F413744

General Info

Members Datasets Scaffolds Average Seq Length
338 241 266 303

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2881364244|2881369345
Length 345
Sequence AASEVCCRTGLVAMRLGRPFLPQIFPALGWSHRAAKNRDPAPKTRYMLPKHLHRLEAESIEIMRDVVAEFKRPVMLYSIGKDSSVLLHLAIKAFYPAKIPFPLLHVDTTWKFREMISFRDATASRLGLDLIVHVNKDGSARGINPIKSGSALHTQVMKTDALKQALDLHGFDAAFGGARRDEERSRAKERILSFRSAGHVWDPRNQRPELWSLFNTRVREGETMRVFAMSNWTELEVWEYIMIEKIPVVPLYFAKRRPIVHRNGAMIMVDDERLPLNCDETPEMRMIRFRTLGCYPLSGAIESDATTIEDIVAEMQTATVSERQGRLIDTDEAASMEKKKREGYF

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
3 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
4 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
7 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
8 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
9 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
10 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
11 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
12 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
13 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
14 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
15 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
16 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
17 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
18 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
19 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
20 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
21 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
22 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
23 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
24 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
25 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
26 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
27 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
28 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
29 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
30 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
31 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
32 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
33 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
34 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
35 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
36 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
37 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
38 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
39 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
40 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
41 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
42 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
43 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
44 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
45 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
46 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
47 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
48 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
49 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
50 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
51 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
52 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
53 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
54 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
55 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
56 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
57 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
58 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
59 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
60 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
61 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
62 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
63 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
64 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
65 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
67 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
68 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
69 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
70 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
71 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
72 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
73 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
74 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
75 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
76 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
77 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
95 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
116 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
117 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
121 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
149 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
150 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
151 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
