F413684

General Info

Members Datasets Scaffolds Average Seq Length
338 193 676 414

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0000118|Ga0496100_0000118_42561_43928
Length 455
Sequence VRAADALVQAQRLHLKLRTPVRRYDPGPVAVETEEVPVAVDVSQIASVATEPGELPKTMTAWVIREERFGEPRDAFQLEEIDTPKPGAFEVVVRVMAAGVNFNNVWAALGEPVSVMRYGDHPQYGHHIGGSDASGIVWKVGEGVTRWKAGDEVVIHCNMASYEDPEVHGLDPLAAPSQMIWGYETTWGSFAQFCKVQAQQLLPKPKHLSWEEAASYGLTYFTAYRMLIDQVKLQAGHRVLIWGAAGGLGVFATQLCALTGAQAVGVVSSPDKGELVKQLGAVDYLDRNEFSGMMRRGGETPEEEKARFKESRRFCKAVEERLGGPPDIVFEHVGKATFPTSVLCVKPFGKVVICGATSGYQLDFDVRYLWMKQKQIIGSHFANAWEATKANELIDQSLVRPVLWQTMSFEQVAEAHQLLRDNKHFGKIAILVGATAEGQGKTADGPGAIRAEVGA

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
78 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
79 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
93 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
123 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
185 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
186 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
187 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
188 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.37
Nodule 0
Rhizoplane 9.47
Rhizosphere 84.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0000118 3300048903 Bacteria 45414
2 LJQas_1001103 3300000549 Bacteria 4099
3 JGI25406J46586_10013137 3300003203 Bacteria 3570
4 JGI25407J50210_10003860 3300003373 Bacteria 3630
5 JGI25407J50210_10023684 3300003373 Bacteria 1593
6 Ga0068869_100230062 3300005334 Bacteria 1473
7 Ga0070682_100007083 3300005337 Bacteria 6309
8 Ga0068868_100008341 3300005338 Bacteria 7415
9 Ga0068868_100037832 3300005338 Bacteria 3743
10 Ga0070660_100008477 3300005339 Bacteria 7193
11 Ga0070660_100147417 3300005339 Bacteria 1891
12 Ga0070692_10003952 3300005345 Bacteria 6118
13 Ga0070692_10075356 3300005345 Bacteria 1807
14 Ga0070659_100000039 3300005366 Bacteria 104397
15 Ga0070714_100000385 3300005435 Bacteria 32922
16 Ga0070714_100003010 3300005435 Bacteria 12496
17 Ga0070713_100011374 3300005436 Bacteria 6479
18 Ga0070710_10000009 3300005437 Bacteria 165863
19 Ga0070710_10087872 3300005437 Bacteria 1828
20 Ga0070700_100007303 3300005441 Bacteria 5955
21 Ga0070700_100057020 3300005441 Bacteria 2450
22 Ga0070700_100078095 3300005441 Bacteria 2130
23 Ga0070678_100033017 3300005456 Bacteria 3589
24 Ga0070662_100061157 3300005457 Bacteria 2749
25 Ga0068854_100018041 3300005578 Bacteria 4731
26 Ga0068856_100024928 3300005614 Bacteria 5828
27 Ga0070702_100009224 3300005615 Bacteria 4819
28 Ga0068859_100071034 3300005617 Bacteria 3517
29 Ga0068863_100063705 3300005841 Bacteria 3487
30 Ga0068858_100248897 3300005842 Bacteria 1688
31 Ga0068860_100040251 3300005843 Bacteria 4467
32 Ga0081538_10000097 3300005981 Bacteria 85125
33 Ga0081538_10000224 3300005981 Bacteria 63610
34 Ga0081538_10000467 3300005981 Bacteria 45342
35 Ga0081538_10001319 3300005981 Bacteria 25609
36 Ga0081538_10002333 3300005981 Bacteria 18722
37 Ga0081538_10004097 3300005981 Bacteria 13549
38 Ga0081538_10004784 3300005981 Bacteria 12370
39 Ga0081538_10006891 3300005981 Bacteria 9890
40 Ga0081538_10011690 3300005981 Bacteria 7094
41 Ga0081538_10019803 3300005981 Bacteria 4979
42 Ga0081538_10021300 3300005981 Bacteria 4737
43 Ga0081538_10022238 3300005981 Bacteria 4598
44 Ga0081540_1000163 3300005983 Bacteria 68955
45 Ga0081539_10001097 3300005985 Bacteria 49223
46 Ga0081539_10002904 3300005985 Bacteria 22668
47 Ga0070717_10000013 3300006028 Bacteria 228046
48 Ga0070717_10003305 3300006028 Bacteria 11535
49 Ga0070717_10034662 3300006028 Bacteria 4082
