213872_10043727 3300021361 Bacteria 2040
23 Ga0209148_1003850 3300025254 Bacteria 3908
24 Ga0209676_1001195 3300025292 Bacteria 27894
25 Ga0209025_1010495 3300025294 Bacteria 6269
26 Ga0209025_1057304 3300025294 Bacteria 1490
27 Ga0209025_1071215 3300025294 Bacteria 1233
28 Ga0207655_1012976 3300025728 Bacteria 4818
29 Ga0207713_1054957 3300025735 Bacteria 1557
30 Ga0207713_1075607 3300025735 Bacteria 1228
31 Ga0207671_10150316 3300025914 Bacteria 1799
32 Ga0207639_10280882 3300026041 Bacteria 1464
33 Ga0207648_10526656 3300026089 Bacteria 1083
34 Ga0209371_1021362 3300027312 Bacteria 1570
35 Ga0209282_1105624 3300027666 Bacteria 1441
36 Ga0307517_10220821 3300028786 Bacteria 1152
37 Ga0307515_10150734 3300028794 Bacteria 2432
38 Ga0237817_11188 3300030083 Bacteria 1446
39 Ga0268256_1024041 3300030500 Bacteria 1570
40 Ga0268256_1027972 3300030500 Bacteria 1397
41 Ga0307408_100139839 3300031548 Bacteria 1899
42 Ga0307408_100157363 3300031548 Bacteria 1801
43 Ga0307409_100323436 3300031995 Bacteria 1444
44 Ga0307414_10251214 3300032004 Bacteria 1470
45 Ga0373936_0023501 3300035113 Bacteria 2402
46 Ga0395898_0242263 3300037466 Bacteria 1720
47 Ga0395901_0219131 3300038443 Bacteria 1990
48 Ga0237819_08371 3300038705 Bacteria 1435
49 Ga0436361_0081922 3300039447 Bacteria 2992
50 Ga0439438_007114 3300041405 Bacteria 3860
51 Ga0439447_007536 3300041407 Bacteria 3443
52 Ga0439466_0026418 3300041411 Bacteria 2018
53 Ga0451847_0004925 3300041503 Bacteria 1875
54 Ga0451849_0649849 3300041505 Bacteria 872
55 Ga0439431_0000022 3300041997 Bacteria 24835
56 Ga0439462_0019289 3300042015 Bacteria 1774
57 Ga0495617_036972 3300046452 Bacteria 1636
58 Ga0495617_041092 3300046452 Bacteria 1546
59 Ga0495627_030609 3300046453 Bacteria 1705
60 Ga0495590_0043988 3300046457 Bacteria 1557
61 Ga0495591_028716 3300046458 Bacteria 1698
62 Ga0495638_0005417 3300046460 Bacteria 9497
63 Ga0495638_0135920 3300046460 Bacteria 1439
64 Ga0495638_0199832 3300046460 Bacteria 1129
65 Ga0495605_0000071 3300046474 Bacteria 135203
66 Ga0495605_0000257 3300046474 Bacteria 62503
67 Ga0495605_0002975 3300046474 Bacteria 10252
68 Ga0495584_0038366 3300046491 Bacteria 2421
69 Ga0495584_0053162 3300046491 Bacteria 2038
70 Ga0495585_0028755 3300046492 Bacteria 3167
71 Ga0495585_0057991 3300046492 Bacteria 2136
72 Ga0495585_0071331 3300046492 Bacteria 1893
73 Ga0495607_0042118 3300046501 Bacteria 2709
74 Ga0495607_0073240 3300046501 Bacteria 1904
75 Ga0495606_0074117 3300046507 Bacteria 2133
76 Ga0495606_0171480 3300046507 Bacteria 1258
77 Ga0495610_0011991 3300046512 Bacteria 5251
78 Ga0495616_0010342 3300046513 Bacteria 5405
79 Ga0495616_0024408 3300046513 Bacteria 3243
80 Ga0495620_0000029 3300046515 Bacteria 122326
81 Ga0495620_0045988 3300046515 Bacteria 1887
82 Ga0495620_0059384 3300046515 Bacteria 1598
83 Ga0495620_0059408 3300046515 Bacteria 1598
84 Ga0495620_0063357 3300046515 Bacteria 1533
85 Ga0495631_0063230 3300046518 Bacteria 1603
86 Ga0495631_0102649 3300046518 Bacteria 1230
