F413744
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 338 | 241 | 266 | 303 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2881364244|2881369345 |
| Length | 345 |
| Sequence | AASEVCCRTGLVAMRLGRPFLPQIFPALGWSHRAAKNRDPAPKTRYMLPKHLHRLEAESIEIMRDVVAEFKRPVMLYSIGKDSSVLLHLAIKAFYPAKIPFPLLHVDTTWKFREMISFRDATASRLGLDLIVHVNKDGSARGINPIKSGSALHTQVMKTDALKQALDLHGFDAAFGGARRDEERSRAKERILSFRSAGHVWDPRNQRPELWSLFNTRVREGETMRVFAMSNWTELEVWEYIMIEKIPVVPLYFAKRRPIVHRNGAMIMVDDERLPLNCDETPEMRMIRFRTLGCYPLSGAIESDATTIEDIVAEMQTATVSERQGRLIDTDEAASMEKKKREGYF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 2 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 3 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 4 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 5 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 6 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 7 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 8 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 9 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 10 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 11 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 12 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 13 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 14 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 15 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 16 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 17 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 18 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 19 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 20 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 21 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 22 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 23 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 24 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 25 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 26 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 27 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 28 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 29 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 30 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 31 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 32 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 33 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 34 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 35 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 36 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 37 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 38 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 39 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 40 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 41 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 42 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 43 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 44 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 45 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 46 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 47 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 48 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 49 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 50 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 51 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 52 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 53 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 54 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 55 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 56 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 57 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 58 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 59 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 60 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 61 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 62 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 63 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 64 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 65 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 67 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 68 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 69 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 70 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 71 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 76 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 95 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 96 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 99 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 116 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 117 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 149 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 150 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 151 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 152 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 156 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 157 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 159 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 160 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 161 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 162 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 163 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 165 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 166 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 167 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 168 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 171 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 172 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 173 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 174 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 175 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 176 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 177 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 178 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 179 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 180 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 181 