50 Ga0075365_10023585 3300006038 Bacteria 3871
51 Ga0075364_10174689 3300006051 Bacteria 1453
52 Ga0075432_10016093 3300006058 Bacteria 2555
53 Ga0070712_100000170 3300006175 Bacteria 35641
54 Ga0075428_100041468 3300006844 Bacteria 5062
55 Ga0075428_100048482 3300006844 Bacteria 4662
56 Ga0075428_100101176 3300006844 Bacteria 3142
57 Ga0075430_100000085 3300006846 Bacteria 52821
58 Ga0075430_100003030 3300006846 Bacteria 14060
59 Ga0075430_100013540 3300006846 Bacteria 6954
60 Ga0075430_100248929 3300006846 Bacteria 1472
61 Ga0075431_100001218 3300006847 Bacteria 23289
62 Ga0075431_100038604 3300006847 Bacteria 4917
63 Ga0075431_100045477 3300006847 Bacteria 4526
64 Ga0075431_100084248 3300006847 Bacteria 3282
65 Ga0075434_100024209 3300006871 Bacteria 5933
66 Ga0075429_100005866 3300006880 Bacteria 10599
67 Ga0075429_100105905 3300006880 Bacteria 2457
68 Ga0097620_100071040 3300006931 Bacteria 3517
69 Ga0105240_10247055 3300009093 Bacteria 2065
70 Ga0105240_10374112 3300009093 Bacteria 1610
71 Ga0111539_10088501 3300009094 Bacteria 3638
72 Ga0114129_10034506 3300009147 Bacteria 7146
73 Ga0114129_10071189 3300009147 Bacteria 4849
74 Ga0105242_10000032 3300009176 Bacteria 98198
75 Ga0105237_10002133 3300009545 Bacteria 24902
76 Ga0105249_10008941 3300009553 Bacteria 8750
77 Ga0105249_10116854 3300009553 Bacteria 2529
78 Ga0105239_10096984 3300010375 Bacteria 3258
79 Ga0163162_10037763 3300013306 Bacteria 4820
80 Ga0163163_10020720 3300014325 Bacteria 6197
81 Ga0157380_10108764 3300014326 Bacteria 2324
82 Ga0157379_10030742 3300014968 Bacteria 4783
83 Ga0206356_10329217 3300020070 Bacteria 2685
84 Ga0213875_10000092 3300021388 Bacteria 104416
85 Ga0213875_10017363 3300021388 Bacteria 3476
86 Ga0224712_10044258 3300022467 Bacteria 1697
87 Ga0207692_10000005 3300025898 Bacteria 370169
88 Ga0207688_10001363 3300025901 Bacteria 12695
89 Ga0207688_10051734 3300025901 Bacteria 2301
90 Ga0207643_10094958 3300025908 Bacteria 1742
91 Ga0207671_10005068 3300025914 Bacteria 12301
92 Ga0207693_10000028 3300025915 Bacteria 120041
93 Ga0207657_10011064 3300025919 Bacteria 8968
94 Ga0207657_10025427 3300025919 Bacteria 5461
95 Ga0207657_10132056 3300025919 Bacteria 2046
96 Ga0207681_10002565 3300025923 Bacteria 11530
97 Ga0207664_10000046 3300025929 Bacteria 140749
98 Ga0207664_10003020 3300025929 Bacteria 11190
99 Ga0207664_10044618 3300025929 Bacteria 3473
100 Ga0207690_10000798 3300025932 Bacteria 20292
101 Ga0207706_10056983 3300025933 Bacteria 3443
102 Ga0207686_10000048 3300025934 Bacteria 115595
103 Ga0207709_10192202 3300025935 Bacteria 1451
104 Ga0207689_10031521 3300025942 Bacteria 4412
105 Ga0207661_10142825 3300025944 Bacteria 2062
106 Ga0207712_10204161 3300025961 Bacteria 1569
107 Ga0207640_10100754 3300025981 Bacteria 2025
108 Ga0207640_10125640 3300025981 Bacteria 1846
109 Ga0207677_10030553 3300026023 Bacteria 3440
110 Ga0207677_10042526 3300026023 Bacteria 3013
111 Ga0207639_10257763 3300026041 Bacteria 1524
112 Ga0207678_10141468 3300026067 Bacteria 2053
113 Ga0207708_10000612 3300026075 Bacteria 27409
114 Ga0207708_10005059 3300026075 Bacteria 9728
115 Ga0207708_10045872 3300026075 Bacteria 3330
116 Ga0207641_10005198 3300026088 Bacteria 11129
117 Ga0207674_10036294 3300026116 Bacteria 5138
118 Ga0207675_100026014 3300026118 Bacteria 5447
119 Ga0207675_100027836 3300026118 Bacteria 5265
120 Ga0207683_10047975 3300026121 Bacteria 3740
121 Ga0268264_10029508 3300028381 Bacteria 4493
122 Ga0265326_10000030 3300028558 Bacteria 96518
123 Ga0265319_1003699 3300028563 Bacteria 7866
124 Ga0265334_10000026 3300028573 Bacteria 116448