87 Ga0495632_0040462 3300046519 Bacteria 2347
88 Ga0495632_0086629 3300046519 Bacteria 1489
89 Ga0495637_0017288 3300046520 Bacteria 3364
90 Ga0495643_0043306 3300046522 Bacteria 2450
91 Ga0495643_0044994 3300046522 Bacteria 2397
92 Ga0495643_0088818 3300046522 Bacteria 1597
93 Ga0495644_0005112 3300046523 Bacteria 5136
94 Ga0495648_0029206 3300046524 Bacteria 3662
95 Ga0495663_0033884 3300046525 Unclassified 1526
96 Ga0495642_0042675 3300046528 Bacteria 1848
97 Ga0495652_0262803 3300046529 Bacteria 1273
98 Ga0495654_0034286 3300046530 Bacteria 2562
99 Ga0495654_0077833 3300046530 Bacteria 1560
100 Ga0495654_0208784 3300046530 Bacteria 831
101 Ga0495609_0049713 3300046538 Bacteria 1870
102 Ga0495597_0025943 3300046542 Bacteria 2694
103 Ga0495597_0060412 3300046542 Bacteria 1653
104 Ga0495645_0107894 3300046543 Bacteria 1973
105 Ga0495622_0032207 3300046557 Bacteria 2448
106 Ga0495633_0011046 3300046558 Bacteria 4899
107 Ga0495633_0095304 3300046558 Bacteria 1382
108 Ga0495656_0029221 3300046615 Bacteria 2218
109 Ga0495656_0052260 3300046615 Bacteria 1751
110 Ga0495668_0049275 3300046616 Bacteria 2336
111 Ga0495668_0087070 3300046616 Bacteria 1713
112 Ga0495611_0036270 3300046648 Bacteria 2187
113 Ga0495611_0079460 3300046648 Bacteria 1506
114 Ga0495625_0079065 3300046660 Bacteria 2294
115 Ga0495625_0093905 3300046660 Bacteria 2070
116 Ga0495625_0105991 3300046660 Bacteria 1925
117 Ga0495625_0107796 3300046660 Bacteria 1906
118 Ga0495659_0088198 3300046664 Bacteria 1187
119 Ga0495661_0081507 3300046665 Bacteria 1864
120 Ga0495661_0091760 3300046665 Bacteria 1726
121 Ga0495661_0098432 3300046665 Bacteria 1651
122 Ga0495661_0100994 3300046665 Bacteria 1623
123 Ga0495588_0034223 3300046674 Bacteria 2570
124 Ga0495669_0006647 3300046684 Bacteria 4837
125 Ga0495669_0081884 3300046684 Bacteria 1482
126 Ga0495670_0007800 3300046691 Bacteria 5264
127 Ga0495670_0028403 3300046691 Bacteria 2773
128 Ga0495670_0042056 3300046691 Bacteria 2280
129 Ga0495670_0046622 3300046691 Bacteria 2165
130 Ga0495670_0088001 3300046691 Bacteria 1587
131 Ga0495670_0098368 3300046691 Bacteria 1504
132 Ga0495671_0073248 3300046692 Bacteria 1681
133 Ga0495649_0012570 3300046694 Bacteria 4916
134 Ga0495589_0028694 3300046794 Bacteria 2807
135 Ga0495660_0053324 3300046810 Bacteria 2195
136 Ga0495660_0069928 3300046810 Unclassified 1865
137 Ga0495636_0011352 3300047318 Bacteria 3525
138 Ga0495636_0027173 3300047318 Bacteria 2331
139 Ga0495636_0029547 3300047318 Bacteria 2237
140 Ga0495636_0042813 3300047318 Bacteria 1882
141 Ga0495672_0012710 3300047320 Bacteria 5854
142 Ga0495672_0017955 3300047320 Bacteria 4713
143 Ga0495680_0054708 3300047322 Bacteria 3098
144 Ga0495683_0066367 3300047323 Bacteria 1778
145 Ga0495683_0179969 3300047323 Bacteria 966
146 Ga0495687_003377 3300047443 Bacteria 11651
147 Ga0495675_0005211 3300047444 Bacteria 7913
148 Ga0495675_0129330 3300047444 Bacteria 1570
149 Ga0495677_0038991 3300047445 Bacteria 1736
150 Ga0495685_016421 3300047447 Bacteria 2528