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 182 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 183 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 193 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 194 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 195 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 196 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 199 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 200 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 201 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 202 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 203 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 204 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 205 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 206 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 207 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 208 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 209 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 210 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 211 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 212 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 216 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 217 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 218 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 219 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 220 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 221 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 223 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 224 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 225 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 226 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 227 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 228 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 229 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 230 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 231 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 232 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 233 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 234 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 235 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 236 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 237 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 238 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 239 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 240 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 241 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.7 |
| Metatranscriptomes | 0 |
| Isolates | 21.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.98 |
| Nodule | 13.91 |
| Rhizoplane | 4.44 |
| Rhizosphere | 44.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 20.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10051875 | 3300003187 | Bacteria | 1384 |
| 2 | JGI25406J46586_10033074 | 3300003203 | Bacteria | 1914 |
| 3 | JGI25153J46596_10006799 | 3300003215 | Bacteria | 5729 |
| 4 | Ga0055526_1003875 | 3300003771 | Bacteria | 9276 |
| 5 | Ga0065165_1002483 | 3300005262 | Bacteria | 15505 |
| 6 | Ga0065165_1003087 | 3300005262 | Bacteria | 12410 |
| 7 | Ga0065715_10208132 | 3300005293 | Bacteria | 1327 |
| 8 | Ga0065707_10082296 | 3300005295 | Bacteria | 17280 |
| 9 | Ga0070683_100557411 | 3300005329 | Bacteria | 1096 |
| 10 | Ga0070666_10035241 | 3300005335 | Bacteria | 3319 |
| 11 | Ga0070660_100007218 | 3300005339 | Bacteria | 7731 |
| 12 | Ga0070671_100000668 | 3300005355 | Bacteria | 24571 |
| 13 | Ga0070671_100201788 | 3300005355 | Bacteria | 1687 |
| 14 | Ga0070688_100142081 | 3300005365 | Bacteria | 1632 |
| 15 | Ga0070667_100013238 | 3300005367 | Bacteria | 6816 |
| 16 | Ga0070681_10020340 | 3300005458 | Bacteria | 6652 |
| 17 | Ga0070679_100014583 | 3300005530 | Bacteria | 7551 |
| 18 | Ga0068853_100217988 | 3300005539 | Bacteria | 1742 |
| 19 | Ga0070693_100293675 | 3300005547 | Bacteria | 1093 |
| 20 | Ga0070665_100000075 | 3300005548 | Bacteria | 189496 |
| 21 | Ga0070665_100004886 | 3300005548 | Bacteria | 13909 |
| 22 | Ga0070665_100009652 | 3300005548 | Bacteria | 9759 |
| 23 | Ga0070665_100024692 | 3300005548 | Bacteria | 6056 |
| 24 | Ga0070665_100029387 | 3300005548 | Bacteria | 5532 |
| 25 | Ga0070665_100034225 | 3300005548 | Bacteria | 5109 |
| 26 | Ga0070665_100082520 | 3300005548 | Bacteria | 3220 |
| 27 | Ga0070665_100164686 | 3300005548 | Bacteria | 2219 |
| 28 | Ga0070665_100354016 | 3300005548 | Bacteria | 1474 |
| 29 | Ga0070665_100595298 | 3300005548 | Bacteria | 1119 |
| 30 | Ga0068855_100022407 | 3300005563 | Bacteria | 7571 |
| 31 | Ga0070664_100194494 | 3300005564 | Bacteria | 1808 |
| 32 | Ga0068856_100390868 | 3300005614 | Bacteria | 1411 |
| 33 | Ga0068859_100000092 | 3300005617 | Bacteria | 82442 |
| 34 | Ga0068864_100375299 | 3300005618 | Bacteria | 1346 |
| 35 | Ga0068861_100592490 | 3300005719 | Bacteria | 1016 |
| 36 | Ga0068863_100009047 | 3300005841 | Bacteria | 9723 |
| 37 | Ga0068863_100473843 | 3300005841 | Bacteria | 1230 |
| 38 | Ga0068863_100534594 | 3300005841 | Bacteria | 1156 |
| 39 | Ga0068858_100007426 | 3300005842 | Bacteria | 10601 |
| 40 | Ga0068860_100001811 | 3300005843 | Bacteria | 22738 |
| 41 | Ga0068860_100004269 | 3300005843 | Bacteria | 14632 |
| 42 | Ga0068860_100024854 | 3300005843 | Bacteria | 5783 |
| 43 | Ga0068862_100106958 | 3300005844 | Bacteria | 2453 |
| 44 | Ga0081455_10179148 | 3300005937 | Bacteria | 1607 |
| 45 | Ga0081539_10000060 | 3300005985 | Bacteria | 252799 |
| 46 | Ga0081539_10004271 | 3300005985 | Bacteria | 16038 |
| 47 | Ga0075365_10106803 | 3300006038 | Bacteria | 1921 |
| 48 | Ga0075365_10271304 | 3300006038 | Bacteria | 1193 |
| 49 | Ga0075363_100036199 | 3300006048 | Bacteria | 2588 |
| 50 | Ga0075362_10025019 | 3300006177 | Bacteria | 2537 |
| 51 | Ga0075367_10019158 | 3300006178 | Bacteria | 3791 |
| 52 | Ga0075369_10001895 | 3300006186 | Bacteria | 7330 |
| 53 | Ga0075366_10080789 | 3300006195 | Bacteria | 1941 |
| 54 | Ga0075370_10010336 | 3300006353 | Bacteria | 4877 |
| 55 | Ga0097620_100000092 | 3300006931 | Bacteria | 82442 |
| 56 | Ga0099824_1023042 | 3300006942 | Bacteria | 3956 |
| 57 | Ga0099824_1029618 | 3300006942 | Bacteria | 2305 |