125 Ga0265338_10000536 3300028800 Bacteria 66434
126 Ga0307405_10058608 3300031731 Bacteria 2424
127 Ga0307405_10088938 3300031731 Bacteria 2039
128 Ga0307413_10019723 3300031824 Bacteria 3570
129 Ga0307413_10022424 3300031824 Bacteria 3403
130 Ga0307410_10008238 3300031852 Bacteria 5769
131 Ga0307406_10107759 3300031901 Bacteria 1911
132 Ga0307407_10053948 3300031903 Bacteria 2315
133 Ga0307412_10031031 3300031911 Bacteria 3371
134 Ga0307409_100000565 3300031995 Bacteria 16137
135 Ga0307409_100004880 3300031995 Bacteria 7625
136 Ga0307409_100020486 3300031995 Bacteria 4509
137 Ga0307416_100016309 3300032002 Bacteria 5159
138 Ga0307416_100387748 3300032002 Bacteria 1430
139 Ga0307414_10028252 3300032004 Bacteria 3636
140 Ga0307414_10145214 3300032004 Bacteria 1863
141 Ga0307411_10008066 3300032005 Bacteria 5427
142 Ga0307415_100000541 3300032126 Bacteria 16503
143 Ga0307415_100009466 3300032126 Bacteria 5464
144 Ga0307415_100020945 3300032126 Bacteria 4006
145 Ga0373932_0027480 3300035112 Bacteria 1557
146 Ga0373960_0011473 3300035121 Bacteria 2184
147 Ga0395898_0217569 3300037466 Bacteria 1822
148 Ga0436364_0527355 3300037853 Bacteria 148076
149 Ga0395901_0301294 3300038443 Bacteria 1662
150 Ga0400483_114267 3300039062 Bacteria 5709
151 Ga0400483_209184 3300039062 Bacteria 6335
152 Ga0436363_0049173 3300039450 Bacteria 2037
153 Ga0436363_1720040 3300039450 Bacteria 2408
154 Ga0466969_0007642 3300044656 Bacteria 5746
155 Ga0466969_0056315 3300044656 Bacteria 1920
156 Ga0466966_0004769 3300044684 Bacteria 8926
157 Ga0466966_0129499 3300044684 Bacteria 1546
158 Ga0466966_0138930 3300044684 Bacteria 1485
159 Ga0466961_0002526 3300044693 Bacteria 11346
160 Ga0466961_0006813 3300044693 Bacteria 7270
161 Ga0466961_0052285 3300044693 Bacteria 2607
162 Ga0466961_0094901 3300044693 Bacteria 1882
163 Ga0466963_0004651 3300044694 Bacteria 8007
164 Ga0466963_0011773 3300044694 Bacteria 5334
165 Ga0466963_0022254 3300044694 Bacteria 4012
166 Ga0466963_0049387 3300044694 Bacteria 2782
167 Ga0466963_0075890 3300044694 Bacteria 2269
168 Ga0466963_0084770 3300044694 Bacteria 2150
169 Ga0466968_0045576 3300044735 Bacteria 1861
170 Ga0466968_0053273 3300044735 Bacteria 1733
171 Ga0466968_0056457 3300044735 Bacteria 1687
172 Ga0466970_0068412 3300044765 Bacteria 1908
173 Ga0466957_0053273 3300044842 Bacteria 2466
174 Ga0466960_0026043 3300044901 Bacteria 2652
175 Ga0466960_0037547 3300044901 Bacteria 2273
176 Ga0466960_0101112 3300044901 Bacteria 1485
177 Ga0466959_0005555 3300045049 Bacteria 8654
178 Ga0466959_0007235 3300045049 Bacteria 7774
179 Ga0466959_0018730 3300045049 Bacteria 5085
180 Ga0466959_0048099 3300045049 Bacteria 3135
181 Ga0466958_0005321 3300045836 Bacteria 6909
182 Ga0466958_0008649 3300045836 Bacteria 5653
183 Ga0466958_0051527 3300045836 Bacteria 2492
184 Ga0466958_0066119 3300045836 Bacteria 2207
185 Ga0466958_0170578 3300045836 Bacteria 1377
186 Ga0466967_0002303 3300045976 Bacteria 11790
187 Ga0466967_0016857 3300045976 Bacteria 5777
188 Ga0466967_0065479 3300045976 Bacteria 3235
189 Ga0466967_0071815 3300045976 Bacteria 3100
190 Ga0466967_0083913 3300045976 Bacteria 2882
191 Ga0466967_0086457 3300045976 Bacteria 2841
192 Ga0466967_0090375 3300045976 Bacteria 2781
193 Ga0466967_0257925 3300045976 Bacteria 1667
194 Ga0466967_0310434 3300045976 Bacteria 1519
195 Ga0466967_0434582 3300045976 Bacteria 1281
196 Ga0495629_0212781 3300046459 Bacteria 1335
197 Ga0495641_0001037 3300046461 Bacteria 23902
198 Ga0495653_0011193 3300046463 Bacteria 7332
199 Ga0495650_0000063 3300046471 Bacteria 277841
200 Ga0495662_0050176 3300046476 Bacteria 2014