151 Ga0495685_017130 3300047447 Bacteria 2479
152 Ga0495673_0043960 3300047469 Bacteria 1995
153 Ga0495673_0049678 3300047469 Bacteria 1845
154 Ga0495681_0068241 3300047470 Bacteria 1618
155 Ga0495681_0078530 3300047470 Bacteria 1478
156 Ga0495684_0014787 3300047471 Bacteria 6008
157 Ga0495686_0093529 3300047472 Bacteria 1823
158 Ga0495602_0028481 3300048088 Bacteria 5343
159 Ga0495615_0001533 3300048090 Bacteria 3469
160 Ga0495615_0041687 3300048090 Bacteria 1148
161 Ga0495626_0019455 3300048091 Bacteria 3397
162 Ga0496102_0305670 3300048905 Bacteria 1499
163 Ga0496102_0327835 3300048905 Bacteria 1442
164 Ga0496104_0350518 3300048907 Bacteria 1389
165 Ga0496116_0128252 3300048919 Bacteria 1451
166 Ga0496117_0089575 3300048920 Bacteria 1986
167 Ga0496118_0083610 3300048921 Bacteria 2231
168 Ga0496118_0127668 3300048921 Bacteria 1640
169 Ga0496118_0132441 3300048921 Bacteria 1598
170 Ga0496121_0031044 3300048924 Bacteria 4893
171 Ga0496121_0183889 3300048924 Bacteria 1505
172 Ga0496121_0214660 3300048924 Bacteria 1360
173 Ga0496122_0023486 3300048925 Bacteria 5433
174 Ga0496122_0060559 3300048925 Bacteria 2787
175 Ga0496123_0039194 3300048926 Bacteria 3317
176 Ga0496124_0141332 3300048927 Bacteria 1899
177 Ga0496126_0082551 3300048929 Bacteria 2839
178 Ga0501295_021673 3300049518 Bacteria 1180
179 Ga0501312_005243 3300049528 Bacteria 1566
180 Ga0501032_0089070 3300049569 Bacteria 2049
181 Ga0501036_0155437 3300049572 Bacteria 1929
182 Ga0501037_0189077 3300049573 Bacteria 1458
183 Ga0501038_0148937 3300049574 Bacteria 1909
184 Ga0501070_0224381 3300049586 Bacteria 1540
185 Ga0501259_010275 3300049688 Bacteria 1527
186 Ga0501232_013623 3300049757 Bacteria 964
187 Ga0501241_005091 3300049758 Bacteria 2455
188 Ga0501264_013641 3300049761 Bacteria 807
189 Ga0501282_005269 3300049778 Bacteria 1384
190 nmdc:mga03683_125571_c1 3300050489 Bacteria 1144
191 Ga0500610_0073722 3300053079 Bacteria 1780
192 Ga0500578_0119593 3300053086 Bacteria 1656
193 Ga0500644_0020119 3300053088 Bacteria 1980
194 Ga0500644_0024557 3300053088 Bacteria 1844
195 Ga0500646_0062578 3300053090 Bacteria 1098
196 Ga0500650_0023379 3300053098 Bacteria 2746
197 Ga0500650_0075414 3300053098 Bacteria 1576
198 Ga0500650_0116060 3300053098 Bacteria 1249
199 Ga0500557_039520 3300053105 Bacteria 1473
200 Ga0500562_028831 3300053108 Bacteria 1459
201 Ga0500562_031641 3300053108 Bacteria 1396
202 Ga0500569_004224 3300053109 Bacteria 3006
203 Ga0500592_007414 3300053116 Bacteria 1745
204 Ga0500595_000811 3300053119 Bacteria 18044
205 Ga0500621_060149 3300053126 Bacteria 1535
206 Ga0500642_0020880 3300053130 Bacteria 2583
207 Ga0500652_004318 3300053131 Bacteria 4391
208 Ga0500658_0000131 3300053134 Bacteria 35339
209 Ga0500658_0002337 3300053134 Bacteria 7350
210 Ga0500568_0025560 3300053139 Unclassified 2489
211 Ga0500568_0031236 3300053139 Bacteria 2199
212 Ga0500627_0010315 3300053158 Bacteria 3402
213 Ga0500627_0028440 3300053158 Bacteria 2322
214 Ga0500633_0050842 3300053160 Bacteria 1429