| 58 | Ga0105240_10009414 | 3300009093 | Bacteria | 13829 |
| 59 | Ga0105240_10084859 | 3300009093 | Bacteria | 3882 |
| 60 | Ga0105245_10392458 | 3300009098 | Bacteria | 1385 |
| 61 | Ga0105247_10000482 | 3300009101 | Bacteria | 33256 |
| 62 | Ga0105241_10223975 | 3300009174 | Bacteria | 1582 |
| 63 | Ga0105248_10005260 | 3300009177 | Bacteria | 14242 |
| 64 | Ga0105237_10017516 | 3300009545 | Bacteria | 7424 |
| 65 | Ga0105237_10159763 | 3300009545 | Bacteria | 2252 |
| 66 | Ga0105238_10040536 | 3300009551 | Bacteria | 4718 |
| 67 | Ga0105238_10194511 | 3300009551 | Bacteria | 2004 |
| 68 | Ga0105249_10092319 | 3300009553 | Bacteria | 2834 |
| 69 | Ga0105249_10363461 | 3300009553 | Bacteria | 1469 |
| 70 | Ga0157378_10026395 | 3300013297 | Bacteria | 5120 |
| 71 | Ga0163163_10274287 | 3300014325 | Bacteria | 1738 |
| 72 | Ga0157379_10007365 | 3300014968 | Bacteria | 9527 |
| 73 | Ga0157379_10080505 | 3300014968 | Bacteria | 2918 |
| 74 | Ga0157379_10105918 | 3300014968 | Bacteria | 2524 |
| 75 | Ga0157376_10093070 | 3300014969 | Bacteria | 2616 |
| 76 | Ga0157376_10604081 | 3300014969 | Bacteria | 1092 |
| 77 | Ga0214542_1000026 | 3300021321 | Bacteria | 182145 |
| 78 | Ga0214545_1000015 | 3300021324 | Bacteria | 182143 |
| 79 | Ga0214543_1000036 | 3300021327 | Bacteria | 182143 |
| 80 | Ga0213876_10004588 | 3300021384 | Bacteria | 7703 |
| 81 | Ga0209148_1016841 | 3300025254 | Bacteria | 1251 |
| 82 | Ga0209233_1001053 | 3300025261 | Bacteria | 11529 |
| 83 | Ga0209233_1002120 | 3300025261 | Bacteria | 7476 |
| 84 | Ga0209025_1000118 | 3300025294 | Bacteria | 214009 |
| 85 | Ga0209564_1000043 | 3300025295 | Bacteria | 388153 |
| 86 | Ga0209758_1000364 | 3300025297 | Bacteria | 80651 |
| 87 | Ga0209758_1006642 | 3300025297 | Bacteria | 8186 |
| 88 | Ga0209256_1002636 | 3300025299 | Bacteria | 14129 |
| 89 | Ga0209256_1006880 | 3300025299 | Bacteria | 5833 |
| 90 | Ga0209256_1030373 | 3300025299 | Bacteria | 1493 |
| 91 | Ga0207710_10000186 | 3300025900 | Bacteria | 60552 |
| 92 | Ga0207710_10114532 | 3300025900 | Bacteria | 1283 |
| 93 | Ga0207680_10193895 | 3300025903 | Bacteria | 1381 |
| 94 | Ga0207647_10167581 | 3300025904 | Bacteria | 1280 |
| 95 | Ga0207707_10019302 | 3300025912 | Bacteria | 5950 |
| 96 | Ga0207695_10020298 | 3300025913 | Bacteria | 7615 |
| 97 | Ga0207695_10096676 | 3300025913 | Bacteria | 2955 |
| 98 | Ga0207671_10038975 | 3300025914 | Bacteria | 3520 |
| 99 | Ga0207663_10123212 | 3300025916 | Bacteria | 1779 |
| 100 | Ga0207657_10000434 | 3300025919 | Bacteria | 44542 |
| 101 | Ga0207652_10023173 | 3300025921 | Bacteria | 5141 |
| 102 | Ga0207652_10128496 | 3300025921 | Bacteria | 2259 |
| 103 | Ga0207694_10163183 | 3300025924 | Bacteria | 1801 |
| 104 | Ga0207694_10244911 | 3300025924 | Bacteria | 1466 |
| 105 | Ga0207694_10485821 | 3300025924 | Bacteria | 1033 |
| 106 | Ga0207700_10232633 | 3300025928 | Bacteria | 1568 |
| 107 | Ga0207700_10308472 | 3300025928 | Bacteria | 1368 |
| 108 | Ga0207644_10002846 | 3300025931 | Bacteria | 11163 |
| 109 | Ga0207661_10509114 | 3300025944 | Bacteria | 1100 |
| 110 | Ga0207667_10010840 | 3300025949 | Bacteria | 10631 |
| 111 | Ga0207712_10086250 | 3300025961 | Bacteria | 2299 |
| 112 | Ga0207658_10011432 | 3300025986 | Bacteria | 6040 |
| 113 | Ga0207703_10000318 | 3300026035 | Bacteria | 52249 |
| 114 | Ga0207703_10001160 | 3300026035 | Bacteria | 24856 |
| 115 | Ga0207639_10057902 | 3300026041 | Bacteria | 2978 |
| 116 | Ga0207678_10008627 | 3300026067 | Bacteria | 8983 |
| 117 | Ga0207702_10207313 | 3300026078 | Bacteria | 1820 |
| 118 | Ga0207641_10083362 | 3300026088 | Bacteria | 2780 |
| 119 | Ga0207674_10493044 | 3300026116 | Bacteria | 1184 |
| 120 | Ga0207675_100230900 | 3300026118 | Bacteria | 1785 |
| 121 | Ga0209389_1000071 | 3300027296 | Bacteria | 97411 |
| 122 | Ga0209389_1000089 | 3300027296 | Bacteria | 83505 |
| 123 | Ga0209389_1000138 | 3300027296 | Bacteria | 63273 |
| 124 | Ga0209589_1000004 | 3300027357 | Bacteria | 578529 |
| 125 | Ga0209589_1000148 | 3300027357 | Bacteria | 77222 |
| 126 | Ga0209489_100004 | 3300027361 | Bacteria | 578529 |
| 127 | Ga0209489_100512 | 3300027361 | Bacteria | 72878 |
| 128 | Ga0209489_101361 | 3300027361 | Bacteria | 50193 |
| 129 | Ga0209489_110008 | 3300027361 | Bacteria | 11158 |
| 130 | Ga0209489_110059 | 3300027361 | Bacteria | 11051 |
| 131 | Ga0209700_100004 | 3300027363 | Bacteria | 578529 |
| 132 | Ga0209700_100011 | 3300027363 | Bacteria | 362159 |
| 133 | Ga0209700_100026 | 3300027363 | Bacteria | 224498 |
| 134 | Ga0209971_1030481 | 3300027682 | Bacteria | 1291 |
| 135 | Ga0268266_10000103 | 3300028379 | Bacteria | 179736 |
| 136 | Ga0268266_10002296 | 3300028379 | Bacteria | 20741 |
| 137 | Ga0268266_10007886 | 3300028379 | Bacteria | 9535 |
| 138 | Ga0268266_10008007 | 3300028379 | Bacteria | 9450 |
| 139 | Ga0268266_10015895 | 3300028379 | Bacteria | 6441 |
| 140 | Ga0268266_10026432 | 3300028379 | Bacteria | 4938 |
| 141 | Ga0268266_10354079 | 3300028379 | Bacteria | 1380 |
| 142 | Ga0268266_10410589 | 3300028379 | Bacteria | 1282 |
| 143 | Ga0268264_10001047 | 3300028381 | Bacteria | 27587 |
| 144 | Ga0268264_10004984 | 3300028381 | Bacteria | 11243 |
| 145 | Ga0268264_10007047 | 3300028381 | Bacteria | 9427 |
| 146 | Ga0265334_10047456 | 3300028573 | Bacteria | 1657 |
| 147 | Ga0307511_10001542 | 3300030521 | Bacteria | 24384 |
| 148 | Ga0265330_10026451 | 3300031235 | Bacteria | 2624 |
| 149 | Ga0307508_10208314 | 3300031616 | Bacteria | 1556 |
| 150 | Ga0307410_10008052 | 3300031852 | Bacteria | 5819 |
| 151 | Ga0307410_10090611 | 3300031852 | Bacteria | 2169 |
| 152 | Ga0307409_100125251 | 3300031995 | Bacteria | 2184 |
| 153 | Ga0307411_10041398 | 3300032005 | Bacteria | 2931 |
| 154 | Ga0307411_10111033 | 3300032005 | Bacteria | 1962 |
| 155 | Ga0307510_10000015 | 3300033180 | Bacteria | 258937 |
| 156 | Ga0373937_0165909 | 3300036401 | Bacteria | 2071 |
| 157 | Ga0316584_0053400 | 3300036712 | Bacteria | 3024 |
| 158 | Ga0395899_0051581 | 3300037312 | Bacteria | 3053 |
| 159 | Ga0395900_0071594 | 3300037418 | Bacteria | 3564 |
| 160 | Ga0395905_0300678 | 3300037471 | Bacteria | 1492 |
| 161 | Ga0436364_0734008 | 3300037853 | Bacteria | 2970 |
| 162 | Ga0395901_0000583 | 3300038443 | Bacteria | 42413 |
| 163 | Ga0436365_0609863 | 3300039437 | Bacteria | 1346 |