201 Ga0495664_0001140 3300046477 Bacteria 13787
202 Ga0495596_0006620 3300046500 Bacteria 5315
203 Ga0495618_0000054 3300046514 Bacteria 83787
204 Ga0495630_0000548 3300046517 Bacteria 27475
205 Ga0495630_0112402 3300046517 Bacteria 2063
206 Ga0495631_0018414 3300046518 Bacteria 3288
207 Ga0495644_0037411 3300046523 Bacteria 1831
208 Ga0495645_0000354 3300046543 Bacteria 32418
209 Ga0495656_0004068 3300046615 Bacteria 4979
210 Ga0495657_0000006 3300046675 Bacteria 250610
211 Ga0495657_0054801 3300046675 Bacteria 2662
212 Ga0495658_0083875 3300046683 Bacteria 1875
213 Ga0495613_0000801 3300046689 Bacteria 24391
214 Ga0495604_0000137 3300047317 Bacteria 62542
215 Ga0495604_0001012 3300047317 Bacteria 23396
216 Ga0495604_0009878 3300047317 Bacteria 7555
217 Ga0495604_0182322 3300047317 Bacteria 1468
218 Ga0495672_0125555 3300047320 Bacteria 1357
219 Ga0495676_0033834 3300047321 Bacteria 4296
220 Ga0495684_0010650 3300047471 Bacteria 7107
221 Ga0495684_0024254 3300047471 Bacteria 4669
222 Ga0495686_0000020 3300047472 Bacteria 429191
223 Ga0495602_0000041 3300048088 Bacteria 126954
224 Ga0495602_0174796 3300048088 Bacteria 1663
225 Ga0496101_0001916 3300048904 Bacteria 12577
226 Ga0496103_0052367 3300048906 Bacteria 2528
227 Ga0496103_0194692 3300048906 Bacteria 1303
228 Ga0496104_0000028 3300048907 Bacteria 203377
229 Ga0496104_0204921 3300048907 Bacteria 1884
230 Ga0496106_0115104 3300048909 Bacteria 2097
231 Ga0496107_0026065 3300048910 Bacteria 4143
232 Ga0496108_0000175 3300048911 Bacteria 59373
233 Ga0496108_0024242 3300048911 Bacteria 4995
234 Ga0496109_0000121 3300048912 Bacteria 81487
235 Ga0496109_0001288 3300048912 Bacteria 20809
236 Ga0496109_0005014 3300048912 Bacteria 11058
237 Ga0496109_0012078 3300048912 Bacteria 7442
238 Ga0496109_0137293 3300048912 Bacteria 2285
239 Ga0496110_0000666 3300048913 Bacteria 23528
240 Ga0496110_0002456 3300048913 Bacteria 13879
241 Ga0496111_0000229 3300048914 Bacteria 26736
242 Ga0496111_0003511 3300048914 Bacteria 9701
243 Ga0496111_0179630 3300048914 Bacteria 1573
244 Ga0496112_0000418 3300048915 Bacteria 28077
245 Ga0496112_0016928 3300048915 Bacteria 6841
246 Ga0496112_0017954 3300048915 Bacteria 6657
247 Ga0496112_0045112 3300048915 Bacteria 4321
248 Ga0496113_0139673 3300048916 Bacteria 1905
249 Ga0496113_0286142 3300048916 Bacteria 1318
250 Ga0496114_0000101 3300048917 Bacteria 61589
251 Ga0496114_0029564 3300048917 Bacteria 4506
252 Ga0496115_0000200 3300048918 Bacteria 55755
253 Ga0496115_0000226 3300048918 Bacteria 51586
254 Ga0496115_0000350 3300048918 Bacteria 39036
255 Ga0496115_0058269 3300048918 Bacteria 3108
256 Ga0496121_0003697 3300048924 Bacteria 21476
257 Ga0496121_0046834 3300048924 Bacteria 3696
258 Ga0496124_0138717 3300048927 Bacteria 1922
259 Ga0496126_0011083 3300048929 Bacteria 9368
260 Ga0501031_0007032 3300049568 Bacteria 7345
261 Ga0501031_0131003 3300049568 Bacteria 1638
262 Ga0501033_0036553 3300049570 Bacteria 3679
263 Ga0501034_0021900 3300049571 Bacteria 6512
264 Ga0501034_0032130 3300049571 Bacteria 5332
265 Ga0501034_0123759 3300049571 Bacteria 2572
266 Ga0501036_0004652 3300049572 Bacteria 11089
267 Ga0501036_0047983 3300049572 Bacteria 3616
268 Ga0501037_0061148 3300049573 Bacteria 2746
269 Ga0501037_0255585 3300049573 Bacteria 1225
270 Ga0501038_0024714 3300049574 Bacteria 5356
271 Ga0501039_0005176 3300049575 Bacteria 9880
272 Ga0501039_0014617 3300049575 Bacteria 6009
273 Ga0501040_0045310 3300049576 Bacteria 2999
274 Ga0501042_0010369 3300049578 Bacteria 6244
275 Ga0501042_0019959 3300049578 Bacteria 4661
276 Ga0501042_0056437 3300049578 Bacteria 2802