215 Ga0500633_0121990 3300053160 Bacteria 970
216 Ga0500611_008394 3300053727 Bacteria 1595
217 Ga0500645_020059 3300053730 Bacteria 2074
218 Ga0500645_071227 3300053730 Bacteria 997
219 Ga0500596_008875 3300053735 Bacteria 1589
220 8005289000 8005282627 Bacteria 6675747
221 2513596325 2513237088 Bacteria 6927906
222 2517075555 2516653085 Bacteria 7346596
223 2517075871 2516653085 Bacteria 7346596
224 2517077626 2516653085 Bacteria 7346596
225 2520377972 2519899620 Bacteria 6499161
226 2617380780 2617270742 Bacteria 6808054
227 2617383360 2617270742 Bacteria 6808054
228 2617384948 2617270742 Bacteria 6808054
229 2617386197 2617270742 Bacteria 6808054
230 2719664291 2718217997 Bacteria 6740740
231 2719664668 2718217997 Bacteria 6740740
232 2719667504 2718217997 Bacteria 6740740
233 2720490710 2718218199 Bacteria 6740745
234 2720491088 2718218199 Bacteria 6740745
235 2720493924 2718218199 Bacteria 6740745
236 2720612456 2718218232 Bacteria 6720332
237 2720612893 2718218232 Bacteria 6720332
238 2720615372 2718218232 Bacteria 6720332
239 2720615387 2718218232 Bacteria 6720332
240 2720619678 2718218233 Bacteria 6662049
241 2720619837 2718218233 Bacteria 6662049
242 2720619905 2718218233 Bacteria 6662049
243 2720620403 2718218233 Bacteria 6662049
244 2720620836 2718218233 Bacteria 6662049
245 2720621843 2718218233 Bacteria 6662049
246 2720630696 2718218235 Bacteria 6630699
247 2720632172 2718218235 Bacteria 6630699
248 2720633067 2718218235 Bacteria 6630699
249 2720633193 2718218235 Bacteria 6630699
250 2720773105 2718218269 Bacteria 6906114
251 2720774389 2718218269 Bacteria 6906114
252 2720775900 2718218269 Bacteria 6906114
253 2720776890 2718218269 Bacteria 6906114
254 2720776920 2718218269 Bacteria 6906114
255 2720777224 2718218269 Bacteria 6906114
256 2723026480 2721755556 Bacteria 6745503
257 2723028524 2721755556 Bacteria 6745503
258 2723028810 2721755556 Bacteria 6745503
259 2723560313 2721755684 Bacteria 6859907
260 2723561113 2721755684 Bacteria 6859907
261 2723562423 2721755684 Bacteria 6859907
262 2723562438 2721755684 Bacteria 6859907
263 2723566277 2721755685 Bacteria 6704835
264 2723567719 2721755685 Bacteria 6704835
265 2723568796 2721755685 Bacteria 6704835
266 2723568972 2721755685 Bacteria 6704835
267 2723569131 2721755685 Bacteria 6704835
268 2724088996 2721755819 Bacteria 6906405
269 2724090507 2721755819 Bacteria 6906405
270 2724091497 2721755819 Bacteria 6906405
271 2724091527 2721755819 Bacteria 6906405
272 2724091831 2721755819 Bacteria 6906405
273 2724093134 2721755819 Bacteria 6906405
274 2724103542 2721755822 Bacteria 6726041
275 2724104984 2721755822 Bacteria 6726041
276 2724106061 2721755822 Bacteria 6726041
277 2724106237 2721755822 Bacteria 6726041
278 2724106396 2721755822 Bacteria 6726041
279 2724108642 2721755823 Bacteria 6752556
280 2724109007 2721755823 Bacteria 6752556
281 2724109746 2721755823 Bacteria 6752556
282 2724109953 2721755823 Bacteria 6752556
283 2724110232 2721755823 Bacteria 6752556