| 164 | Ga0436365_0611857 | 3300039437 | Bacteria | 5251 |
| 165 | Ga0436365_1874128 | 3300039437 | Bacteria | 23935 |
| 166 | Ga0436360_0344470 | 3300039438 | Bacteria | 3084 |
| 167 | Ga0436360_1029045 | 3300039438 | Bacteria | 1483 |
| 168 | Ga0439441_006564 | 3300042001 | Bacteria | 1851 |
| 169 | Ga0439443_013304 | 3300042003 | Bacteria | 1228 |
| 170 | Ga0439440_0008264 | 3300042993 | Bacteria | 2132 |
| 171 | Ga0466969_0024766 | 3300044656 | Bacteria | 3087 |
| 172 | Ga0466972_0088815 | 3300044658 | Bacteria | 1467 |
| 173 | Ga0466963_0040090 | 3300044694 | Bacteria | 3069 |
| 174 | Ga0466963_0086919 | 3300044694 | Bacteria | 2125 |
| 175 | Ga0466964_0177203 | 3300044706 | Bacteria | 1008 |
| 176 | Ga0466957_0337725 | 3300044842 | Bacteria | 1020 |
| 177 | Ga0466960_0159497 | 3300044901 | Bacteria | 1210 |
| 178 | Ga0466959_0000216 | 3300045049 | Bacteria | 37434 |
| 179 | Ga0466959_0004820 | 3300045049 | Bacteria | 9112 |
| 180 | Ga0466959_0038731 | 3300045049 | Bacteria | 3522 |
| 181 | Ga0466959_0070877 | 3300045049 | Bacteria | 2525 |
| 182 | Ga0466967_0020032 | 3300045976 | Bacteria | 5395 |
| 183 | Ga0495606_0082324 | 3300046507 | Bacteria | 1998 |
| 184 | Ga0495606_0086772 | 3300046507 | Bacteria | 1933 |
| 185 | Ga0495628_0058299 | 3300046516 | Bacteria | 3035 |
| 186 | Ga0495630_0414199 | 3300046517 | Bacteria | 1033 |
| 187 | Ga0495632_0086296 | 3300046519 | Bacteria | 1493 |
| 188 | Ga0495587_0202205 | 3300046536 | Bacteria | 1123 |
| 189 | Ga0495623_0203515 | 3300046679 | Bacteria | 1137 |
| 190 | Ga0495600_0109899 | 3300046809 | Bacteria | 1795 |
| 191 | Ga0495604_0017277 | 3300047317 | Bacteria | 5774 |
| 192 | Ga0495680_0126966 | 3300047322 | Bacteria | 1877 |
| 193 | Ga0496102_0014863 | 3300048905 | Bacteria | 6772 |
| 194 | Ga0496102_0023703 | 3300048905 | Bacteria | 5454 |
| 195 | Ga0496103_0180946 | 3300048906 | Bacteria | 1355 |
| 196 | Ga0496104_0004434 | 3300048907 | Bacteria | 12220 |
| 197 | Ga0496104_0019582 | 3300048907 | Bacteria | 6196 |
| 198 | Ga0496105_0020993 | 3300048908 | Bacteria | 5282 |
| 199 | Ga0496105_0180837 | 3300048908 | Bacteria | 1727 |
| 200 | Ga0496108_0266293 | 3300048911 | Bacteria | 1491 |
| 201 | Ga0496108_0285911 | 3300048911 | Bacteria | 1436 |
| 202 | Ga0496109_0268424 | 3300048912 | Bacteria | 1607 |
| 203 | Ga0496112_0262527 | 3300048915 | Bacteria | 1676 |
| 204 | Ga0496112_0351516 | 3300048915 | Bacteria | 1416 |
| 205 | Ga0496112_0439906 | 3300048915 | Bacteria | 1242 |
| 206 | Ga0496113_0269975 | 3300048916 | Bacteria | 1359 |
| 207 | Ga0496115_0060656 | 3300048918 | Bacteria | 3048 |
| 208 | Ga0496117_0000208 | 3300048920 | Bacteria | 113931 |
| 209 | Ga0496118_0000005 | 3300048921 | Bacteria | 697350 |
| 210 | Ga0496118_0022715 | 3300048921 | Bacteria | 5472 |
| 211 | Ga0496118_0025499 | 3300048921 | Bacteria | 5066 |
| 212 | Ga0496118_0277950 | 3300048921 | Bacteria | 934 |
| 213 | Ga0496119_0003655 | 3300048922 | Bacteria | 15792 |
| 214 | Ga0496119_0053636 | 3300048922 | Bacteria | 2461 |
| 215 | Ga0496120_0030683 | 3300048923 | Bacteria | 3263 |
| 216 | Ga0496121_0001978 | 3300048924 | Bacteria | 32561 |
| 217 | Ga0496121_0027812 | 3300048924 | Bacteria | 5281 |
| 218 | Ga0496121_0035492 | 3300048924 | Bacteria | 4468 |
| 219 | Ga0496121_0083673 | 3300048924 | Bacteria | 2518 |
| 220 | Ga0496122_0000604 | 3300048925 | Bacteria | 73844 |
| 221 | Ga0496123_0001019 | 3300048926 | Bacteria | 42794 |
| 222 | Ga0496124_0034793 | 3300048927 | Bacteria | 4414 |
| 223 | Ga0496125_0000254 | 3300048928 | Bacteria | 109882 |
| 224 | Ga0496125_0003265 | 3300048928 | Bacteria | 19952 |
| 225 | Ga0496125_0067070 | 3300048928 | Bacteria | 2830 |
| 226 | Ga0496125_0094259 | 3300048928 | Bacteria | 2231 |
| 227 | Ga0496126_0002653 | 3300048929 | Bacteria | 23704 |
| 228 | Ga0496126_0037842 | 3300048929 | Bacteria | 4495 |
| 229 | Ga0496126_0074554 | 3300048929 | Bacteria | 3013 |
| 230 | Ga0501300_000445 | 3300049523 | Bacteria | 6290 |
| 231 | Ga0501043_0050028 | 3300049579 | Bacteria | 3285 |
| 232 | Ga0501080_0540469 | 3300049742 | Bacteria | 1039 |
| 233 | Ga0501035_0080627 | 3300049822 | Bacteria | 2873 |
| 234 | nmdc:mga03683_6684_c1 | 3300050489 | Bacteria | 3961 |
| 235 | nmdc:mga03n38_127131_c1 | 3300050490 | Bacteria | 1259 |
| 236 | nmdc:mga0yw44_117534_c1 | 3300050492 | Bacteria | 1710 |
| 237 | nmdc:mga0k408_12539_c1 | 3300050493 | Bacteria | 4635 |
| 238 | nmdc:mga06z11_1813_c1 | 3300050494 | Bacteria | 8045 |
| 239 | nmdc:mga06z11_23078_c1 | 3300050494 | Bacteria | 2917 |
| 240 | nmdc:mga07m45_1996_c4 | 3300050496 | Bacteria | 5391 |
| 241 | nmdc:mga0qj67_381361_c1 | 3300050509 | Bacteria | 1138 |
| 242 | nmdc:mga0sz30_204_c1 | 3300050516 | Bacteria | 22141 |
| 243 | nmdc:mga0sz30_5801_c1 | 3300050516 | Bacteria | 4548 |
| 244 | nmdc:mga0sz30_85859_c1 | 3300050516 | Bacteria | 1366 |
| 245 | Ga0500635_0021341 | 3300053080 | Bacteria | 1994 |
| 246 | Ga0500643_000063 | 3300053087 | Bacteria | 122135 |
| 247 | Ga0500651_0081117 | 3300053093 | Bacteria | 2009 |
| 248 | Ga0500640_052574 | 3300053095 | Bacteria | 1779 |
| 249 | Ga0500555_006779 | 3300053103 | Bacteria | 3255 |
| 250 | Ga0500572_000037 | 3300053111 | Bacteria | 42272 |
| 251 | Ga0500572_017072 | 3300053111 | Bacteria | 1860 |
| 252 | Ga0500607_043489 | 3300053121 | Bacteria | 2420 |
| 253 | Ga0500608_020689 | 3300053122 | Bacteria | 3030 |
| 254 | Ga0500608_046641 | 3300053122 | Bacteria | 2082 |
| 255 | Ga0500642_0004907 | 3300053130 | Bacteria | 4249 |
| 256 | Ga0500642_0126263 | 3300053130 | Bacteria | 1198 |
| 257 | Ga0500559_0003395 | 3300053136 | Bacteria | 7850 |
| 258 | Ga0500564_016514 | 3300053138 | Bacteria | 3346 |
| 259 | Ga0500568_0049409 | 3300053139 | Bacteria | 1660 |
| 260 | Ga0500616_0000016 | 3300053153 | Bacteria | 627087 |
| 261 | Ga0500616_0043724 | 3300053153 | Bacteria | 2393 |
| 262 | Ga0500619_003020 | 3300053154 | Bacteria | 3364 |
| 263 | Ga0500636_0002129 | 3300053177 | Bacteria | 10922 |
| 264 | Ga0500636_0014406 | 3300053177 | Bacteria | 4651 |
| 265 | Ga0500637_0017366 | 3300053178 | Bacteria | 3851 |
| 266 | Ga0466962_0112942 | 3300061719 | Bacteria | 1308 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005339 | Ga0070660_100007218 | Ga0070660_1000072184 | 266 |
| 2 | 3300025919 | Ga0207657_10000434 | Ga0207657_100004344 | 266 |