277 Ga0501042_0197670 3300049578 Bacteria 1450
278 Ga0501043_0005658 3300049579 Bacteria 10071
279 Ga0501046_0006259 3300049580 Bacteria 10559
280 Ga0501047_0037018 3300049581 Bacteria 4716
281 Ga0501067_0008817 3300049583 Bacteria 5587
282 Ga0501068_0023411 3300049584 Bacteria 3619
283 Ga0501069_0012605 3300049585 Bacteria 4496
284 Ga0501070_0047585 3300049586 Bacteria 3563
285 Ga0501071_0028393 3300049587 Bacteria 3943
286 Ga0501071_0038465 3300049587 Bacteria 3419
287 Ga0501072_0014032 3300049588 Bacteria 6140
288 Ga0501072_0024523 3300049588 Bacteria 4692
289 Ga0501073_0018523 3300049589 Bacteria 5033
290 Ga0501073_0033525 3300049589 Bacteria 3657
291 Ga0501074_0020813 3300049590 Bacteria 4765
292 Ga0501075_0160058 3300049591 Bacteria 1717
293 Ga0501077_0051400 3300049593 Bacteria 2619
294 Ga0501077_0089182 3300049593 Bacteria 1954
295 Ga0501080_0017461 3300049742 Bacteria 6636
296 Ga0501080_0030416 3300049742 Bacteria 5031
297 Ga0501080_0174862 3300049742 Bacteria 1979
298 Ga0501035_0007105 3300049822 Bacteria 10467
299 Ga0501044_0107655 3300049823 Bacteria 2798
300 Ga0501045_0131250 3300049824 Bacteria 1862
301 nmdc:mga03n38_86405_c1 3300050490 Bacteria 1484
302 nmdc:mga0yw44_28145_c1 3300050492 Bacteria 3230
303 nmdc:mga05p37_1637_c1 3300050507 Bacteria 25971
304 nmdc:mga05p37_19701_c1 3300050507 Bacteria 8161
305 nmdc:mga05p37_349835_c1 3300050507 Bacteria 1740
306 nmdc:mga05p37_560785_c1 3300050507 Bacteria 1298
307 nmdc:mga05p37_86918_c1 3300050507 Bacteria 3854
308 nmdc:mga09592_18270_c1 3300050508 Bacteria 5749
309 nmdc:mga09592_77822_c1 3300050508 Bacteria 2822
310 nmdc:mga0qj67_15101_c1 3300050509 Bacteria 5844
311 nmdc:mga06r32_25826_c1 3300050510 Bacteria 5468
312 nmdc:mga06r32_32626_c1 3300050510 Bacteria 4901
313 nmdc:mga06r32_389310_c1 3300050510 Bacteria 1376
314 nmdc:mga06r32_40709_c1 3300050510 Bacteria 4412
315 nmdc:mga08y16_20500_c1 3300050511 Bacteria 6978
316 nmdc:mga08y16_33072_c1 3300050511 Bacteria 5433
317 nmdc:mga08y16_51472_c1 3300050511 Bacteria 4309
318 nmdc:mga08y16_99835_c1 3300050511 Bacteria 3022
319 nmdc:mga0rr50_297822_c1 3300050513 Bacteria 1349
320 nmdc:mga0a205_15818_c1 3300050515 Bacteria 7054
321 nmdc:mga0a205_34512_c1 3300050515 Bacteria 4852
322 Ga0495601_0000013 3300053077 Bacteria 226476
323 Ga0495601_0000577 3300053077 Bacteria 19478
324 Ga0495612_0000176 3300053078 Bacteria 26921
325 Ga0495655_0000001 3300053083 Bacteria 419518
326 Ga0500556_0001508 3300053104 Bacteria 9605
327 Ga0500628_000033 3300053129 Bacteria 52431
328 Ga0500616_0004764 3300053153 Bacteria 9527
329 Ga0500616_0005144 3300053153 Bacteria 8990
330 Ga0501084_0058199 3300054114 Bacteria 3234
331 Ga0501084_0059290 3300054114 Bacteria 3204
332 Ga0590075_023696 3300059424 Bacteria 1539
333 Ga0501082_0018334 3300060353 Bacteria 6027
334 Ga0501082_0105558 3300060353 Bacteria 2437
335 Ga0466962_0006254 3300061719 Bacteria 5720
336 Ga0466962_0009389 3300061719 Bacteria 4689
337 Ga0466962_0103096 3300061719 Bacteria 1370
338 Ga0530510_0013210 3300061734 Bacteria 5807
339 Ga0496100_0000118
340 LJQas_1001103
341 JGI25406J46586_10013137
342 JGI25407J50210_10003860
343 JGI25407J50210_10023684
344 Ga0068869_100230062
345 Ga0070682_100007083
346 Ga0068868_100008341
347 Ga0068868_100037832
348 Ga0070660_100008477
349 Ga0070660_100147417
350 Ga0070692_10003952
351 Ga0070692_10075356
352 Ga0070659_100000039
353 Ga0070714_100000385
354 Ga0070714_100003010
355 Ga0070713_100011374
356 Ga0070710_10000009
357 Ga0070710_10087872
358 Ga0070700_100007303
359 Ga0070700_100057020
360 Ga0070700_100078095
361 Ga0070678_100033017