284 2724110330 2721755823 Bacteria 6752556
285 2730107416 2728369352 Bacteria 6745171
286 2730109460 2728369352 Bacteria 6745171
287 2730109746 2728369352 Bacteria 6745171
288 2738715243 2738541276 Bacteria 4690596
289 2766062249 2765235942 Bacteria 7445910
290 2770200456 2767802442 Bacteria 5747986
291 2838694284 2838686498 Bacteria 7807632
292 2838736949 2838729681 Bacteria 7400765
293 2838749887 2838742623 Bacteria 7396178
294 2841859083 2841851746 Bacteria 7532261
295 2842163698 2842156927 Bacteria 6894975
296 2842187310 2842180545 Bacteria 6888678
297 2842237088 2842229732 Bacteria 7475766
298 2842250908 2842243621 Bacteria 7421798
299 2842264687 2842257432 Bacteria 7401195
300 2842271000 2842264693 Bacteria 6472963
301 2842278801 2842271015 Bacteria 7807131
302 2842311124 2842304105 Bacteria 7023636
303 2844454643 2844454524 Bacteria 7952546
304 2844455046 2844454524 Bacteria 7952546
305 2844456731 2844454524 Bacteria 7952546
306 2844457794 2844454524 Bacteria 7952546
307 2857524579 2857516855 Bacteria 7787325
308 2857605406 2857604169 Bacteria 5111450
309 2857609502 2857604169 Bacteria 5111450
310 2904549528 2904541872 Bacteria 8915136
311 2904607322 2904606771 Bacteria 4684500
312 2920823505 2920822456 Bacteria 6897201
313 2920827713 2920822456 Bacteria 6897201
314 2928519759 2928515477 Bacteria 4448421
315 2929166418 2929160207 Bacteria 9075316
316 2929166725 2929160207 Bacteria 9075316
317 2929240836 2929239360 Bacteria 7745570
318 2929244975 2929239360 Bacteria 7745570
319 2929245028 2929239360 Bacteria 7745570
320 2933577611 2933570622 Bacteria 7023390
321 2933605154 2933599457 Bacteria 5858799
322 2938921537 2938917290 Bacteria 5914775
323 2977254909 2977254563 Bacteria 4828420
324 2977256266 2977254563 Bacteria 4828420
325 2977257332 2977254563 Bacteria 4828420
326 8003157724 8003151029 Bacteria 8187759
327 8005431218 8005430974 Bacteria 6689030
328 8005497730 8005497431 Bacteria 6477605
329 8005499389 8005497431 Bacteria 6477605
330 8005499779 8005497431 Bacteria 6477605
331 8005501832 8005497431 Bacteria 6477605
332 8005620998 8005619151 Bacteria 7030230
333 8005624638 8005619151 Bacteria 7030230
334 8005669135 8005668836 Bacteria 6953162
335 8005670805 8005668836 Bacteria 6953162
336 8005671200 8005668836 Bacteria 6953162
337 8005673256 8005668836 Bacteria 6953162
338 8023449131 8023444577 Bacteria 5661597
339 JGI25151J46595_10031610
340 rootH1_10043984
341 rootH1_10351537
342 Ga0055542_1009075
343 Ga0065714_10101184
344 Ga0070658_10215881
345 Ga0070670_100208927
346 Ga0081455_10082170
347 Ga0099826_10133961
348 Ga0105251_10016814
349 Ga0105244_10071407
350 Ga0105244_10089023
351 Ga0105237_10097385
352 Ga0105246_10077271
353 Ga0157371_10022170
354 Ga0157371_10193058
355 Ga0157375_10311197
356 Ga0182008_10001486
357 Ga0182006_1029354
358 Ga0182007_10000982
359 Ga0182005_1005078
360 Ga0213872_10043727
361 Ga0209148_1003850
362 Ga0209676_1001195
363 Ga0209025_1010495
364 Ga0209025_1057304
365 Ga0209025_1071215