| 3 | iso_pu_bacteria | 2511231028 | 2511396756 | 279 |
| 4 | iso_pu_bacteria | 2617270741 | 2617379638 | 279 |
| 5 | iso_pu_bacteria | 2824746037 | 2824750956 | 279 |
| 6 | iso_pu_bacteria | 2857509624 | 2857510030 | 279 |
| 7 | iso_pu_bacteria | 2876761206 | 2876769684 | 279 |
| 8 | 3300025900 | Ga0207710_10114532 | Ga0207710_101145322 | 282 |
| 9 | 3300025299 | Ga0209256_1030373 | Ga0209256_10303731 | 283 |
| 10 | 3300046517 | Ga0495630_0414199 | Ga0495630_0414199_163_1014 | 283 |
| 11 | 3300048908 | Ga0496105_0020993 | Ga0496105_0020993_975_1826 | 283 |
| 12 | 3300048921 | Ga0496118_0277950 | Ga0496118_0277950_14_865 | 283 |
| 13 | 3300061719 | Ga0466962_0112942 | Ga0466962_0112942_25_876 | 283 |
| 14 | 3300048929 | Ga0496126_0037842 | Ga0496126_0037842_1998_2894 | 285 |
| 15 | 3300025916 | Ga0207663_10123212 | Ga0207663_101232122 | 289 |
| 16 | 3300014969 | Ga0157376_10093070 | Ga0157376_100930701 | 292 |
| 17 | 3300014968 | Ga0157379_10080505 | Ga0157379_100805054 | 294 |
| 18 | 3300044656 | Ga0466969_0024766 | Ga0466969_0024766_1211_2095 | 294 |
| 19 | 3300045049 | Ga0466959_0038731 | Ga0466959_0038731_2155_3039 | 294 |
| 20 | iso_pu_bacteria | 2513237096 | 2513659706 | 295 |
| 21 | iso_pu_bacteria | 2513237145 | 2513921774 | 295 |
| 22 | iso_pu_bacteria | 2513237161 | 2514015884 | 295 |
| 23 | iso_pu_bacteria | 2524023228 | 2524541685 | 295 |
| 24 | iso_pu_bacteria | 2617270735 | 2617353401 | 295 |
| 25 | iso_pu_bacteria | 2824600985 | 2824601098 | 295 |
| 26 | iso_pu_bacteria | 2824617872 | 2824618320 | 295 |
| 27 | iso_pu_bacteria | 2824626560 | 2824626971 | 295 |
| 28 | iso_pu_bacteria | 2824635225 | 2824635359 | 295 |
| 29 | iso_pu_bacteria | 2824644064 | 2824644198 | 295 |
| 30 | iso_pu_bacteria | 2824653114 | 2824654675 | 295 |
| 31 | iso_pu_bacteria | 2824671348 | 2824671368 | 295 |
| 32 | iso_pu_bacteria | 2824687955 | 2824688156 | 295 |
| 33 | iso_pu_bacteria | 2824696289 | 2824696883 | 295 |
| 34 | iso_pu_bacteria | 2824704595 | 2824704796 | 295 |
| 35 | iso_pu_bacteria | 2824714736 | 2824714870 | 295 |
| 36 | iso_pu_bacteria | 2824723954 | 2824724066 | 295 |
| 37 | iso_pu_bacteria | 2824753945 | 2824754800 | 295 |
| 38 | iso_pu_bacteria | 2824763712 | 2824764551 | 295 |
| 39 | iso_pu_bacteria | 2824773399 | 2824779930 | 295 |
| 40 | iso_pu_bacteria | 2838122688 | 2838130855 | 295 |
| 41 | iso_pu_bacteria | 2841949485 | 2841955284 | 295 |
| 42 | iso_pu_bacteria | 2841957949 | 2841963819 | 295 |
| 43 | iso_pu_bacteria | 2841966195 | 2841974143 | 295 |
| 44 | iso_pu_bacteria | 2841974524 | 2841976722 | 295 |
| 45 | iso_pu_bacteria | 2841983080 | 2841986144 | 295 |
| 46 | iso_pu_bacteria | 2847930680 | 2847933487 | 295 |
| 47 | iso_pu_bacteria | 2874604998 | 2874605751 | 295 |
| 48 | iso_pu_bacteria | 2874612657 | 2874613714 | 295 |
| 49 | iso_pu_bacteria | 2874620515 | 2874622127 | 295 |
| 50 | iso_pu_bacteria | 2879083081 | 2879088864 | 295 |
| 51 | iso_pu_bacteria | 2881665667 | 2881666821 | 295 |
| 52 | iso_pu_bacteria | 2885366525 | 2885370843 | 295 |
| 53 | iso_pu_bacteria | 2903748898 | 2903752380 | 295 |
| 54 | iso_pu_bacteria | 2904666416 | 2904672459 | 295 |
| 55 | iso_pu_bacteria | 2904690495 | 2904693599 | 295 |
| 56 | iso_pu_bacteria | 2904711408 | 2904714006 | 295 |
| 57 | iso_pu_bacteria | 2906643746 | 2906644849 | 295 |
| 58 | iso_pu_bacteria | 2906660503 | 2906664641 | 295 |
| 59 | iso_pu_bacteria | 2908739725 | 2908740141 | 295 |
| 60 | iso_pu_bacteria | 2908756301 | 2908758564 | 295 |
| 61 | iso_pu_bacteria | 2908775508 | 2908777872 | 295 |
| 62 | iso_pu_bacteria | 2922393267 | 2922398828 | 295 |
| 63 | iso_pu_bacteria | 2935630451 | 2935637670 | 295 |
| 64 | iso_pu_bacteria | 2941507105 | 2941514229 | 295 |
| 65 | iso_pu_bacteria | 2941515067 | 2941522187 | 295 |
| 66 | iso_pu_bacteria | 2941523033 | 2941529999 | 295 |
| 67 | iso_pu_bacteria | 2941531003 | 2941535187 | 295 |
| 68 | iso_pu_bacteria | 3005483717 | 3005490700 | 295 |
| 69 | iso_pu_bacteria | 8006933436 | 8006934219 | 295 |
| 70 | iso_pu_bacteria | 8006973647 | 8006974200 | 295 |
| 71 | 3300006038 | Ga0075365_10106803 | Ga0075365_101068032 | 296 |
| 72 | 3300005293 | Ga0065715_10208132 | Ga0065715_102081321 | 297 |
| 73 | iso_pu_bacteria | 2824600985 | 2824605287 | 297 |
| 74 | iso_pu_bacteria | 2885366525 | 2885367092 | 297 |
| 75 | 3300031852 | Ga0307410_10008052 | Ga0307410_100080523 | 298 |
| 76 | 3300032005 | Ga0307411_10111033 | Ga0307411_101110332 | 298 |
| 77 | iso_pu_bacteria | 2824653114 | 2824656932 | 298 |
| 78 | 3300005365 | Ga0070688_100142081 | Ga0070688_1001420811 | 299 |
| 79 | 3300006942 | Ga0099824_1023042 | Ga0099824_10230422 | 299 |
| 80 | 3300021321 | Ga0214542_1000026 | Ga0214542_1000026152 | 299 |
| 81 | 3300021324 | Ga0214545_1000015 | Ga0214545_1000015152 | 299 |
| 82 | 3300021327 | Ga0214543_1000036 | Ga0214543_1000036152 | 299 |
| 83 | 3300027296 | Ga0209389_1000138 | Ga0209389_100013848 | 299 |
| 84 | 3300027357 | Ga0209589_1000004 | Ga0209589_1000004321 | 299 |
| 85 | 3300027361 | Ga0209489_100004 | Ga0209489_100004321 | 299 |
| 86 | 3300027361 | Ga0209489_110008 | Ga0209489_1100088 | 299 |
| 87 | 3300027361 | Ga0209489_110059 | Ga0209489_1100597 | 299 |
| 88 | 3300027363 | Ga0209700_100004 | Ga0209700_100004321 | 299 |
| 89 | 3300027363 | Ga0209700_100026 | Ga0209700_100026210 | 299 |
| 90 | 3300044658 | Ga0466972_0088815 | Ga0466972_0088815_310_1209 | 299 |
| 91 | 3300046507 | Ga0495606_0082324 | Ga0495606_0082324_504_1403 | 299 |
| 92 | 3300046516 | Ga0495628_0058299 | Ga0495628_0058299_1884_2783 | 299 |
| 93 | 3300046536 | Ga0495587_0202205 | Ga0495587_0202205_23_922 | 299 |
| 94 | 3300046679 | Ga0495623_0203515 | Ga0495623_0203515_105_1004 | 299 |
| 95 | 3300046809 | Ga0495600_0109899 | Ga0495600_0109899_864_1763 | 299 |
| 96 | 3300047317 | Ga0495604_0017277 | Ga0495604_0017277_1341_2240 | 299 |
| 97 | 3300047322 | Ga0495680_0126966 | Ga0495680_0126966_825_1724 | 299 |
| 98 | 3300048907 | Ga0496104_0019582 | Ga0496104_0019582_2014_2913 | 299 |
| 99 | 3300048908 | Ga0496105_0180837 | Ga0496105_0180837_759_1658 | 299 |
| 100 | 3300050516 | nmdc:mga0sz30_5801_c1 | nmdc:mga0sz30_5801_c1_739_1638 | 299 |
| 101 | 3300005295 | Ga0065707_10082296 | Ga0065707_100822964 | 300 |
| 102 | 3300005335 | Ga0070666_10035241 | Ga0070666_100352413 | 300 |