152 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
156 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
157 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
158 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
173 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
174 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
216 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
223 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
224 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
225 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
226 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
227 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
228 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
229 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
230 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
231 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
232 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
233 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
237 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
238 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
239 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
240 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
241 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.7
Metatranscriptomes 0
Isolates 21.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.98
Nodule 13.91
Rhizoplane 4.44
Rhizosphere 44.97
Stem 0
Stem Tuber 0
Unclassified 20.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10051875 3300003187 Bacteria 1384
2 JGI25406J46586_10033074 3300003203 Bacteria 1914
3 JGI25153J46596_10006799 3300003215 Bacteria 5729
4 Ga0055526_1003875 3300003771 Bacteria 9276
5 Ga0065165_1002483 3300005262 Bacteria 15505
6 Ga0065165_1003087 3300005262 Bacteria 12410
7 Ga0065715_10208132 3300005293 Bacteria 1327
8 Ga0065707_10082296 3300005295 Bacteria 17280
9 Ga0070683_100557411 3300005329 Bacteria 1096
10 Ga0070666_10035241 3300005335 Bacteria 3319
11 Ga0070660_100007218 3300005339 Bacteria 7731
12 Ga0070671_100000668 3300005355 Bacteria 24571
13 Ga0070671_100201788 3300005355 Bacteria 1687
14 Ga0070688_100142081 3300005365 Bacteria 1632
15 Ga0070667_100013238 3300005367 Bacteria 6816
16 Ga0070681_10020340 3300005458 Bacteria 6652
17 Ga0070679_100014583 3300005530 Bacteria 7551
18 Ga0068853_100217988 3300005539 Bacteria 1742
19 Ga0070693_100293675 3300005547 Bacteria 1093
20 Ga0070665_100000075 3300005548 Bacteria 189496
21 Ga0070665_100004886 3300005548 Bacteria 13909
22 Ga0070665_100009652 3300005548 Bacteria 9759
23 Ga0070665_100024692 3300005548 Bacteria 6056
24 Ga0070665_100029387 3300005548 Bacteria 5532
25 Ga0070665_100034225 3300005548 Bacteria 5109
26 Ga0070665_100082520 3300005548 Bacteria 3220
27 Ga0070665_100164686 3300005548 Bacteria 2219
28 Ga0070665_100354016 3300005548 Bacteria 1474
29 Ga0070665_100595298 3300005548 Bacteria 1119
30 Ga0068855_100022407 3300005563 Bacteria 7571
31 Ga0070664_100194494 3300005564 Bacteria 1808
32 Ga0068856_100390868 3300005614 Bacteria 1411
33 Ga0068859_100000092 3300005617 Bacteria 82442
34 Ga0068864_100375299 3300005618 Bacteria 1346
35 Ga0068861_100592490 3300005719 Bacteria 1016
36 Ga0068863_100009047 3300005841 Bacteria 9723
37 Ga0068863_100473843 3300005841 Bacteria 1230
38 Ga0068863_100534594 3300005841 Bacteria 1156
39 Ga0068858_100007426 3300005842 Bacteria 10601
40 Ga0068860_100001811 3300005843 Bacteria 22738
41 Ga0068860_100004269 3300005843 Bacteria 14632
42 Ga0068860_100024854 3300005843 Bacteria 5783
43 Ga0068862_100106958 3300005844 Bacteria 2453
44 Ga0081455_10179148 3300005937 Bacteria 1607
45 Ga0081539_10000060 3300005985 Bacteria 252799
46 Ga0081539_10004271 3300005985 Bacteria 16038
47 Ga0075365_10106803 3300006038 Bacteria 1921
48 Ga0075365_10271304 3300006038 Bacteria 1193
49 Ga0075363_100036199 3300006048 Bacteria 2588
50 Ga0075362_10025019 3300006177 Bacteria 2537
51 Ga0075367_10019158 3300006178 Bacteria 3791
52 Ga0075369_10001895 3300006186 Bacteria 7330
53 Ga0075366_10080789 3300006195 Bacteria 1941
54 Ga0075370_10010336 3300006353 Bacteria 4877
55 Ga0097620_100000092 3300006931 Bacteria 82442
56 Ga0099824_1023042 3300006942 Bacteria 3956
57 Ga0099824_1029618 3300006942 Bacteria 2305
58 Ga0105240_10009414 3300009093 Bacteria 13829
59 Ga0105240_10084859 3300009093 Bacteria 3882
60 Ga0105245_10392458 3300009098 Bacteria 1385
61 Ga0105247_10000482 3300009101 Bacteria 33256
62 Ga0105241_10223975 3300009174 Bacteria 1582
63 Ga0105248_10005260 3300009177 Bacteria 14242
64 Ga0105237_10017516 3300009545 Bacteria 7424
65 Ga0105237_10159763 3300009545 Bacteria 2252
66 Ga0105238_10040536 3300009551 Bacteria 4718
67 Ga0105238_10194511 3300009551 Bacteria 2004
68 Ga0105249_10092319 3300009553 Bacteria 2834
69 Ga0105249_10363461 3300009553 Bacteria 1469
70 Ga0157378_10026395 3300013297 Bacteria 5120
71 Ga0163163_10274287 3300014325 Bacteria 1738
72 Ga0157379_10007365 3300014968 Bacteria 9527
73 Ga0157379_10080505 3300014968 Bacteria 2918
74 Ga0157379_10105918 3300014968 Bacteria 2524
75 Ga0157376_10093070 3300014969 Bacteria 2616
76 Ga0157376_10604081 3300014969 Bacteria 1092
77 Ga0214542_1000026 3300021321 Bacteria 182145
78 Ga0214545_1000015 3300021324 Bacteria 182143
79 Ga0214543_1000036 3300021327 Bacteria 182143
80 Ga0213876_10004588 3300021384 Bacteria 7703
81 Ga0209148_1016841 3300025254 Bacteria 1251
82 Ga0209233_1001053 3300025261 Bacteria 11529
83 Ga0209233_1002120 3300025261 Bacteria 7476
84 Ga0209025_1000118 3300025294 Bacteria 214009
85 Ga0209564_1000043 3300025295 Bacteria 388153
86 Ga0209758_1000364 3300025297 Bacteria 80651
87 Ga0209758_1006642 3300025297 Bacteria 8186
88 Ga0209256_1002636 3300025299 Bacteria 14129
89 Ga0209256_1006880 3300025299 Bacteria 5833
90 Ga0209256_1030373 3300025299 Bacteria 1493
91 Ga0207710_10000186 3300025900 Bacteria 60552
92 Ga0207710_10114532 3300025900 Bacteria 1283
93 Ga0207680_10193895 3300025903 Bacteria 1381
94 Ga0207647_10167581 3300025904 Bacteria 1280
95 Ga0207707_10019302 3300025912 Bacteria 5950
96 Ga0207695_10020298 3300025913 Bacteria 7615
97 Ga0207695_10096676 3300025913 Bacteria 2955
98 Ga0207671_10038975 3300025914 Bacteria 3520
99 Ga0207663_10123212 3300025916 Bacteria 1779
100 Ga0207657_10000434 3300025919 Bacteria 44542
101 Ga0207652_10023173 3300025921 Bacteria 5141
102 Ga0207652_10128496 3300025921 Bacteria 2259
103 Ga0207694_10163183 3300025924 Bacteria 1801
104 Ga0207694_10244911 3300025924 Bacteria 1466
105 Ga0207694_10485821 3300025924 Bacteria 1033
106 Ga0207700_10232633 3300025928 Bacteria 1568
107 Ga0207700_10308472 3300025928 Bacteria 1368
108 Ga0207644_10002846 3300025931 Bacteria 11163
109 Ga0207661_10509114 3300025944 Bacteria 1100
110 Ga0207667_10010840 3300025949 Bacteria 10631
111 Ga0207712_10086250 3300025961 Bacteria 2299
112 Ga0207658_10011432 3300025986 Bacteria 6040
113 Ga0207703_10000318 3300026035 Bacteria 52249
114 Ga0207703_10001160 3300026035 Bacteria 24856
115 Ga0207639_10057902 3300026041 Bacteria 2978
116 Ga0207678_10008627 3300026067 Bacteria 8983
117 Ga0207702_10207313 3300026078 Bacteria 1820
118 Ga0207641_10083362 3300026088 Bacteria 2780
119 Ga0207674_10493044 3300026116 Bacteria 1184
120 Ga0207675_100230900 3300026118 Bacteria 1785
121 Ga0209389_1000071 3300027296 Bacteria 97411
122 Ga0209389_1000089 3300027296 Bacteria 83505
123 Ga0209389_1000138 3300027296 Bacteria 63273
124 Ga0209589_1000004 3300027357 Bacteria 578529
125 Ga0209589_1000148 3300027357 Bacteria 77222
126 Ga0209489_100004 3300027361 Bacteria 578529
127 Ga0209489_100512 3300027361 Bacteria 72878
128 Ga0209489_101361 3300027361 Bacteria 50193
129 Ga0209489_110008 3300027361 Bacteria 11158
130 Ga0209489_110059 3300027361 Bacteria 11051
131 Ga0209700_100004 3300027363 Bacteria 578529
132 Ga0209700_100011 3300027363 Bacteria 362159
133 Ga0209700_100026 3300027363 Bacteria 224498
134 Ga0209971_1030481 3300027682 Bacteria 1291
135 Ga0268266_10000103 3300028379 Bacteria 179736
136 Ga0268266_10002296 3300028379 Bacteria 20741
137 Ga0268266_10007886 3300028379 Bacteria 9535
138 Ga0268266_10008007 3300028379 Bacteria 9450
139 Ga0268266_10015895 3300028379 Bacteria 6441
140 Ga0268266_10026432 3300028379 Bacteria 4938
141 Ga0268266_10354079 3300028379 Bacteria 1380
142 Ga0268266_10410589 3300028379 Bacteria 1282
143 Ga0268264_10001047 3300028381 Bacteria 27587
144 Ga0268264_10004984 3300028381 Bacteria 11243
145 Ga0268264_10007047 3300028381 Bacteria 9427
146 Ga0265334_10047456 3300028573 Bacteria 1657
147 Ga0307511_10001542 3300030521 Bacteria 24384
148 Ga0265330_10026451 3300031235 Bacteria 2624
149 Ga0307508_10208314 3300031616 Bacteria 1556
150 Ga0307410_10008052 3300031852 Bacteria 5819
151 Ga0307410_10090611 3300031852 Bacteria 2169
152 Ga0307409_100125251 3300031995 Bacteria 2184
153 Ga0307411_10041398 3300032005 Bacteria 2931
154 Ga0307411_10111033 3300032005 Bacteria 1962
155 Ga0307510_10000015 3300033180 Bacteria 258937
156 Ga0373937_0165909 3300036401 Bacteria 2071
157 Ga0316584_0053400 3300036712 Bacteria 3024
158 Ga0395899_0051581 3300037312 Bacteria 3053
159 Ga0395900_0071594 3300037418 Bacteria 3564
160 Ga0395905_0300678 3300037471 Bacteria 1492
161 Ga0436364_0734008 3300037853 Bacteria 2970
162 Ga0395901_0000583 3300038443 Bacteria 42413
163 Ga0436365_0609863 3300039437 Bacteria 1346
164 Ga0436365_0611857 3300039437 Bacteria 5251
165 Ga0436365_1874128 3300039437 Bacteria 23935
166 Ga0436360_0344470 3300039438 Bacteria 3084
167 Ga0436360_1029045 3300039438 Bacteria 1483
168 Ga0439441_006564 3300042001 Bacteria 1851
169 Ga0439443_013304 3300042003 Bacteria 1228
170 Ga0439440_0008264 3300042993 Bacteria 2132
171 Ga0466969_0024766 3300044656 Bacteria 3087
172 Ga0466972_0088815 3300044658 Bacteria 1467
173 Ga0466963_0040090 3300044694 Bacteria 3069
174 Ga0466963_0086919 3300044694 Bacteria 2125
175 Ga0466964_0177203 3300044706 Bacteria 1008
176 Ga0466957_0337725 3300044842 Bacteria 1020
177 Ga0466960_0159497 3300044901 Bacteria 1210
178 Ga0466959_0000216 3300045049 Bacteria 37434
179 Ga0466959_0004820 3300045049 Bacteria 9112
180 Ga0466959_0038731 3300045049 Bacteria 3522
181 Ga0466959_0070877 3300045049 Bacteria 2525
182 Ga0466967_0020032 3300045976 Bacteria 5395
183 Ga0495606_0082324 3300046507 Bacteria 1998
184 Ga0495606_0086772 3300046507 Bacteria 1933
185 Ga0495628_0058299 3300046516 Bacteria 3035
186 Ga0495630_0414199 3300046517 Bacteria 1033
187 Ga0495632_0086296 3300046519 Bacteria 1493
188 Ga0495587_0202205 3300046536 Bacteria 1123
189 Ga0495623_0203515 3300046679 Bacteria 1137
190 Ga0495600_0109899 3300046809 Bacteria 1795
191 Ga0495604_0017277 3300047317 Bacteria 5774
192 Ga0495680_0126966 3300047322 Bacteria 1877
193 Ga0496102_0014863 3300048905 Bacteria 6772
194 Ga0496102_0023703 3300048905 Bacteria 5454
195 Ga0496103_0180946 3300048906 Bacteria 1355
196 Ga0496104_0004434 3300048907 Bacteria 12220
197 Ga0496104_0019582 3300048907 Bacteria 6196
198 Ga0496105_0020993 3300048908 Bacteria 5282
199 Ga0496105_0180837 3300048908 Bacteria 1727
200 Ga0496108_0266293 3300048911 Bacteria 1491
201 Ga0496108_0285911 3300048911 Bacteria 1436
202 Ga0496109_0268424 3300048912 Bacteria 1607
203 Ga0496112_0262527 3300048915 Bacteria 1676
204 Ga0496112_0351516 3300048915 Bacteria 1416
205 Ga0496112_0439906 3300048915 Bacteria 1242
206 Ga0496113_0269975 3300048916 Bacteria 1359
207 Ga0496115_0060656 3300048918 Bacteria 3048
208 Ga0496117_0000208 3300048920 Bacteria 113931
209 Ga0496118_0000005 3300048921 Bacteria 697350
210 Ga0496118_0022715 3300048921 Bacteria 5472
211 Ga0496118_0025499 3300048921 Bacteria 5066
212 Ga0496118_0277950 3300048921 Bacteria 934
213 Ga0496119_0003655 3300048922 Bacteria 15792
214 Ga0496119_0053636 3300048922 Bacteria 2461
215 Ga0496120_0030683 3300048923 Bacteria 3263
216 Ga0496121_0001978 3300048924 Bacteria 32561
217 Ga0496121_0027812 3300048924 Bacteria 5281
218 Ga0496121_0035492 3300048924 Bacteria 4468
219 Ga0496121_0083673 3300048924 Bacteria 2518
220 Ga0496122_0000604 3300048925 Bacteria 73844
221 Ga0496123_0001019 3300048926 Bacteria 42794
222 Ga0496124_0034793 3300048927 Bacteria 4414
223 Ga0496125_0000254 3300048928 Bacteria 109882
224 Ga0496125_0003265 3300048928 Bacteria 19952
225 Ga0496125_0067070 3300048928 Bacteria 2830
226 Ga0496125_0094259 3300048928 Bacteria 2231
227 Ga0496126_0002653 3300048929 Bacteria 23704
228 Ga0496126_0037842 3300048929 Bacteria 4495
229 Ga0496126_0074554 3300048929 Bacteria 3013
230 Ga0501300_000445 3300049523 Bacteria 6290
231 Ga0501043_0050028 3300049579 Bacteria 3285
232 Ga0501080_0540469 3300049742 Bacteria 1039
233 Ga0501035_0080627 3300049822 Bacteria 2873
234 nmdc:mga03683_6684_c1 3300050489 Bacteria 3961
235 nmdc:mga03n38_127131_c1 3300050490 Bacteria 1259
236 nmdc:mga0yw44_117534_c1 3300050492 Bacteria 1710
237 nmdc:mga0k408_12539_c1 3300050493 Bacteria 4635
238 nmdc:mga06z11_1813_c1 3300050494 Bacteria 8045
239 nmdc:mga06z11_23078_c1 3300050494 Bacteria 2917
240 nmdc:mga07m45_1996_c4 3300050496 Bacteria 5391
241 nmdc:mga0qj67_381361_c1 3300050509 Bacteria 1138
242 nmdc:mga0sz30_204_c1 3300050516 Bacteria 22141
243 nmdc:mga0sz30_5801_c1 3300050516 Bacteria 4548
244 nmdc:mga0sz30_85859_c1 3300050516 Bacteria 1366
245 Ga0500635_0021341 3300053080 Bacteria 1994
246 Ga0500643_000063 3300053087 Bacteria 122135
247 Ga0500651_0081117 3300053093 Bacteria 2009
248 Ga0500640_052574 3300053095 Bacteria 1779
249 Ga0500555_006779 3300053103 Bacteria 3255
250 Ga0500572_000037 3300053111 Bacteria 42272
251 Ga0500572_017072 3300053111 Bacteria 1860
252 Ga0500607_043489 3300053121 Bacteria 2420
253 Ga0500608_020689 3300053122 Bacteria 3030
254 Ga0500608_046641 3300053122 Bacteria 2082
255 Ga0500642_0004907 3300053130 Bacteria 4249
256 Ga0500642_0126263 3300053130 Bacteria 1198
257 Ga0500559_0003395 3300053136 Bacteria 7850
258 Ga0500564_016514 3300053138 Bacteria 3346
259 Ga0500568_0049409 3300053139 Bacteria 1660
260 Ga0500616_0000016 3300053153 Bacteria 627087
261 Ga0500616_0043724 3300053153 Bacteria 2393
262 Ga0500619_003020 3300053154 Bacteria 3364
263 Ga0500636_0002129 3300053177 Bacteria 10922
264 Ga0500636_0014406 3300053177 Bacteria 4651
265 Ga0500637_0017366 3300053178 Bacteria 3851
266 Ga0466962_0112942 3300061719 Bacteria 1308

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100007218 Ga0070660_1000072184 266
2 3300025919 Ga0207657_10000434 Ga0207657_100004344 266
3 iso_pu_bacteria 2511231028 2511396756 279
4 iso_pu_bacteria 2617270741 2617379638 279
5 iso_pu_bacteria 2824746037 2824750956 279
6 iso_pu_bacteria 2857509624 2857510030 279
7 iso_pu_bacteria 2876761206 2876769684 279
8 3300025900 Ga0207710_10114532 Ga0207710_101145322 282
9 3300025299 Ga0209256_1030373 Ga0209256_10303731 283
10 3300046517 Ga0495630_0414199 Ga0495630_0414199_163_1014 283
11 3300048908 Ga0496105_0020993 Ga0496105_0020993_975_1826 283
12 3300048921 Ga0496118_0277950 Ga0496118_0277950_14_865 283
13 3300061719 Ga0466962_0112942 Ga0466962_0112942_25_876 283
14 3300048929 Ga0496126_0037842 Ga0496126_0037842_1998_2894 285
15 3300025916 Ga0207663_10123212 Ga0207663_101232122 289
16 3300014969 Ga0157376_10093070 Ga0157376_100930701 292
17 3300014968 Ga0157379_10080505 Ga0157379_100805054 294
18 3300044656 Ga0466969_0024766 Ga0466969_0024766_1211_2095 294
19 3300045049 Ga0466959_0038731 Ga0466959_0038731_2155_3039 294
20 iso_pu_bacteria 2513237096 2513659706 295
21 iso_pu_bacteria 2513237145 2513921774 295
22 iso_pu_bacteria 2513237161 2514015884 295
23 iso_pu_bacteria 2524023228 2524541685 295
24 iso_pu_bacteria 2617270735 2617353401 295
25 iso_pu_bacteria 2824600985 2824601098 295
26 iso_pu_bacteria 2824617872 2824618320 295
27 iso_pu_bacteria 2824626560 2824626971 295
28 iso_pu_bacteria 2824635225 2824635359 295
29 iso_pu_bacteria 2824644064 2824644198 295
30 iso_pu_bacteria 2824653114 2824654675 295
31 iso_pu_bacteria 2824671348 2824671368 295
32 iso_pu_bacteria 2824687955 2824688156 295
33 iso_pu_bacteria 2824696289 2824696883 295
34 iso_pu_bacteria 2824704595 2824704796 295
35 iso_pu_bacteria 2824714736 2824714870 295
36 iso_pu_bacteria 2824723954 2824724066 295
37 iso_pu_bacteria 2824753945 2824754800 295
38 iso_pu_bacteria 2824763712 2824764551 295
39 iso_pu_bacteria 2824773399 2824779930 295
40 iso_pu_bacteria 2838122688 2838130855 295
41 iso_pu_bacteria 2841949485 2841955284 295
42 iso_pu_bacteria 2841957949 2841963819 295
43 iso_pu_bacteria 2841966195 2841974143 295
44 iso_pu_bacteria 2841974524 2841976722 295
45 iso_pu_bacteria 2841983080 2841986144 295
46 iso_pu_bacteria 2847930680 2847933487 295
47 iso_pu_bacteria 2874604998 2874605751 295
48 iso_pu_bacteria 2874612657 2874613714 295
49 iso_pu_bacteria 2874620515 2874622127 295
50 iso_pu_bacteria 2879083081 2879088864 295
51 iso_pu_bacteria 2881665667 2881666821 295
52 iso_pu_bacteria 2885366525 2885370843 295
53 iso_pu_bacteria 2903748898 2903752380 295
54 iso_pu_bacteria 2904666416 2904672459 295
55 iso_pu_bacteria 2904690495 2904693599 295
56 iso_pu_bacteria 2904711408 2904714006 295
57 iso_pu_bacteria 2906643746 2906644849 295
58 iso_pu_bacteria 2906660503 2906664641 295
59 iso_pu_bacteria 2908739725 2908740141 295
60 iso_pu_bacteria 2908756301 2908758564 295
61 iso_pu_bacteria 2908775508 2908777872 295
62 iso_pu_bacteria 2922393267 2922398828 295
63 iso_pu_bacteria 2935630451 2935637670 295
64 iso_pu_bacteria 2941507105 2941514229 295
65 iso_pu_bacteria 2941515067 2941522187 295
66 iso_pu_bacteria 2941523033 2941529999 295
67 iso_pu_bacteria 2941531003 2941535187 295
68 iso_pu_bacteria 3005483717 3005490700 295
69 iso_pu_bacteria 8006933436 8006934219 295
70 iso_pu_bacteria 8006973647 8006974200 295
71 3300006038 Ga0075365_10106803 Ga0075365_101068032 296
72 3300005293 Ga0065715_10208132 Ga0065715_102081321 297
73 iso_pu_bacteria 2824600985 2824605287 297
74 iso_pu_bacteria 2885366525 2885367092 297
75 3300031852 Ga0307410_10008052 Ga0307410_100080523 298
76 3300032005 Ga0307411_10111033 Ga0307411_101110332 298
77 iso_pu_bacteria 2824653114 2824656932 298
78 3300005365 Ga0070688_100142081 Ga0070688_1001420811 299
79 3300006942 Ga0099824_1023042 Ga0099824_10230422 299
80 3300021321 Ga0214542_1000026 Ga0214542_1000026152 299
81 3300021324 Ga0214545_1000015 Ga0214545_1000015152 299
82 3300021327 Ga0214543_1000036 Ga0214543_1000036152 299
83 3300027296 Ga0209389_1000138 Ga0209389_100013848 299
84 3300027357 Ga0209589_1000004 Ga0209589_1000004321 299
85 3300027361 Ga0209489_100004 Ga0209489_100004321 299
86 3300027361 Ga0209489_110008 Ga0209489_1100088 299
87 3300027361 Ga0209489_110059 Ga0209489_1100597 299
88 3300027363 Ga0209700_100004 Ga0209700_100004321 299
89 3300027363 Ga0209700_100026 Ga0209700_100026210 299
90 3300044658 Ga0466972_0088815 Ga0466972_0088815_310_1209 299
91 3300046507 Ga0495606_0082324 Ga0495606_0082324_504_1403 299
92 3300046516 Ga0495628_0058299 Ga0495628_0058299_1884_2783 299
93 3300046536 Ga0495587_0202205 Ga0495587_0202205_23_922 299
94 3300046679 Ga0495623_0203515 Ga0495623_0203515_105_1004 299
95 3300046809 Ga0495600_0109899 Ga0495600_0109899_864_1763 299
96 3300047317 Ga0495604_0017277 Ga0495604_0017277_1341_2240 299
97 3300047322 Ga0495680_0126966 Ga0495680_0126966_825_1724 299
98 3300048907 Ga0496104_0019582 Ga0496104_0019582_2014_2913 299
99 3300048908 Ga0496105_0180837 Ga0496105_0180837_759_1658 299
100 3300050516 nmdc:mga0sz30_5801_c1 nmdc:mga0sz30_5801_c1_739_1638 299
101 3300005295 Ga0065707_10082296 Ga0065707_100822964 300
102 3300005335 Ga0070666_10035241 Ga0070666_100352413 300
103 3300005355 Ga0070671_100000668 Ga0070671_1000006683 300
104 3300005367 Ga0070667_100013238 Ga0070667_1000132387 300
105 3300005539 Ga0068853_100217988 Ga0068853_1002179882 300
106 3300005547 Ga0070693_100293675 Ga0070693_1002936751 300
107 3300005548 Ga0070665_100024692 Ga0070665_1000246924 300
108 3300005548 Ga0070665_100029387 Ga0070665_1000293876 300
109 3300005548 Ga0070665_100034225 Ga0070665_1000342254 300
110 3300005548 Ga0070665_100082520 Ga0070665_1000825202 300
111 3300005548 Ga0070665_100164686 Ga0070665_1001646863 300
112 3300005548 Ga0070665_100354016 Ga0070665_1003540162 300
113 3300005614 Ga0068856_100390868 Ga0068856_1003908682 300
114 3300005617 Ga0068859_100000092 Ga0068859_10000009236 300
115 3300005618 Ga0068864_100375299 Ga0068864_1003752992 300
116 3300005719 Ga0068861_100592490 Ga0068861_1005924901 300
117 3300005841 Ga0068863_100009047 Ga0068863_1000090474 300
118 3300005841 Ga0068863_100473843 Ga0068863_1004738432 300
119 3300005841 Ga0068863_100534594 Ga0068863_1005345942 300
120 3300005842 Ga0068858_100007426 Ga0068858_1000074265 300
121 3300005843 Ga0068860_100001811 Ga0068860_1000018112 300
122 3300005843 Ga0068860_100004269 Ga0068860_1000042692 300
123 3300005843 Ga0068860_100024854 Ga0068860_1000248543 300
124 3300005937 Ga0081455_10179148 Ga0081455_101791481 300
125 3300006177 Ga0075362_10025019 Ga0075362_100250192 300
126 3300006178 Ga0075367_10019158 Ga0075367_100191582 300
127 3300006186 Ga0075369_10001895 Ga0075369_100018953 300
128 3300006353 Ga0075370_10010336 Ga0075370_100103362 300
129 3300006931 Ga0097620_100000092 Ga0097620_10000009236 300
130 3300009093 Ga0105240_10084859 Ga0105240_100848595 300
131 3300009101 Ga0105247_10000482 Ga0105247_1000048211 300
132 3300009174 Ga0105241_10223975 Ga0105241_102239751 300
133 3300009177 Ga0105248_10005260 Ga0105248_100052607 300
134 3300009551 Ga0105238_10194511 Ga0105238_101945112 300
135 3300009553 Ga0105249_10092319 Ga0105249_100923192 300
136 3300009553 Ga0105249_10363461 Ga0105249_103634612 300
137 3300014325 Ga0163163_10274287 Ga0163163_102742872 300
138 3300014968 Ga0157379_10007365 Ga0157379_100073657 300
139 3300014968 Ga0157379_10105918 Ga0157379_101059183 300
140 3300014969 Ga0157376_10604081 Ga0157376_106040812 300
141 3300025900 Ga0207710_10000186 Ga0207710_100001864 300
142 3300025904 Ga0207647_10167581 Ga0207647_101675812 300
143 3300025924 Ga0207694_10163183 Ga0207694_101631832 300
144 3300025924 Ga0207694_10485821 Ga0207694_104858211 300
145 3300025931 Ga0207644_10002846 Ga0207644_100028464 300
146 3300025961 Ga0207712_10086250 Ga0207712_100862502 300
147 3300025986 Ga0207658_10011432 Ga0207658_100114324 300
148 3300026035 Ga0207703_10000318 Ga0207703_1000031828 300
149 3300026035 Ga0207703_10001160 Ga0207703_100011604 300
150 3300026041 Ga0207639_10057902 Ga0207639_100579022 300
151 3300026067 Ga0207678_10008627 Ga0207678_100086272 300
152 3300026078 Ga0207702_10207313 Ga0207702_102073132 300
153 3300026088 Ga0207641_10083362 Ga0207641_100833622 300
154 3300026116 Ga0207674_10493044 Ga0207674_104930441 300
155 3300026118 Ga0207675_100230900 Ga0207675_1002309001 300
156 3300028379 Ga0268266_10007886 Ga0268266_100078867 300
157 3300028379 Ga0268266_10008007 Ga0268266_100080078 300
158 3300028379 Ga0268266_10026432 Ga0268266_100264324 300
159 3300028379 Ga0268266_10354079 Ga0268266_103540792 300
160 3300028381 Ga0268264_10001047 Ga0268264_100010472 300
161 3300028381 Ga0268264_10004984 Ga0268264_100049842 300
162 3300028381 Ga0268264_10007047 Ga0268264_100070474 300
163 3300030521 Ga0307511_10001542 Ga0307511_100015423 300
164 3300031616 Ga0307508_10208314 Ga0307508_102083142 300
165 3300033180 Ga0307510_10000015 Ga0307510_10000015147 300
166 3300039438 Ga0436360_1029045 Ga0436360_1029045_143_1045 300
167 3300046507 Ga0495606_0086772 Ga0495606_0086772_838_1740 300
168 3300046519 Ga0495632_0086296 Ga0495632_0086296_436_1338 300
169 3300048905 Ga0496102_0023703 Ga0496102_0023703_2029_2931 300
170 3300048911 Ga0496108_0285911 Ga0496108_0285911_113_1015 300
171 3300048915 Ga0496112_0351516 Ga0496112_0351516_146_1048 300
172 3300048920 Ga0496117_0000208 Ga0496117_0000208_11274_12176 300
173 3300048921 Ga0496118_0000005 Ga0496118_0000005_411713_412615 300
174 3300048922 Ga0496119_0003655 Ga0496119_0003655_10127_11029 300
175 3300048923 Ga0496120_0030683 Ga0496120_0030683_2116_3018 300
176 3300048924 Ga0496121_0001978 Ga0496121_0001978_16587_17489 300
177 3300048924 Ga0496121_0035492 Ga0496121_0035492_274_1176 300
178 3300048924 Ga0496121_0083673 Ga0496121_0083673_1343_2245 300
179 3300048927 Ga0496124_0034793 Ga0496124_0034793_3239_4141 300
180 3300048928 Ga0496125_0003265 Ga0496125_0003265_18780_19682 300
181 3300048928 Ga0496125_0067070 Ga0496125_0067070_1594_2496 300
182 3300048928 Ga0496125_0094259 Ga0496125_0094259_245_1147 300
183 3300048929 Ga0496126_0074554 Ga0496126_0074554_857_1759 300
184 3300050489 nmdc:mga03683_6684_c1 nmdc:mga03683_6684_c1_1481_2383 300
185 3300050494 nmdc:mga06z11_1813_c1 nmdc:mga06z11_1813_c1_6677_7579 300
186 3300050496 nmdc:mga07m45_1996_c4 nmdc:mga07m45_1996_c4_2823_3725 300
187 3300050516 nmdc:mga0sz30_204_c1 nmdc:mga0sz30_204_c1_15808_16710 300
188 3300053093 Ga0500651_0081117 Ga0500651_0081117_337_1239 300
189 3300053178 Ga0500637_0017366 Ga0500637_0017366_730_1632 300
190 3300003771 Ga0055526_1003875 Ga0055526_10038756 301
191 3300005355 Ga0070671_100201788 Ga0070671_1002017881 301
192 3300005548 Ga0070665_100595298 Ga0070665_1005952981 301
193 3300005985 Ga0081539_10004271 Ga0081539_100042717 301
194 3300006038 Ga0075365_10271304 Ga0075365_102713041 301
195 3300006048 Ga0075363_100036199 Ga0075363_1000361992 301
196 3300006195 Ga0075366_10080789 Ga0075366_100807892 301
197 3300025295 Ga0209564_1000043 Ga0209564_100004357 301
198 3300025903 Ga0207680_10193895 Ga0207680_101938952 301
199 3300028379 Ga0268266_10410589 Ga0268266_104105891 301
200 3300036712 Ga0316584_0053400 Ga0316584_0053400_375_1283 301
201 3300042001 Ga0439441_006564 Ga0439441_006564_641_1546 301
202 3300042003 Ga0439443_013304 Ga0439443_013304_225_1130 301
203 3300042993 Ga0439440_0008264 Ga0439440_0008264_317_1222 301
204 3300048905 Ga0496102_0014863 Ga0496102_0014863_5057_5962 301
205 3300048906 Ga0496103_0180946 Ga0496103_0180946_311_1216 301
206 3300050509 nmdc:mga0qj67_381361_c1 nmdc:mga0qj67_381361_c1_113_1018 301
207 3300005262 Ga0065165_1002483 Ga0065165_100248310 302
208 3300009098 Ga0105245_10392458 Ga0105245_103924581 302
209 3300025299 Ga0209256_1002636 Ga0209256_10026367 302
210 3300025299 Ga0209256_1006880 Ga0209256_10068802 302
211 3300044694 Ga0466963_0086919 Ga0466963_0086919_43_951 302
212 3300044842 Ga0466957_0337725 Ga0466957_0337725_50_958 302
213 3300005844 Ga0068862_100106958 Ga0068862_1001069582 303
214 3300048915 Ga0496112_0439906 Ga0496112_0439906_105_1019 304
215 3300049742 Ga0501080_0540469 Ga0501080_0540469_34_948 304
216 3300050490 nmdc:mga03n38_127131_c1 nmdc:mga03n38_127131_c1_50_964 304
217 3300050493 nmdc:mga0k408_12539_c1 nmdc:mga0k408_12539_c1_50_964 304
218 3300050494 nmdc:mga06z11_23078_c1 nmdc:mga06z11_23078_c1_1535_2449 304
219 3300050516 nmdc:mga0sz30_85859_c1 nmdc:mga0sz30_85859_c1_211_1125 304
220 3300009545 Ga0105237_10159763 Ga0105237_101597632 305
221 3300025914 Ga0207671_10038975 Ga0207671_100389752 305
222 3300048907 Ga0496104_0004434 Ga0496104_0004434_9513_10430 305
223 3300048911 Ga0496108_0266293 Ga0496108_0266293_444_1361 305
224 3300048912 Ga0496109_0268424 Ga0496109_0268424_203_1120 305
225 3300048915 Ga0496112_0262527 Ga0496112_0262527_339_1256 305
226 3300048916 Ga0496113_0269975 Ga0496113_0269975_49_966 305
227 3300048918 Ga0496115_0060656 Ga0496115_0060656_1183_2100 305
228 3300037471 Ga0395905_0300678 Ga0395905_0300678_188_1111 306
229 iso_pu_bacteria 2508501009 2508544349 306
230 3300005329 Ga0070683_100557411 Ga0070683_1005574111 307
231 3300005458 Ga0070681_10020340 Ga0070681_100203405 307
232 3300005548 Ga0070665_100004886 Ga0070665_1000048862 307
233 3300005564 Ga0070664_100194494 Ga0070664_1001944942 307
234 3300006942 Ga0099824_1029618 Ga0099824_10296182 307
235 3300009545 Ga0105237_10017516 Ga0105237_100175164 307
236 3300009551 Ga0105238_10040536 Ga0105238_100405362 307
237 3300025912 Ga0207707_10019302 Ga0207707_100193022 307
238 3300025921 Ga0207652_10128496 Ga0207652_101284962 307
239 3300025924 Ga0207694_10244911 Ga0207694_102449112 307
240 3300025928 Ga0207700_10232633 Ga0207700_102326331 307
241 3300025944 Ga0207661_10509114 Ga0207661_105091141 307
242 3300027296 Ga0209389_1000089 Ga0209389_100008947 307
243 3300027357 Ga0209589_1000148 Ga0209589_100014841 307
244 3300027361 Ga0209489_100512 Ga0209489_10051242 307
245 3300028379 Ga0268266_10002296 Ga0268266_1000229617 307
246 3300028573 Ga0265334_10047456 Ga0265334_100474562 307
247 3300039438 Ga0436360_0344470 Ga0436360_0344470_1473_2417 307
248 3300045049 Ga0466959_0004820 Ga0466959_0004820_14_937 307
249 3300045049 Ga0466959_0070877 Ga0466959_0070877_821_1744 307
250 3300053153 Ga0500616_0000016 Ga0500616_0000016_68023_68946 307
251 3300053153 Ga0500616_0043724 Ga0500616_0043724_1241_2164 307
252 iso_pu_bacteria 2881364244 2881369345 307
253 iso_pu_bacteria 2906626472 2906633777 307
254 3300003203 JGI25406J46586_10033074 JGI25406J46586_100330742 308
255 3300005530 Ga0070679_100014583 Ga0070679_1000145834 308
256 3300005548 Ga0070665_100000075 Ga0070665_100000075148 308
257 3300005563 Ga0068855_100022407 Ga0068855_1000224075 308
258 3300005985 Ga0081539_10000060 Ga0081539_1000006078 308
259 3300009093 Ga0105240_10009414 Ga0105240_100094142 308
260 3300025913 Ga0207695_10020298 Ga0207695_100202988 308
261 3300025913 Ga0207695_10096676 Ga0207695_100966762 308
262 3300025921 Ga0207652_10023173 Ga0207652_100231737 308
263 3300025949 Ga0207667_10010840 Ga0207667_100108407 308
264 3300028379 Ga0268266_10000103 Ga0268266_1000010387 308
265 3300037418 Ga0395900_0071594 Ga0395900_0071594_1464_2393 308
266 3300038443 Ga0395901_0000583 Ga0395901_0000583_15249_16178 308
267 3300021384 Ga0213876_10004588 Ga0213876_100045885 309
268 3300036401 Ga0373937_0165909 Ga0373937_0165909_845_1774 309
269 3300037853 Ga0436364_0734008 Ga0436364_0734008_1908_2837 309
270 3300039437 Ga0436365_1874128 Ga0436365_1874128_11324_12256 309
271 3300003215 JGI25153J46596_10006799 JGI25153J46596_100067993 310
272 3300025297 Ga0209758_1000364 Ga0209758_100036471 310
273 3300037312 Ga0395899_0051581 Ga0395899_0051581_471_1406 310
274 3300053130 Ga0500642_0004907 Ga0500642_0004907_265_1197 310
275 3300053080 Ga0500635_0021341 Ga0500635_0021341_511_1449 311
276 3300053095 Ga0500640_052574 Ga0500640_052574_618_1556 311
277 3300053111 Ga0500572_000037 Ga0500572_000037_21117_22052 311
278 3300053111 Ga0500572_017072 Ga0500572_017072_593_1531 311
279 3300053121 Ga0500607_043489 Ga0500607_043489_630_1568 311
280 3300053122 Ga0500608_046641 Ga0500608_046641_753_1691 311
281 3300053136 Ga0500559_0003395 Ga0500559_0003395_980_1918 311
282 3300053138 Ga0500564_016514 Ga0500564_016514_1269_2207 311
283 3300053154 Ga0500619_003020 Ga0500619_003020_1231_2169 311
284 3300053177 Ga0500636_0002129 Ga0500636_0002129_5758_6696 311
285 iso_pu_bacteria 2511231028 2511401157 311
286 3300025254 Ga0209148_1016841 Ga0209148_10168412 312
287 3300025261 Ga0209233_1001053 Ga0209233_10010534 312
288 3300044706 Ga0466964_0177203 Ga0466964_0177203_49_987 312
289 3300048921 Ga0496118_0025499 Ga0496118_0025499_1022_1960 312
290 3300048924 Ga0496121_0027812 Ga0496121_0027812_1863_2801 312
291 3300053177 Ga0500636_0014406 Ga0500636_0014406_506_1444 312
292 iso_pu_bacteria 2513237139 2513873480 312
293 iso_pu_bacteria 2824696289 2824703029 312
294 iso_pu_bacteria 2847939898 2847942205 312
295 iso_pu_bacteria 3005506211 3005509113 312
296 3300005262 Ga0065165_1003087 Ga0065165_10030875 313
297 3300025261 Ga0209233_1002120 Ga0209233_10021203 313
298 3300025928 Ga0207700_10308472 Ga0207700_103084722 313
299 3300031235 Ga0265330_10026451 Ga0265330_100264512 313
300 3300039437 Ga0436365_0609863 Ga0436365_0609863_155_1114 313
301 iso_pu_bacteria 2891373044 2891376419 313
302 iso_pu_bacteria 2906643746 2906651350 313
303 iso_pu_bacteria 3003930520 3003932353 313
304 3300027682 Ga0209971_1030481 Ga0209971_10304812 314
305 3300039437 Ga0436365_0611857 Ga0436365_0611857_364_1311 314
306 3300044694 Ga0466963_0040090 Ga0466963_0040090_1965_2912 314
307 3300045049 Ga0466959_0000216 Ga0466959_0000216_21716_22663 314
308 3300045976 Ga0466967_0020032 Ga0466967_0020032_3175_4122 314
309 3300049523 Ga0501300_000445 Ga0501300_000445_4910_5860 314
310 3300048921 Ga0496118_0022715 Ga0496118_0022715_2420_3391 315
311 3300048922 Ga0496119_0053636 Ga0496119_0053636_418_1389 315
312 3300053087 Ga0500643_000063 Ga0500643_000063_113398_114369 315
313 3300053103 Ga0500555_006779 Ga0500555_006779_2011_2982 315
314 3300053130 Ga0500642_0126263 Ga0500642_0126263_78_1049 315
315 3300053139 Ga0500568_0049409 Ga0500568_0049409_552_1523 315
316 iso_pu_bacteria 3005594810 3005595107 315
317 3300005548 Ga0070665_100009652 Ga0070665_1000096527 316
318 3300025297 Ga0209758_1006642 Ga0209758_10066426 316
319 3300028379 Ga0268266_10015895 Ga0268266_100158952 316
320 3300050492 nmdc:mga0yw44_117534_c1 nmdc:mga0yw44_117534_c1_686_1645 316
321 3300053122 Ga0500608_020689 Ga0500608_020689_1941_2894 316
322 3300003187 JGI25151J46595_10051875 JGI25151J46595_100518752 317
323 3300013297 Ga0157378_10026395 Ga0157378_100263955 317
324 3300025294 Ga0209025_1000118 Ga0209025_1000118181 317
325 3300027296 Ga0209389_1000071 Ga0209389_100007150 317
326 3300027361 Ga0209489_101361 Ga0209489_1013612 317
327 3300027363 Ga0209700_100011 Ga0209700_100011249 317
328 3300031852 Ga0307410_10090611 Ga0307410_100906112 317
329 3300031995 Ga0307409_100125251 Ga0307409_1001252512 317
330 3300032005 Ga0307411_10041398 Ga0307411_100413982 317
331 3300044901 Ga0466960_0159497 Ga0466960_0159497_132_1097 317
332 3300048925 Ga0496122_0000604 Ga0496122_0000604_50368_51321 317
333 3300048926 Ga0496123_0001019 Ga0496123_0001019_31419_32372 317
334 3300048928 Ga0496125_0000254 Ga0496125_0000254_102363_103316 317
335 3300048929 Ga0496126_0002653 Ga0496126_0002653_3095_4048 317
336 3300049579 Ga0501043_0050028 Ga0501043_0050028_453_1406 317
337 3300049822 Ga0501035_0080627 Ga0501035_0080627_232_1185 317
338 iso_pu_bacteria 2879083081 2879085960 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01507

PAPS_reduct

Phosphoadenosine phosphosulfate reductase family

72

300

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zun-assembly1.cif.gz_A crystal structure of a gtp-regulated atp sulfurylase heterodimer from pseudomonas syringae 0.9014 13 227
1zun-assembly1.cif.gz_A crystal structure of a gtp-regulated atp sulfurylase heterodimer from pseudomonas syringae 0.8843 13 227
2oq2-assembly1.cif.gz_A crystal structure of yeast paps reductase with pap, a product complex 0.7918 31 298
4bwv-assembly1.cif.gz_B structure of adenosine 5-prime-phosphosulfate reductase apr-b from physcomitrella patens 0.7818 3 298
4bwv-assembly1.cif.gz_B structure of adenosine 5-prime-phosphosulfate reductase apr-b from physcomitrella patens 0.7754 3 298
ID Description Score Start End Superfamily
1zunA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.928 23 227 3.40.50.620
1zunA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9184 23 227 3.40.50.620
af_Q8R123_266_492_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8005 17 224 3.40.50.620
4bwvB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7818 3 298 3.40.50.620
4bwvB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7754 3 298 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A3D3BSU9-F1-model_v4 Sulfate adenylyltransferase small subunit (EC 2.7.7.4) 0.997 24 103 GO:0004781
AF-A0A7C7W5V8-F1-model_v4 Sulfate adenylyltransferase small subunit (EC 2.7.7.4) 0.9956 36 133 GO:0004781
AF-A0A5S3RNS7-F1-model_v4 deleted 0.9955 28 138
AF-A0A4Q3J4F7-F1-model_v4 Sulfate adenylyltransferase small subunit (EC 2.7.7.4) 0.9954 23 107 GO:0004781
AF-A0A6L7M336-F1-model_v4 deleted 0.9898 36 132

Feature Viewer

pLDDT pTM Quality
80.53 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map