366 Ga0207655_1012976
367 Ga0207713_1054957
368 Ga0207713_1075607
369 Ga0207671_10150316
370 Ga0207639_10280882
371 Ga0207648_10526656
372 Ga0209371_1021362
373 Ga0209282_1105624
374 Ga0307517_10220821
375 Ga0307515_10150734
376 Ga0237817_11188
377 Ga0268256_1024041
378 Ga0268256_1027972
379 Ga0307408_100139839
380 Ga0307408_100157363
381 Ga0307409_100323436
382 Ga0307414_10251214
383 Ga0373936_0023501
384 Ga0395898_0242263
385 Ga0395901_0219131
386 Ga0237819_08371
387 Ga0436361_0081922
388 Ga0439438_007114
389 Ga0439447_007536
390 Ga0439466_0026418
391 Ga0451847_0004925
392 Ga0451849_0649849
393 Ga0439431_0000022
394 Ga0439462_0019289
395 Ga0495617_036972
396 Ga0495617_041092
397 Ga0495627_030609
398 Ga0495590_0043988
399 Ga0495591_028716
400 Ga0495638_0005417
401 Ga0495638_0135920
402 Ga0495638_0199832
403 Ga0495605_0000071
404 Ga0495605_0000257
405 Ga0495605_0002975
406 Ga0495584_0038366
407 Ga0495584_0053162
408 Ga0495585_0028755
409 Ga0495585_0057991
410 Ga0495585_0071331
411 Ga0495607_0042118
412 Ga0495607_0073240
413 Ga0495606_0074117
414 Ga0495606_0171480
415 Ga0495610_0011991
416 Ga0495616_0010342
417 Ga0495616_0024408
418 Ga0495620_0000029
419 Ga0495620_0045988
420 Ga0495620_0059384
421 Ga0495620_0059408
422 Ga0495620_0063357
423 Ga0495631_0063230
424 Ga0495631_0102649
425 Ga0495632_0040462
426 Ga0495632_0086629
427 Ga0495637_0017288
428 Ga0495643_0043306
429 Ga0495643_0044994
430 Ga0495643_0088818
431 Ga0495644_0005112
432 Ga0495648_0029206
433 Ga0495663_0033884
434 Ga0495642_0042675
435 Ga0495652_0262803
436 Ga0495654_0034286
437 Ga0495654_0077833
438 Ga0495654_0208784
439 Ga0495609_0049713
440 Ga0495597_0025943
441 Ga0495597_0060412
442 Ga0495645_0107894
443 Ga0495622_0032207
444 Ga0495633_0011046
445 Ga0495633_0095304
446 Ga0495656_0029221
447 Ga0495656_0052260
448 Ga0495668_0049275
449 Ga0495668_0087070
450 Ga0495611_0036270
451 Ga0495611_0079460
452 Ga0495625_0079065
453 Ga0495625_0093905
454 Ga0495625_0105991
455 Ga0495625_0107796
456 Ga0495659_0088198
457 Ga0495661_0081507
458 Ga0495661_0091760
459 Ga0495661_0098432
460 Ga0495661_0100994
461 Ga0495588_0034223
462 Ga0495669_0006647
463 Ga0495669_0081884
464 Ga0495670_0007800
465 Ga0495670_0028403
466 Ga0495670_0042056
467 Ga0495670_0046622
468 Ga0495670_0088001
469 Ga0495670_0098368
470 Ga0495671_0073248
471 Ga0495649_0012570
472 Ga0495589_0028694
473 Ga0495660_0053324
474 Ga0495660_0069928
475 Ga0495636_0011352
476 Ga0495636_0027173
477 Ga0495636_0029547
478 Ga0495636_0042813
479 Ga0495672_0012710
480 Ga0495672_0017955
481 Ga0495680_0054708
482 Ga0495683_0066367
483 Ga0495683_0179969
484 Ga0495687_003377
485 Ga0495675_0005211
486 Ga0495675_0129330
487 Ga0495677_0038991
488 Ga0495685_016421
489 Ga0495685_017130
490 Ga0495673_0043960
491 Ga0495673_0049678
492 Ga0495681_0068241
493 Ga0495681_0078530
494 Ga0495684_0014787
495 Ga0495686_0093529
496 Ga0495602_0028481
497 Ga0495615_0001533
498 Ga0495615_0041687
499 Ga0495626_0019455
500 Ga0496102_0305670
501 Ga0496102_0327835
502 Ga0496104_0350518
503 Ga0496116_0128252
504 Ga0496117_0089575
505 Ga0496118_0083610
506 Ga0496118_0127668
507 Ga0496118_0132441
508 Ga0496121_0031044
509 Ga0496121_0183889
510 Ga0496121_0214660
511 Ga0496122_0023486
512 Ga0496122_0060559
513 Ga0496123_0039194
514 Ga0496124_0141332
515 Ga0496126_0082551
516 Ga0501295_021673
517 Ga0501312_005243
518 Ga0501032_0089070
519 Ga0501036_0155437
520 Ga0501037_0189077
521 Ga0501038_0148937
522 Ga0501070_0224381
523 Ga0501259_010275
524 Ga0501232_013623
525 Ga0501241_005091
526 Ga0501264_013641
527 Ga0501282_005269
528 nmdc:mga03683_125571_c1
529 Ga0500610_0073722
530 Ga0500578_0119593
531 Ga0500644_0020119
532 Ga0500644_0024557
533 Ga0500646_0062578
534 Ga0500650_0023379
535 Ga0500650_0075414
536 Ga0500650_0116060
537 Ga0500557_039520
538 Ga0500562_028831
539 Ga0500562_031641
540 Ga0500569_004224
541 Ga0500592_007414
542 Ga0500595_000811
543 Ga0500621_060149
544 Ga0500642_0020880
545 Ga0500652_004318
546 Ga0500658_0000131
547 Ga0500658_0002337
548 Ga0500568_0025560
549 Ga0500568_0031236
550 Ga0500627_0010315
551 Ga0500627_0028440
552 Ga0500633_0050842
553 Ga0500633_0121990
554 Ga0500611_008394
555 Ga0500645_020059
556 Ga0500645_071227
557 Ga0500596_008875
558 8005289000
559 2513596325
560 2517075555
561 2517075871
562 2517077626
563 2520377972
564 2617380780
565 2617383360
566 2617384948
567 2617386197
568 2719664291
569 2719664668
570 2719667504
571 2720490710
572 2720491088
573 2720493924
574 2720612456
575 2720612893
576 2720615372
577 2720615387
578 2720619678
579 2720619837
580 2720619905
581 2720620403
582 2720620836
583 2720621843
584 2720630696
585 2720632172
586 2720633067
587 2720633193
588 2720773105
589 2720774389
590 2720775900
591 2720776890
592 2720776920
593 2720777224
594 2723026480
595 2723028524
596 2723028810
597 2723560313
598 2723561113
599 2723562423
600 2723562438
601 2723566277
602 2723567719
603 2723568796
604 2723568972
605 2723569131
606 2724088996
607 2724090507
608 2724091497
609 2724091527
610 2724091831
611 2724093134
612 2724103542
613 2724104984
614 2724106061
615 2724106237
616 2724106396
617 2724108642
618 2724109007
619 2724109746
620 2724109953
621 2724110232
622 2724110330
623 2730107416
624 2730109460
625 2730109746
626 2738715243
627 2766062249
628 2770200456
629 2838694284
630 2838736949
631 2838749887
632 2841859083
633 2842163698
634 2842187310
635 2842237088
636 2842250908
637 2842264687
638 2842271000
639 2842278801
640 2842311124
641 2844454643
642 2844455046
643 2844456731
644 2844457794
645 2857524579
646 2857605406
647 2857609502
648 2904549528
649 2904607322
650 2920823505
651 2920827713
652 2928519759
653 2929166418
654 2929166725
655 2929240836
656 2929244975
657 2929245028
658 2933577611
659 2933605154
660 2938921537
661 2977254909
662 2977256266
663 2977257332
664 8003157724
665 8005431218
666 8005497730
667 8005499389
668 8005499779
669 8005501832
670 8005620998
671 8005624638
672 8005669135
673 8005670805
674 8005671200
675 8005673256
676 8023449131

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13333

rve_2

Integrase core domain

233

288

0.98

PF00665

rve

Integrase core domain

127

226

0.97

PF13683

rve_3

Integrase core domain

214

280

0.96

PF13276

HTH_21

HTH-like domain

47

105

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ut1-assembly1.cif.gz_b higher-order assembly of multiple mmtv strand transfer complex intasomes 0.7985 106 261
3dlr-assembly1.cif.gz_A-2 crystal structure of the catalytic core domain from pfv integrase 0.7905 105 264
2x74-assembly2.cif.gz_A human foamy virus integrase - catalytic core. 0.7872 103 263
3hpg-assembly2.cif.gz_F visna virus integrase (residues 1-219) in complex with ledgf ibd: examples of open integrase dimer-dimer interfaces 0.7849 110 265
3hpg-assembly3.cif.gz_C visna virus integrase (residues 1-219) in complex with ledgf ibd: examples of open integrase dimer-dimer interfaces 0.7846 105 266
ID Description Score Start End Superfamily
af_P19769_115_278_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9678 101 262 3.30.420.10
af_P19769_115_278_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9506 101 262 3.30.420.10
af_P9WKH9_102_261_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9112 104 256 3.30.420.10
af_P0CF80_124_283_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8976 104 259 3.30.420.10
af_Q47718_102_174_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.896 99 161 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A254PS84-F1-model_v4 IS3 family transposase 0.9756 125 267 GO:0003676
GO:0015074
AF-A0A6J5EQA7-F1-model_v4 IS3 family transposase ISBam1 0.9745 116 262 GO:0003676
GO:0015074
AF-A0A699Y0E4-F1-model_v4 deleted 0.9725 113 267
AF-A0A829DNR4-F1-model_v4 deleted 0.9705 125 263
AF-A0A6B2JF85-F1-model_v4 IS3 family transposase 0.9702 132 267 GO:0003676
GO:0015074

Map