| 103 | 3300005355 | Ga0070671_100000668 | Ga0070671_1000006683 | 300 |
| 104 | 3300005367 | Ga0070667_100013238 | Ga0070667_1000132387 | 300 |
| 105 | 3300005539 | Ga0068853_100217988 | Ga0068853_1002179882 | 300 |
| 106 | 3300005547 | Ga0070693_100293675 | Ga0070693_1002936751 | 300 |
| 107 | 3300005548 | Ga0070665_100024692 | Ga0070665_1000246924 | 300 |
| 108 | 3300005548 | Ga0070665_100029387 | Ga0070665_1000293876 | 300 |
| 109 | 3300005548 | Ga0070665_100034225 | Ga0070665_1000342254 | 300 |
| 110 | 3300005548 | Ga0070665_100082520 | Ga0070665_1000825202 | 300 |
| 111 | 3300005548 | Ga0070665_100164686 | Ga0070665_1001646863 | 300 |
| 112 | 3300005548 | Ga0070665_100354016 | Ga0070665_1003540162 | 300 |
| 113 | 3300005614 | Ga0068856_100390868 | Ga0068856_1003908682 | 300 |
| 114 | 3300005617 | Ga0068859_100000092 | Ga0068859_10000009236 | 300 |
| 115 | 3300005618 | Ga0068864_100375299 | Ga0068864_1003752992 | 300 |
| 116 | 3300005719 | Ga0068861_100592490 | Ga0068861_1005924901 | 300 |
| 117 | 3300005841 | Ga0068863_100009047 | Ga0068863_1000090474 | 300 |
| 118 | 3300005841 | Ga0068863_100473843 | Ga0068863_1004738432 | 300 |
| 119 | 3300005841 | Ga0068863_100534594 | Ga0068863_1005345942 | 300 |
| 120 | 3300005842 | Ga0068858_100007426 | Ga0068858_1000074265 | 300 |
| 121 | 3300005843 | Ga0068860_100001811 | Ga0068860_1000018112 | 300 |
| 122 | 3300005843 | Ga0068860_100004269 | Ga0068860_1000042692 | 300 |
| 123 | 3300005843 | Ga0068860_100024854 | Ga0068860_1000248543 | 300 |
| 124 | 3300005937 | Ga0081455_10179148 | Ga0081455_101791481 | 300 |
| 125 | 3300006177 | Ga0075362_10025019 | Ga0075362_100250192 | 300 |
| 126 | 3300006178 | Ga0075367_10019158 | Ga0075367_100191582 | 300 |
| 127 | 3300006186 | Ga0075369_10001895 | Ga0075369_100018953 | 300 |
| 128 | 3300006353 | Ga0075370_10010336 | Ga0075370_100103362 | 300 |
| 129 | 3300006931 | Ga0097620_100000092 | Ga0097620_10000009236 | 300 |
| 130 | 3300009093 | Ga0105240_10084859 | Ga0105240_100848595 | 300 |
| 131 | 3300009101 | Ga0105247_10000482 | Ga0105247_1000048211 | 300 |
| 132 | 3300009174 | Ga0105241_10223975 | Ga0105241_102239751 | 300 |
| 133 | 3300009177 | Ga0105248_10005260 | Ga0105248_100052607 | 300 |
| 134 | 3300009551 | Ga0105238_10194511 | Ga0105238_101945112 | 300 |
| 135 | 3300009553 | Ga0105249_10092319 | Ga0105249_100923192 | 300 |
| 136 | 3300009553 | Ga0105249_10363461 | Ga0105249_103634612 | 300 |
| 137 | 3300014325 | Ga0163163_10274287 | Ga0163163_102742872 | 300 |
| 138 | 3300014968 | Ga0157379_10007365 | Ga0157379_100073657 | 300 |
| 139 | 3300014968 | Ga0157379_10105918 | Ga0157379_101059183 | 300 |
| 140 | 3300014969 | Ga0157376_10604081 | Ga0157376_106040812 | 300 |
| 141 | 3300025900 | Ga0207710_10000186 | Ga0207710_100001864 | 300 |
| 142 | 3300025904 | Ga0207647_10167581 | Ga0207647_101675812 | 300 |
| 143 | 3300025924 | Ga0207694_10163183 | Ga0207694_101631832 | 300 |
| 144 | 3300025924 | Ga0207694_10485821 | Ga0207694_104858211 | 300 |
| 145 | 3300025931 | Ga0207644_10002846 | Ga0207644_100028464 | 300 |
| 146 | 3300025961 | Ga0207712_10086250 | Ga0207712_100862502 | 300 |
| 147 | 3300025986 | Ga0207658_10011432 | Ga0207658_100114324 | 300 |
| 148 | 3300026035 | Ga0207703_10000318 | Ga0207703_1000031828 | 300 |
| 149 | 3300026035 | Ga0207703_10001160 | Ga0207703_100011604 | 300 |
| 150 | 3300026041 | Ga0207639_10057902 | Ga0207639_100579022 | 300 |
| 151 | 3300026067 | Ga0207678_10008627 | Ga0207678_100086272 | 300 |
| 152 | 3300026078 | Ga0207702_10207313 | Ga0207702_102073132 | 300 |
| 153 | 3300026088 | Ga0207641_10083362 | Ga0207641_100833622 | 300 |
| 154 | 3300026116 | Ga0207674_10493044 | Ga0207674_104930441 | 300 |
| 155 | 3300026118 | Ga0207675_100230900 | Ga0207675_1002309001 | 300 |
| 156 | 3300028379 | Ga0268266_10007886 | Ga0268266_100078867 | 300 |
| 157 | 3300028379 | Ga0268266_10008007 | Ga0268266_100080078 | 300 |
| 158 | 3300028379 | Ga0268266_10026432 | Ga0268266_100264324 | 300 |
| 159 | 3300028379 | Ga0268266_10354079 | Ga0268266_103540792 | 300 |
| 160 | 3300028381 | Ga0268264_10001047 | Ga0268264_100010472 | 300 |
| 161 | 3300028381 | Ga0268264_10004984 | Ga0268264_100049842 | 300 |
| 162 | 3300028381 | Ga0268264_10007047 | Ga0268264_100070474 | 300 |
| 163 | 3300030521 | Ga0307511_10001542 | Ga0307511_100015423 | 300 |
| 164 | 3300031616 | Ga0307508_10208314 | Ga0307508_102083142 | 300 |
| 165 | 3300033180 | Ga0307510_10000015 | Ga0307510_10000015147 | 300 |
| 166 | 3300039438 | Ga0436360_1029045 | Ga0436360_1029045_143_1045 | 300 |
| 167 | 3300046507 | Ga0495606_0086772 | Ga0495606_0086772_838_1740 | 300 |
| 168 | 3300046519 | Ga0495632_0086296 | Ga0495632_0086296_436_1338 | 300 |
| 169 | 3300048905 | Ga0496102_0023703 | Ga0496102_0023703_2029_2931 | 300 |
| 170 | 3300048911 | Ga0496108_0285911 | Ga0496108_0285911_113_1015 | 300 |
| 171 | 3300048915 | Ga0496112_0351516 | Ga0496112_0351516_146_1048 | 300 |
| 172 | 3300048920 | Ga0496117_0000208 | Ga0496117_0000208_11274_12176 | 300 |
| 173 | 3300048921 | Ga0496118_0000005 | Ga0496118_0000005_411713_412615 | 300 |
| 174 | 3300048922 | Ga0496119_0003655 | Ga0496119_0003655_10127_11029 | 300 |
| 175 | 3300048923 | Ga0496120_0030683 | Ga0496120_0030683_2116_3018 | 300 |
| 176 | 3300048924 | Ga0496121_0001978 | Ga0496121_0001978_16587_17489 | 300 |
| 177 | 3300048924 | Ga0496121_0035492 | Ga0496121_0035492_274_1176 | 300 |
| 178 | 3300048924 | Ga0496121_0083673 | Ga0496121_0083673_1343_2245 | 300 |
| 179 | 3300048927 | Ga0496124_0034793 | Ga0496124_0034793_3239_4141 | 300 |
| 180 | 3300048928 | Ga0496125_0003265 | Ga0496125_0003265_18780_19682 | 300 |
| 181 | 3300048928 | Ga0496125_0067070 | Ga0496125_0067070_1594_2496 | 300 |
| 182 | 3300048928 | Ga0496125_0094259 | Ga0496125_0094259_245_1147 | 300 |
| 183 | 3300048929 | Ga0496126_0074554 | Ga0496126_0074554_857_1759 | 300 |
| 184 | 3300050489 | nmdc:mga03683_6684_c1 | nmdc:mga03683_6684_c1_1481_2383 | 300 |
| 185 | 3300050494 | nmdc:mga06z11_1813_c1 | nmdc:mga06z11_1813_c1_6677_7579 | 300 |
| 186 | 3300050496 | nmdc:mga07m45_1996_c4 | nmdc:mga07m45_1996_c4_2823_3725 | 300 |
| 187 | 3300050516 | nmdc:mga0sz30_204_c1 | nmdc:mga0sz30_204_c1_15808_16710 | 300 |
| 188 | 3300053093 | Ga0500651_0081117 | Ga0500651_0081117_337_1239 | 300 |
| 189 | 3300053178 | Ga0500637_0017366 | Ga0500637_0017366_730_1632 | 300 |