362 Ga0070662_100061157
363 Ga0068854_100018041
364 Ga0068856_100024928
365 Ga0070702_100009224
366 Ga0068859_100071034
367 Ga0068863_100063705
368 Ga0068858_100248897
369 Ga0068860_100040251
370 Ga0081538_10000097
371 Ga0081538_10000224
372 Ga0081538_10000467
373 Ga0081538_10001319
374 Ga0081538_10002333
375 Ga0081538_10004097
376 Ga0081538_10004784
377 Ga0081538_10006891
378 Ga0081538_10011690
379 Ga0081538_10019803
380 Ga0081538_10021300
381 Ga0081538_10022238
382 Ga0081540_1000163
383 Ga0081539_10001097
384 Ga0081539_10002904
385 Ga0070717_10000013
386 Ga0070717_10003305
387 Ga0070717_10034662
388 Ga0075365_10023585
389 Ga0075364_10174689
390 Ga0075432_10016093
391 Ga0070712_100000170
392 Ga0075428_100041468
393 Ga0075428_100048482
394 Ga0075428_100101176
395 Ga0075430_100000085
396 Ga0075430_100003030
397 Ga0075430_100013540
398 Ga0075430_100248929
399 Ga0075431_100001218
400 Ga0075431_100038604
401 Ga0075431_100045477
402 Ga0075431_100084248
403 Ga0075434_100024209
404 Ga0075429_100005866
405 Ga0075429_100105905
406 Ga0097620_100071040
407 Ga0105240_10247055
408 Ga0105240_10374112
409 Ga0111539_10088501
410 Ga0114129_10034506
411 Ga0114129_10071189
412 Ga0105242_10000032
413 Ga0105237_10002133
414 Ga0105249_10008941
415 Ga0105249_10116854
416 Ga0105239_10096984
417 Ga0163162_10037763
418 Ga0163163_10020720
419 Ga0157380_10108764
420 Ga0157379_10030742
421 Ga0206356_10329217
422 Ga0213875_10000092
423 Ga0213875_10017363
424 Ga0224712_10044258
425 Ga0207692_10000005
426 Ga0207688_10001363
427 Ga0207688_10051734
428 Ga0207643_10094958
429 Ga0207671_10005068
430 Ga0207693_10000028
431 Ga0207657_10011064
432 Ga0207657_10025427
433 Ga0207657_10132056
434 Ga0207681_10002565
435 Ga0207664_10000046
436 Ga0207664_10003020
437 Ga0207664_10044618
438 Ga0207690_10000798
439 Ga0207706_10056983
440 Ga0207686_10000048
441 Ga0207709_10192202
442 Ga0207689_10031521
443 Ga0207661_10142825
444 Ga0207712_10204161
445 Ga0207640_10100754
446 Ga0207640_10125640
447 Ga0207677_10030553
448 Ga0207677_10042526
449 Ga0207639_10257763
450 Ga0207678_10141468
451 Ga0207708_10000612
452 Ga0207708_10005059
453 Ga0207708_10045872
454 Ga0207641_10005198
455 Ga0207674_10036294
456 Ga0207675_100026014
457 Ga0207675_100027836
458 Ga0207683_10047975
459 Ga0268264_10029508
460 Ga0265326_10000030
461 Ga0265319_1003699
462 Ga0265334_10000026
463 Ga0265338_10000536
464 Ga0307405_10058608
465 Ga0307405_10088938
466 Ga0307413_10019723
467 Ga0307413_10022424
468 Ga0307410_10008238
469 Ga0307406_10107759
470 Ga0307407_10053948
471 Ga0307412_10031031
472 Ga0307409_100000565
473 Ga0307409_100004880
474 Ga0307409_100020486
475 Ga0307416_100016309
476 Ga0307416_100387748
477 Ga0307414_10028252
478 Ga0307414_10145214
479 Ga0307411_10008066
480 Ga0307415_100000541
481 Ga0307415_100009466
482 Ga0307415_100020945
483 Ga0373932_0027480
484 Ga0373960_0011473
485 Ga0395898_0217569
486 Ga0436364_0527355
487 Ga0395901_0301294
488 Ga0400483_114267
489 Ga0400483_209184
490 Ga0436363_0049173
491 Ga0436363_1720040
492 Ga0466969_0007642
493 Ga0466969_0056315
494 Ga0466966_0004769
495 Ga0466966_0129499
496 Ga0466966_0138930
497 Ga0466961_0002526
498 Ga0466961_0006813
499 Ga0466961_0052285
500 Ga0466961_0094901
501 Ga0466963_0004651
502 Ga0466963_0011773
503 Ga0466963_0022254
504 Ga0466963_0049387
505 Ga0466963_0075890
506 Ga0466963_0084770
507 Ga0466968_0045576
508 Ga0466968_0053273
509 Ga0466968_0056457
510 Ga0466970_0068412
511 Ga0466957_0053273
512 Ga0466960_0026043
513 Ga0466960_0037547
514 Ga0466960_0101112
515 Ga0466959_0005555
516 Ga0466959_0007235
517 Ga0466959_0018730
518 Ga0466959_0048099
519 Ga0466958_0005321
520 Ga0466958_0008649
521 Ga0466958_0051527
522 Ga0466958_0066119
523 Ga0466958_0170578
524 Ga0466967_0002303
525 Ga0466967_0016857
526 Ga0466967_0065479
527 Ga0466967_0071815
528 Ga0466967_0083913
529 Ga0466967_0086457
530 Ga0466967_0090375
531 Ga0466967_0257925
532 Ga0466967_0310434
533 Ga0466967_0434582
534 Ga0495629_0212781
535 Ga0495641_0001037
536 Ga0495653_0011193
537 Ga0495650_0000063
538 Ga0495662_0050176
539 Ga0495664_0001140
540 Ga0495596_0006620
541 Ga0495618_0000054
542 Ga0495630_0000548
543 Ga0495630_0112402
544 Ga0495631_0018414
545 Ga0495644_0037411
546 Ga0495645_0000354
547 Ga0495656_0004068
548 Ga0495657_0000006
549 Ga0495657_0054801
550 Ga0495658_0083875
551 Ga0495613_0000801
552 Ga0495604_0000137
553 Ga0495604_0001012
554 Ga0495604_0009878
555 Ga0495604_0182322
556 Ga0495672_0125555
557 Ga0495676_0033834
558 Ga0495684_0010650
559 Ga0495684_0024254
560 Ga0495686_0000020
561 Ga0495602_0000041
562 Ga0495602_0174796
563 Ga0496101_0001916
564 Ga0496103_0052367
565 Ga0496103_0194692
566 Ga0496104_0000028
567 Ga0496104_0204921
568 Ga0496106_0115104
569 Ga0496107_0026065
570 Ga0496108_0000175
571 Ga0496108_0024242
572 Ga0496109_0000121
573 Ga0496109_0001288
574 Ga0496109_0005014
575 Ga0496109_0012078
576 Ga0496109_0137293
577 Ga0496110_0000666
578 Ga0496110_0002456
579 Ga0496111_0000229
580 Ga0496111_0003511
581 Ga0496111_0179630
582 Ga0496112_0000418
583 Ga0496112_0016928
584 Ga0496112_0017954
585 Ga0496112_0045112
586 Ga0496113_0139673
587 Ga0496113_0286142
588 Ga0496114_0000101
589 Ga0496114_0029564
590 Ga0496115_0000200
591 Ga0496115_0000226
592 Ga0496115_0000350
593 Ga0496115_0058269
594 Ga0496121_0003697
595 Ga0496121_0046834
596 Ga0496124_0138717
597 Ga0496126_0011083
598 Ga0501031_0007032
599 Ga0501031_0131003
600 Ga0501033_0036553
601 Ga0501034_0021900
602 Ga0501034_0032130
603 Ga0501034_0123759
604 Ga0501036_0004652
605 Ga0501036_0047983
606 Ga0501037_0061148
607 Ga0501037_0255585
608 Ga0501038_0024714
609 Ga0501039_0005176
610 Ga0501039_0014617
611 Ga0501040_0045310
612 Ga0501042_0010369
613 Ga0501042_0019959
614 Ga0501042_0056437
615 Ga0501042_0197670
616 Ga0501043_0005658
617 Ga0501046_0006259
618 Ga0501047_0037018
619 Ga0501067_0008817
620 Ga0501068_0023411
621 Ga0501069_0012605
622 Ga0501070_0047585
623 Ga0501071_0028393
624 Ga0501071_0038465
625 Ga0501072_0014032
626 Ga0501072_0024523
627 Ga0501073_0018523
628 Ga0501073_0033525
629 Ga0501074_0020813
630 Ga0501075_0160058
631 Ga0501077_0051400
632 Ga0501077_0089182
633 Ga0501080_0017461
634 Ga0501080_0030416
635 Ga0501080_0174862
636 Ga0501035_0007105
637 Ga0501044_0107655
638 Ga0501045_0131250
639 nmdc:mga03n38_86405_c1
640 nmdc:mga0yw44_28145_c1
641 nmdc:mga05p37_1637_c1
642 nmdc:mga05p37_19701_c1
643 nmdc:mga05p37_349835_c1
644 nmdc:mga05p37_560785_c1
645 nmdc:mga05p37_86918_c1
646 nmdc:mga09592_18270_c1
647 nmdc:mga09592_77822_c1
648 nmdc:mga0qj67_15101_c1
649 nmdc:mga06r32_25826_c1
650 nmdc:mga06r32_32626_c1
651 nmdc:mga06r32_389310_c1
652 nmdc:mga06r32_40709_c1
653 nmdc:mga08y16_20500_c1
654 nmdc:mga08y16_33072_c1
655 nmdc:mga08y16_51472_c1
656 nmdc:mga08y16_99835_c1
657 nmdc:mga0rr50_297822_c1
658 nmdc:mga0a205_15818_c1
659 nmdc:mga0a205_34512_c1
660 Ga0495601_0000013
661 Ga0495601_0000577
662 Ga0495612_0000176
663 Ga0495655_0000001
664 Ga0500556_0001508
665 Ga0500628_000033
666 Ga0500616_0004764
667 Ga0500616_0005144
668 Ga0501084_0058199
669 Ga0501084_0059290
670 Ga0590075_023696
671 Ga0501082_0018334
672 Ga0501082_0105558
673 Ga0466962_0006254
674 Ga0466962_0009389
675 Ga0466962_0103096
676 Ga0530510_0013210

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

247

396

0.8

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

87

206

0.78

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

307

430

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y0k-assembly1.cif.gz_A structure of crotonyl-coa carboxylase/reductase ante in complex with nadp 0.9315 12 400
4y1b-assembly1.cif.gz_A structure of crotonyl-coa carboxylase/reductase ante v350a in complex with nadp 0.9306 11 398
4a0s-assembly1.cif.gz_D structure of the 2-octenoyl-coa carboxylase reductase cinf in complex with nadp and 2-octenoyl-coa 0.9279 15 407
2eih-assembly1.cif.gz_A crystal structure of nad-dependent alcohol dehydrogenase 0.9266 23 397
2eih-assembly1.cif.gz_A crystal structure of nad-dependent alcohol dehydrogenase 0.924 23 397
ID Description Score Start End Superfamily
af_Q5QMG5_99_194_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.936 200 232 3.40.50.720
4a10C02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9265 195 344 3.40.50.720
2eihB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9194 183 343 3.40.50.720
4gi2B01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9156 17 406 3.90.180.10
4a10C02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9117 195 344 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A354Q5Q8-F1-model_v4 NAD(P)H-quinone oxidoreductase 0.9688 160 250 GO:0016651
GO:0070402
AF-A0A5C4JI81-F1-model_v4 Crotonyl-CoA carboxylase/reductase (EC 1.3.1.85) 0.9461 23 407 GO:0043880
AF-A0A554UGD4-F1-model_v4 deleted 0.9451 23 408
AF-A0A2E1WXA7-F1-model_v4 Alcohol dehydrogenase 0.9415 143 394 GO:0016491
AF-A0A1F3BNT2-F1-model_v4 Alcohol dehydrogenase 0.9412 23 395 GO:0016491

Map