| 190 | 3300003771 | Ga0055526_1003875 | Ga0055526_10038756 | 301 |
| 191 | 3300005355 | Ga0070671_100201788 | Ga0070671_1002017881 | 301 |
| 192 | 3300005548 | Ga0070665_100595298 | Ga0070665_1005952981 | 301 |
| 193 | 3300005985 | Ga0081539_10004271 | Ga0081539_100042717 | 301 |
| 194 | 3300006038 | Ga0075365_10271304 | Ga0075365_102713041 | 301 |
| 195 | 3300006048 | Ga0075363_100036199 | Ga0075363_1000361992 | 301 |
| 196 | 3300006195 | Ga0075366_10080789 | Ga0075366_100807892 | 301 |
| 197 | 3300025295 | Ga0209564_1000043 | Ga0209564_100004357 | 301 |
| 198 | 3300025903 | Ga0207680_10193895 | Ga0207680_101938952 | 301 |
| 199 | 3300028379 | Ga0268266_10410589 | Ga0268266_104105891 | 301 |
| 200 | 3300036712 | Ga0316584_0053400 | Ga0316584_0053400_375_1283 | 301 |
| 201 | 3300042001 | Ga0439441_006564 | Ga0439441_006564_641_1546 | 301 |
| 202 | 3300042003 | Ga0439443_013304 | Ga0439443_013304_225_1130 | 301 |
| 203 | 3300042993 | Ga0439440_0008264 | Ga0439440_0008264_317_1222 | 301 |
| 204 | 3300048905 | Ga0496102_0014863 | Ga0496102_0014863_5057_5962 | 301 |
| 205 | 3300048906 | Ga0496103_0180946 | Ga0496103_0180946_311_1216 | 301 |
| 206 | 3300050509 | nmdc:mga0qj67_381361_c1 | nmdc:mga0qj67_381361_c1_113_1018 | 301 |
| 207 | 3300005262 | Ga0065165_1002483 | Ga0065165_100248310 | 302 |
| 208 | 3300009098 | Ga0105245_10392458 | Ga0105245_103924581 | 302 |
| 209 | 3300025299 | Ga0209256_1002636 | Ga0209256_10026367 | 302 |
| 210 | 3300025299 | Ga0209256_1006880 | Ga0209256_10068802 | 302 |
| 211 | 3300044694 | Ga0466963_0086919 | Ga0466963_0086919_43_951 | 302 |
| 212 | 3300044842 | Ga0466957_0337725 | Ga0466957_0337725_50_958 | 302 |
| 213 | 3300005844 | Ga0068862_100106958 | Ga0068862_1001069582 | 303 |
| 214 | 3300048915 | Ga0496112_0439906 | Ga0496112_0439906_105_1019 | 304 |
| 215 | 3300049742 | Ga0501080_0540469 | Ga0501080_0540469_34_948 | 304 |
| 216 | 3300050490 | nmdc:mga03n38_127131_c1 | nmdc:mga03n38_127131_c1_50_964 | 304 |
| 217 | 3300050493 | nmdc:mga0k408_12539_c1 | nmdc:mga0k408_12539_c1_50_964 | 304 |
| 218 | 3300050494 | nmdc:mga06z11_23078_c1 | nmdc:mga06z11_23078_c1_1535_2449 | 304 |
| 219 | 3300050516 | nmdc:mga0sz30_85859_c1 | nmdc:mga0sz30_85859_c1_211_1125 | 304 |
| 220 | 3300009545 | Ga0105237_10159763 | Ga0105237_101597632 | 305 |
| 221 | 3300025914 | Ga0207671_10038975 | Ga0207671_100389752 | 305 |
| 222 | 3300048907 | Ga0496104_0004434 | Ga0496104_0004434_9513_10430 | 305 |
| 223 | 3300048911 | Ga0496108_0266293 | Ga0496108_0266293_444_1361 | 305 |
| 224 | 3300048912 | Ga0496109_0268424 | Ga0496109_0268424_203_1120 | 305 |
| 225 | 3300048915 | Ga0496112_0262527 | Ga0496112_0262527_339_1256 | 305 |
| 226 | 3300048916 | Ga0496113_0269975 | Ga0496113_0269975_49_966 | 305 |
| 227 | 3300048918 | Ga0496115_0060656 | Ga0496115_0060656_1183_2100 | 305 |
| 228 | 3300037471 | Ga0395905_0300678 | Ga0395905_0300678_188_1111 | 306 |
| 229 | iso_pu_bacteria | 2508501009 | 2508544349 | 306 |
| 230 | 3300005329 | Ga0070683_100557411 | Ga0070683_1005574111 | 307 |
| 231 | 3300005458 | Ga0070681_10020340 | Ga0070681_100203405 | 307 |
| 232 | 3300005548 | Ga0070665_100004886 | Ga0070665_1000048862 | 307 |
| 233 | 3300005564 | Ga0070664_100194494 | Ga0070664_1001944942 | 307 |
| 234 | 3300006942 | Ga0099824_1029618 | Ga0099824_10296182 | 307 |
| 235 | 3300009545 | Ga0105237_10017516 | Ga0105237_100175164 | 307 |
| 236 | 3300009551 | Ga0105238_10040536 | Ga0105238_100405362 | 307 |
| 237 | 3300025912 | Ga0207707_10019302 | Ga0207707_100193022 | 307 |
| 238 | 3300025921 | Ga0207652_10128496 | Ga0207652_101284962 | 307 |
| 239 | 3300025924 | Ga0207694_10244911 | Ga0207694_102449112 | 307 |
| 240 | 3300025928 | Ga0207700_10232633 | Ga0207700_102326331 | 307 |
| 241 | 3300025944 | Ga0207661_10509114 | Ga0207661_105091141 | 307 |
| 242 | 3300027296 | Ga0209389_1000089 | Ga0209389_100008947 | 307 |
| 243 | 3300027357 | Ga0209589_1000148 | Ga0209589_100014841 | 307 |
| 244 | 3300027361 | Ga0209489_100512 | Ga0209489_10051242 | 307 |
| 245 | 3300028379 | Ga0268266_10002296 | Ga0268266_1000229617 | 307 |
| 246 | 3300028573 | Ga0265334_10047456 | Ga0265334_100474562 | 307 |
| 247 | 3300039438 | Ga0436360_0344470 | Ga0436360_0344470_1473_2417 | 307 |
| 248 | 3300045049 | Ga0466959_0004820 | Ga0466959_0004820_14_937 | 307 |
| 249 | 3300045049 | Ga0466959_0070877 | Ga0466959_0070877_821_1744 | 307 |
| 250 | 3300053153 | Ga0500616_0000016 | Ga0500616_0000016_68023_68946 | 307 |
| 251 | 3300053153 | Ga0500616_0043724 | Ga0500616_0043724_1241_2164 | 307 |
| 252 | iso_pu_bacteria | 2881364244 | 2881369345 | 307 |
| 253 | iso_pu_bacteria | 2906626472 | 2906633777 | 307 |
| 254 | 3300003203 | JGI25406J46586_10033074 | JGI25406J46586_100330742 | 308 |
| 255 | 3300005530 | Ga0070679_100014583 | Ga0070679_1000145834 | 308 |
| 256 | 3300005548 | Ga0070665_100000075 | Ga0070665_100000075148 | 308 |
| 257 | 3300005563 | Ga0068855_100022407 | Ga0068855_1000224075 | 308 |
| 258 | 3300005985 | Ga0081539_10000060 | Ga0081539_1000006078 | 308 |
| 259 | 3300009093 | Ga0105240_10009414 | Ga0105240_100094142 | 308 |
| 260 | 3300025913 | Ga0207695_10020298 | Ga0207695_100202988 | 308 |
| 261 | 3300025913 | Ga0207695_10096676 | Ga0207695_100966762 | 308 |
| 262 | 3300025921 | Ga0207652_10023173 | Ga0207652_100231737 | 308 |
| 263 | 3300025949 | Ga0207667_10010840 | Ga0207667_100108407 | 308 |
| 264 | 3300028379 | Ga0268266_10000103 | Ga0268266_1000010387 | 308 |
| 265 | 3300037418 | Ga0395900_0071594 | Ga0395900_0071594_1464_2393 | 308 |
| 266 | 3300038443 | Ga0395901_0000583 | Ga0395901_0000583_15249_16178 | 308 |
| 267 | 3300021384 | Ga0213876_10004588 | Ga0213876_100045885 | 309 |
| 268 | 3300036401 | Ga0373937_0165909 | Ga0373937_0165909_845_1774 | 309 |
| 269 | 3300037853 | Ga0436364_0734008 | Ga0436364_0734008_1908_2837 | 309 |
| 270 | 3300039437 | Ga0436365_1874128 | Ga0436365_1874128_11324_12256 | 309 |
| 271 | 3300003215 | JGI25153J46596_10006799 | JGI25153J46596_100067993 | 310 |
| 272 | 3300025297 | Ga0209758_1000364 | Ga0209758_100036471 | 310 |
| 273 | 3300037312 | Ga0395899_0051581 | Ga0395899_0051581_471_1406 | 310 |
| 274 | 3300053130 | Ga0500642_0004907 | Ga0500642_0004907_265_1197 | 310 |
| 275 | 3300053080 | Ga0500635_0021341 | Ga0500635_0021341_511_1449 | 311 |
| 276 | 3300053095 | Ga0500640_052574 | Ga0500640_052574_618_1556 | 311 |
| 277 | 3300053111 | Ga0500572_000037 | Ga0500572_000037_21117_22052 | 311 |
| 278 | 3300053111 | Ga0500572_017072 | Ga0500572_017072_593_1531 | 311 |
| 279 | 3300053121 | Ga0500607_043489 | Ga0500607_043489_630_1568 | 311 |
| 280 | 3300053122 | Ga0500608_046641 | Ga0500608_046641_753_1691 | 311 |
| 281 | 3300053136 | Ga0500559_0003395 | Ga0500559_0003395_980_1918 | 311 |
| 282 | 3300053138 | Ga0500564_016514 | Ga0500564_016514_1269_2207 | 311 |
| 283 | 3300053154 | Ga0500619_003020 | Ga0500619_003020_1231_2169 | 311 |
| 284 | 3300053177 | Ga0500636_0002129 | Ga0500636_0002129_5758_6696 | 311 |
| 285 | iso_pu_bacteria | 2511231028 | 2511401157 | 311 |
| 286 | 3300025254 | Ga0209148_1016841 | Ga0209148_10168412 | 312 |
| 287 | 3300025261 | Ga0209233_1001053 | Ga0209233_10010534 | 312 |
| 288 | 3300044706 | Ga0466964_0177203 | Ga0466964_0177203_49_987 | 312 |
| 289 | 3300048921 | Ga0496118_0025499 | Ga0496118_0025499_1022_1960 | 312 |
| 290 | 3300048924 | Ga0496121_0027812 | Ga0496121_0027812_1863_2801 | 312 |
| 291 | 3300053177 | Ga0500636_0014406 | Ga0500636_0014406_506_1444 | 312 |
| 292 | iso_pu_bacteria | 2513237139 | 2513873480 | 312 |
| 293 | iso_pu_bacteria | 2824696289 | 2824703029 | 312 |
| 294 | iso_pu_bacteria | 2847939898 | 2847942205 | 312 |
| 295 | iso_pu_bacteria | 3005506211 | 3005509113 | 312 |
| 296 | 3300005262 | Ga0065165_1003087 | Ga0065165_10030875 | 313 |
| 297 | 3300025261 | Ga0209233_1002120 | Ga0209233_10021203 | 313 |
| 298 | 3300025928 | Ga0207700_10308472 | Ga0207700_103084722 | 313 |
| 299 | 3300031235 | Ga0265330_10026451 | Ga0265330_100264512 | 313 |
| 300 | 3300039437 | Ga0436365_0609863 | Ga0436365_0609863_155_1114 | 313 |
| 301 | iso_pu_bacteria | 2891373044 | 2891376419 | 313 |
| 302 | iso_pu_bacteria | 2906643746 | 2906651350 | 313 |
| 303 | iso_pu_bacteria | 3003930520 | 3003932353 | 313 |
| 304 | 3300027682 | Ga0209971_1030481 | Ga0209971_10304812 | 314 |
| 305 | 3300039437 | Ga0436365_0611857 | Ga0436365_0611857_364_1311 | 314 |
| 306 | 3300044694 | Ga0466963_0040090 | Ga0466963_0040090_1965_2912 | 314 |
| 307 | 3300045049 | Ga0466959_0000216 | Ga0466959_0000216_21716_22663 | 314 |
| 308 | 3300045976 | Ga0466967_0020032 | Ga0466967_0020032_3175_4122 | 314 |
| 309 | 3300049523 | Ga0501300_000445 | Ga0501300_000445_4910_5860 | 314 |
| 310 | 3300048921 | Ga0496118_0022715 | Ga0496118_0022715_2420_3391 | 315 |
| 311 | 3300048922 | Ga0496119_0053636 | Ga0496119_0053636_418_1389 | 315 |
| 312 | 3300053087 | Ga0500643_000063 | Ga0500643_000063_113398_114369 | 315 |
| 313 | 3300053103 | Ga0500555_006779 | Ga0500555_006779_2011_2982 | 315 |
| 314 | 3300053130 | Ga0500642_0126263 | Ga0500642_0126263_78_1049 | 315 |
| 315 | 3300053139 | Ga0500568_0049409 | Ga0500568_0049409_552_1523 | 315 |
| 316 | iso_pu_bacteria | 3005594810 | 3005595107 | 315 |
| 317 | 3300005548 | Ga0070665_100009652 | Ga0070665_1000096527 | 316 |
| 318 | 3300025297 | Ga0209758_1006642 | Ga0209758_10066426 | 316 |
| 319 | 3300028379 | Ga0268266_10015895 | Ga0268266_100158952 | 316 |
| 320 | 3300050492 | nmdc:mga0yw44_117534_c1 | nmdc:mga0yw44_117534_c1_686_1645 | 316 |
| 321 | 3300053122 | Ga0500608_020689 | Ga0500608_020689_1941_2894 | 316 |
| 322 | 3300003187 | JGI25151J46595_10051875 | JGI25151J46595_100518752 | 317 |
| 323 | 3300013297 | Ga0157378_10026395 | Ga0157378_100263955 | 317 |
| 324 | 3300025294 | Ga0209025_1000118 | Ga0209025_1000118181 | 317 |
| 325 | 3300027296 | Ga0209389_1000071 | Ga0209389_100007150 | 317 |
| 326 | 3300027361 | Ga0209489_101361 | Ga0209489_1013612 | 317 |
| 327 | 3300027363 | Ga0209700_100011 | Ga0209700_100011249 | 317 |
| 328 | 3300031852 | Ga0307410_10090611 | Ga0307410_100906112 | 317 |
| 329 | 3300031995 | Ga0307409_100125251 | Ga0307409_1001252512 | 317 |
| 330 | 3300032005 | Ga0307411_10041398 | Ga0307411_100413982 | 317 |
| 331 | 3300044901 | Ga0466960_0159497 | Ga0466960_0159497_132_1097 | 317 |
| 332 | 3300048925 | Ga0496122_0000604 | Ga0496122_0000604_50368_51321 | 317 |
| 333 | 3300048926 | Ga0496123_0001019 | Ga0496123_0001019_31419_32372 | 317 |
| 334 | 3300048928 | Ga0496125_0000254 | Ga0496125_0000254_102363_103316 | 317 |
| 335 | 3300048929 | Ga0496126_0002653 | Ga0496126_0002653_3095_4048 | 317 |
| 336 | 3300049579 | Ga0501043_0050028 | Ga0501043_0050028_453_1406 | 317 |
| 337 | 3300049822 | Ga0501035_0080627 | Ga0501035_0080627_232_1185 | 317 |
| 338 | iso_pu_bacteria | 2879083081 | 2879085960 | 317 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zun-assembly1.cif.gz_A | crystal structure of a gtp-regulated atp sulfurylase heterodimer from pseudomonas syringae | 0.9014 | 13 | 227 |
| 1zun-assembly1.cif.gz_A | crystal structure of a gtp-regulated atp sulfurylase heterodimer from pseudomonas syringae | 0.8843 | 13 | 227 |
| 2oq2-assembly1.cif.gz_A | crystal structure of yeast paps reductase with pap, a product complex | 0.7918 | 31 | 298 |
| 4bwv-assembly1.cif.gz_B | structure of adenosine 5-prime-phosphosulfate reductase apr-b from physcomitrella patens | 0.7818 | 3 | 298 |
| 4bwv-assembly1.cif.gz_B | structure of adenosine 5-prime-phosphosulfate reductase apr-b from physcomitrella patens | 0.7754 | 3 | 298 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1zunA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.928 | 23 | 227 | 3.40.50.620 |
| 1zunA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9184 | 23 | 227 | 3.40.50.620 |
| af_Q8R123_266_492_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8005 | 17 | 224 | 3.40.50.620 |
| 4bwvB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.7818 | 3 | 298 | 3.40.50.620 |
| 4bwvB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.7754 | 3 | 298 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D3BSU9-F1-model_v4 | Sulfate adenylyltransferase small subunit (EC 2.7.7.4) | 0.997 | 24 | 103 |
GO:0004781
|
| AF-A0A7C7W5V8-F1-model_v4 | Sulfate adenylyltransferase small subunit (EC 2.7.7.4) | 0.9956 | 36 | 133 |
GO:0004781
|
| AF-A0A5S3RNS7-F1-model_v4 | deleted | 0.9955 | 28 | 138 |
|
| AF-A0A4Q3J4F7-F1-model_v4 | Sulfate adenylyltransferase small subunit (EC 2.7.7.4) | 0.9954 | 23 | 107 |
GO:0004781
|
| AF-A0A6L7M336-F1-model_v4 | deleted | 0.9898 | 36 | 132 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar