F413583

General Info

Members Datasets Scaffolds Average Seq Length
338 246 676 216

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100358714|Ga0307409_1003587142
Length 238
Sequence MTSHAVDETATATSSPIGSAGAVATARAEIVRVGRSLHSRGYVHASAGNLSTRAGDDVLITPTDATLGFLEAERISVVAPDGQQRSGDRASKTLALHRRIYAGSAEAGFVIHTHSTHLVALTLSGVYQPGDIVPPLTPYYVMKVGHVPLIPYHRPGHPTVVDLVEQAIADAAGRGTPIRAVMLERLGPVVWGPTADAAMAVLEELEETARLWLLTDRRPEPLPPHAIQELKDTFGAPW

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
136 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
157 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
175 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
176 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
177 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
180 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
181 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
182 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
183 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
196 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
197 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
198 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
213 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
214 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
215 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
217 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
218 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
219 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
220 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
221 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
222 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
223 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
224 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
225 2818991452 Burkholderia cepacia 561 Isolate Unclassified
226 2862574272 Streptomyces sp. AcE210 Isolate Nodule
227 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
228 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
229 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
230 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
231 2928163908 Burkholderia sp. 567 Isolate Unclassified
232 2928170801 Burkholderia sp. 572 Isolate Unclassified
233 2928536128 Burkholderia sola 565 Isolate Unclassified
234 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
235 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
236 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
237 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
238 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
239 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
240 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
241 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
242 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
243 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
244 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
245 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
246 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.12
Metatranscriptomes 0
Isolates 8.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.68
Nodule 0.89
Rhizoplane 1.48
Rhizosphere 76.04
Stem 0
Stem Tuber 0
Unclassified 1.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100358714 3300031995 Bacteria 1378
2 JGI24739J22299_10008043 3300001989 Bacteria 3940
3 JGI25151J46595_10001553 3300003187 Bacteria 15323
4 rootH1_10025618 3300003316 Bacteria 13568
5 rootH2_10018558 3300003320 Bacteria 1578
6 Ga0055532_1000422 3300003758 Bacteria 20282
7 Ga0055532_1000486 3300003758 Bacteria 17734
8 Ga0055532_1000548 3300003758 Bacteria 16029
9 Ga0055527_1000288 3300003760 Bacteria 29471
10 Ga0055527_1000359 3300003760 Bacteria 21867
11 Ga0055535_1000604 3300003761 Bacteria 29593
12 Ga0055535_1000845 3300003761 Bacteria 21867
13 Ga0055542_1000633 3300003762 Bacteria 29593
14 Ga0055542_1000944 3300003762 Bacteria 19122
15 Ga0055529_1000568 3300003763 Bacteria 30261
16 Ga0055529_1000659 3300003763 Bacteria 24478
17 Ga0055526_1011012 3300003771 Bacteria 4132
18 Ga0055537_1004761 3300003773 Bacteria 3798
19 Ga0055524_1000647 3300003775 Bacteria 24696
20 Ga0055528_1001220 3300003790 Bacteria 16479
21 Ga0058692_1016051 3300003856 Bacteria 1674
22 Ga0065714_10075842 3300005288 Bacteria 2859
23 Ga0070658_10018007 3300005327 Bacteria 5650
24 Ga0070676_10007786 3300005328 Bacteria 5756
25 Ga0070690_100290598 3300005330 Bacteria 1169
26 Ga0070677_10101200 3300005333 Bacteria 1271
27 Ga0070677_10115979 3300005333 Bacteria 1202
28 Ga0068869_100012129 3300005334 Bacteria 5683
29 Ga0070680_100240127 3300005336 Bacteria 1531
30 Ga0070660_100000006 3300005339 Bacteria 166714
31 Ga0070660_100000965 3300005339 Bacteria 19234
32 Ga0070687_100216553 3300005343 Bacteria 1170
33 Ga0070675_100589674 3300005354 Bacteria 1007
34 Ga0070671_100543262 3300005355 Bacteria 1002
35 Ga0070674_100342733 3300005356 Bacteria 1204
36 Ga0070673_100043260 3300005364 Bacteria 3479
37 Ga0070673_100185825 3300005364 Bacteria 1782
38 Ga0070659_100000082 3300005366 Bacteria 71707
39 Ga0070659_100807644 3300005366 Bacteria 816
40 Ga0070709_10348899 3300005434 Bacteria 1093
41 Ga0070713_100405179 3300005436 Bacteria 1274
42 Ga0070663_100006199 3300005455 Bacteria 7167
43 Ga0070678_100271881 3300005456 Bacteria 1429
44 Ga0070678_100425027 3300005456 Bacteria 1159
45 Ga0070662_100129323 3300005457 Bacteria 1945
46 Ga0070681_10003713 3300005458 Bacteria 14324
47 Ga0068867_100030456 3300005459 Bacteria 3893
48 Ga0068867_100062936 3300005459 Bacteria 2758
49 Ga0068867_100107085 3300005459 Bacteria 2142
50 Ga0068867_100231253 3300005459 Bacteria 1495
51 Ga0068867_100238393 3300005459 Bacteria 1474
52 Ga0070706_100221268 3300005467 Bacteria 1767
53 Ga0070679_100001120 3300005530 Bacteria 23378
54 Ga0070686_100175438 3300005544 Bacteria 1519
55 Ga0070693_100522726 3300005547 Bacteria 845
56 Ga0070665_100061178 3300005548 Bacteria 3774
57 Ga0070665_100070516 3300005548 Bacteria 3502
58 Ga0068855_100019387 3300005563 Bacteria 8172
59 Ga0068855_100042237 3300005563 Bacteria 5402
60 Ga0068855_100773125 3300005563 Bacteria 1022
61 Ga0070664_100135664 3300005564 Bacteria 2164
62 Ga0068857_100045080 3300005577 Bacteria 3912
63 Ga0068857_100050579 3300005577 Bacteria 3686
64 Ga0068857_100460801 3300005577 Bacteria 1190
65 Ga0068856_100002983 3300005614 Bacteria 17324
66 Ga0068856_100286394 3300005614 Bacteria 1664
67 Ga0068856_100296965 3300005614 Bacteria 1633
68 Ga0068856_101023281 3300005614 Bacteria 844
69 Ga0068852_100002020 3300005616 Bacteria 13822
70 Ga0068852_100910518 3300005616 Bacteria 897
71 Ga0068866_10040445 3300005718 Bacteria 2308
72 Ga0068866_10232145 3300005718 Bacteria 1119
73 Ga0068860_100734623 3300005843 Bacteria 998
74 Ga0068862_100083087 3300005844 Bacteria 2781
75 Ga0068862_100089683 3300005844 Bacteria 2676
76 Ga0081455_10253261 3300005937 Bacteria 1287
77 Ga0070717_10596215 3300006028 Unclassified 1002
78 Ga0075369_10006157 3300006186 Bacteria 4526
79 Ga0075366_10010199 3300006195 Bacteria 5270
80 Ga0075366_10066802 3300006195 Bacteria 2139
81 Ga0075366_10072883 3300006195 Bacteria 2047
82 Ga0075366_10100411 3300006195 Bacteria 1736
83 Ga0075370_10089521 3300006353 Bacteria 1775
84 Ga0075428_100002412 3300006844 Bacteria 20305
85 Ga0075431_100011563 3300006847 Bacteria 8903
86 Ga0068865_100064949 3300006881 Bacteria 2570
87 Ga0099795_10153000 3300007788 Unclassified 946
88 Ga0105251_10004244 3300009011 Bacteria 9889
89 Ga0105244_10119850 3300009036 Bacteria 1275
90 Ga0105250_10002909 3300009092 Bacteria 8367
91 Ga0105240_10002065 3300009093 Bacteria 32902
92 Ga0105240_10002523 3300009093 Bacteria 29393
93 Ga0105240_10009041 3300009093 Bacteria 14148
94 Ga0105240_10018427 3300009093 Bacteria 9372
95 Ga0105245_10300945 3300009098 Bacteria 1574
96 Ga0114129_10275997 3300009147 Bacteria 2247
97 Ga0105243_10020397 3300009148 Bacteria 5026
98 Ga0105242_10001707 3300009176 Bacteria 17362
99 Ga0105248_10132506 3300009177 Bacteria 2812
100 Ga0105237_10001734 3300009545 Bacteria 28197
101 Ga0105237_10018081 3300009545 Bacteria 7301
102 Ga0105237_10112557 3300009545 Bacteria 2714
103 Ga0105238_10001410 3300009551 Bacteria 24084
104 Ga0105238_10051850 3300009551 Bacteria 4125
105 Ga0105238_10407460 3300009551 Bacteria 1353
106 Ga0105249_11016940 3300009553 Bacteria 898
107 Ga0105239_10001342 3300010375 Bacteria 33155
108 Ga0105239_10917583 3300010375 Bacteria 1005
109 Ga0157373_10010249 3300013100 Bacteria 6904
110 Ga0157370_10004909 3300013104 Bacteria 15153
111 Ga0157369_10111187 3300013105 Bacteria 2912
112 Ga0157369_10658774 3300013105 Bacteria 1079
113 Ga0157374_10014937 3300013296 Bacteria 6805
114 Ga0157378_11232655 3300013297 Bacteria 788
115 Ga0157372_10002510 3300013307 Bacteria 19901
116 Ga0157372_10069982 3300013307 Bacteria 3947
117 Ga0157375_10603419 3300013308 Bacteria 1257
118 Ga0157379_10376612 3300014968 Bacteria 1302
119 Ga0182006_1053191 3300015261 Bacteria 1553
120 Ga0182007_10014332 3300015262 Bacteria 2993
121 Ga0163161_10019408 3300017792 Bacteria 4769
122 Ga0209566_100917 3300025225 Bacteria 13777
123 Ga0209674_101407 3300025226 Bacteria 6431
124 Ga0209672_100020 3300025228 Bacteria 429003
125 Ga0209672_100066 3300025228 Bacteria 189828
126 Ga0209672_108994 3300025228 Bacteria 1438
127 Ga0209147_100024 3300025229 Bacteria 429003
128 Ga0209147_100084 3300025229 Bacteria 189828
129 Ga0209147_100562 3300025229 Bacteria 20865
130 Ga0209258_100084 3300025242 Bacteria 244783
131 Ga0209258_100117 3300025242 Bacteria 189828
132 Ga0209148_1000442 3300025254 Bacteria 45703
133 Ga0209148_1000644 3300025254 Bacteria 30313
134 Ga0209759_1004404 3300025256 Bacteria 5275
135 Ga0209565_1000066 3300025263 Bacteria 173062
136 Ga0209455_1000110 3300025272 Bacteria 189828
137 Ga0209455_1000414 3300025272 Bacteria 34168
138 Ga0209455_1000627 3300025272 Bacteria 21920
139 Ga0209673_1000057 3300025273 Bacteria 270150
140 Ga0209675_1000930 3300025291 Bacteria 18669
141 Ga0209675_1006100 3300025291 Bacteria 4909
142 Ga0209025_1003952 3300025294 Bacteria 13303
143 Ga0209564_1001787 3300025295 Bacteria 19890
144 Ga0209758_1010144 3300025297 Bacteria 5696
145 Ga0209256_1000600 3300025299 Bacteria 50120
146 Ga0209256_1001560 3300025299 Bacteria 22629
147 Ga0209051_1062249 3300025303 Bacteria 1168
148 Ga0207696_1007555 3300025711 Bacteria 4240
149 Ga0207696_1011009 3300025711 Bacteria 3283
150 Ga0207682_10006158 3300025893 Bacteria 4847
151 Ga0207642_10184060 3300025899 Bacteria 1141
152 Ga0207647_10014824 3300025904 Bacteria 5362
153 Ga0207699_10321269 3300025906 Bacteria 1086
154 Ga0207645_10005869 3300025907 Bacteria 8845
155 Ga0207705_10008289 3300025909 Bacteria 7592
156 Ga0207705_10131768 3300025909 Bacteria 1861
157 Ga0207707_10008247 3300025912 Bacteria 9045
158 Ga0207695_10001034 3300025913 Bacteria 48892
159 Ga0207695_10004360 3300025913 Bacteria 19376
160 Ga0207695_10012371 3300025913 Bacteria 10250
161 Ga0207671_10044649 3300025914 Bacteria 3278
162 Ga0207671_10354068 3300025914 Bacteria 1164
163 Ga0207660_10208256 3300025917 Bacteria 1530
164 Ga0207657_10000003 3300025919 Bacteria 263148
165 Ga0207657_10001776 3300025919 Bacteria 23290
166 Ga0207652_10001985 3300025921 Bacteria 17706
167 Ga0207652_10382929 3300025921 Bacteria 1269
168 Ga0207694_10007403 3300025924 Bacteria 8325
169 Ga0207694_10053339 3300025924 Bacteria 3135
170 Ga0207659_10051046 3300025926 Bacteria 2940
171 Ga0207659_10216549 3300025926 Bacteria 1537
172 Ga0207644_10034000 3300025931 Bacteria 3567
173 Ga0207644_10561491 3300025931 Bacteria 945
174 Ga0207690_10000007 3300025932 Bacteria 388533
175 Ga0207706_10145881 3300025933 Bacteria 2082
176 Ga0207686_10001711 3300025934 Bacteria 12224
177 Ga0207709_10111648 3300025935 Bacteria 1829
178 Ga0207669_10116855 3300025937 Bacteria 1801
179 Ga0207691_10032476 3300025940 Bacteria 4866
180 Ga0207691_10034663 3300025940 Bacteria 4692
181 Ga0207691_10514520 3300025940 Bacteria 1016
182 Ga0207689_10018692 3300025942 Bacteria 5845
183 Ga0207667_10003444 3300025949 Bacteria 19522
184 Ga0207667_10036084 3300025949 Bacteria 5301
185 Ga0207658_10018517 3300025986 Bacteria 4810
186 Ga0207678_10001015 3300026067 Bacteria 25611
187 Ga0207702_10006926 3300026078 Bacteria 9709
188 Ga0207702_10365193 3300026078 Bacteria 1384
189 Ga0207648_10015068 3300026089 Bacteria 7119
190 Ga0207648_10016378 3300026089 Bacteria 6774
191 Ga0207648_10087409 3300026089 Bacteria 2720
192 Ga0207648_10103885 3300026089 Bacteria 2492
193 Ga0207648_10313185 3300026089 Bacteria 1409
194 Ga0207674_10005973 3300026116 Bacteria 14412
195 Ga0207674_10201771 3300026116 Bacteria 1938
196 Ga0207683_10050579 3300026121 Bacteria 3641
197 Ga0207683_10063863 3300026121 Bacteria 3244
198 Ga0207683_10365656 3300026121 Bacteria 1325
199 Ga0207698_10011334 3300026142 Bacteria 5773
200 Ga0207698_10132219 3300026142 Bacteria 2134
201 Ga0207698_10158856 3300026142 Bacteria 1974
202 Ga0207698_10172554 3300026142 Bacteria 1906
203 Ga0209371_1000255 3300027312 Bacteria 64538
204 Ga0268266_10221517 3300028379 Bacteria 1739
205 Ga0268265_10113266 3300028380 Bacteria 2219
206 Ga0265336_10025545 3300028666 Unclassified 1860
207 Ga0265338_10030681 3300028800 Bacteria 5287
208 Ga0265338_10078202 3300028800 Unclassified 2791
209 Ga0268256_1000210 3300030500 Bacteria 65841
210 Ga0265330_10007809 3300031235 Bacteria 5190
211 Ga0265332_10015028 3300031238 Bacteria 3422
212 Ga0265325_10004021 3300031241 Bacteria 9390
213 Ga0265339_10185634 3300031249 Bacteria 1033
214 Ga0307513_10026344 3300031456 Bacteria 6706
215 Ga0307509_10164174 3300031507 Bacteria 2113
216 Ga0307408_100641238 3300031548 Bacteria 949
217 Ga0265313_10005985 3300031595 Bacteria 8787
218 Ga0265314_10000552 3300031711 Bacteria 47809
219 Ga0265342_10005622 3300031712 Bacteria 9490
220 Ga0307410_10272347 3300031852 Bacteria 1325
221 Ga0307406_10283565 3300031901 Bacteria 1265
222 Ga0307406_10508825 3300031901 Bacteria 978
223 Ga0307414_10923495 3300032004 Bacteria 801
224 Ga0307411_10623304 3300032005 Bacteria 930
225 Ga0307415_100384533 3300032126 Bacteria 1193
226 Ga0307510_10015777 3300033180 Bacteria 8931
227 Ga0373929_0048328 3300035085 Bacteria 966
228 Ga0373931_0332056 3300035691 Bacteria 947
229 Ga0395905_0002320 3300037471 Bacteria 21297
230 Ga0395905_0013468 3300037471 Bacteria 7837
231 Ga0395905_0141011 3300037471 Bacteria 2267
232 Ga0451853_0032473 3300041512 Bacteria 909
233 Ga0439432_017591 3300042006 Bacteria 2397
234 Ga0450896_018564 3300042133 Bacteria 1009
235 Ga0451577_0012180 3300042876 Bacteria 8086
236 Ga0451577_0772276 3300042876 Bacteria 869
237 Ga0466969_0002024 3300044656 Bacteria 10823
238 Ga0466973_0024812 3300044659 Bacteria 5750
239 Ga0466965_0017038 3300044683 Bacteria 3467
240 Ga0466965_0066682 3300044683 Bacteria 1805
241 Ga0466961_0053811 3300044693 Bacteria 2567
242 Ga0466961_0226490 3300044693 Bacteria 1151
243 Ga0466963_0000069 3300044694 Bacteria 35701
244 Ga0466971_0001214 3300044719 Bacteria 10720
245 Ga0466970_0031883 3300044765 Bacteria 2784
246 Ga0466957_0003376 3300044842 Bacteria 8767
247 Ga0466959_0030887 3300045049 Bacteria 3966
248 Ga0451576_0646742 3300045051 Bacteria 1111
249 Ga0466958_0078641 3300045836 Bacteria 2027
250 Ga0495603_0002758 3300046455 Bacteria 10350
251 Ga0495603_0044046 3300046455 Bacteria 2663
252 Ga0495590_0013851 3300046457 Bacteria 2956
253 Ga0495638_0026589 3300046460 Bacteria 3749
254 Ga0495638_0145534 3300046460 Bacteria 1379
255 Ga0495651_0000983 3300046462 Bacteria 22103
256 Ga0495650_0006343 3300046471 Bacteria 7391
257 Ga0495616_0035431 3300046513 Bacteria 2582
258 Ga0495632_0000963 3300046519 Bacteria 25144
259 Ga0495637_0006338 3300046520 Bacteria 5945
260 Ga0495648_0024838 3300046524 Bacteria 4069
261 Ga0495642_0000154 3300046528 Bacteria 39891
262 Ga0495654_0009615 3300046530 Bacteria 5295
263 Ga0495597_0000116 3300046542 Bacteria 72210
264 Ga0495633_0049648 3300046558 Bacteria 1980
265 Ga0495656_0091960 3300046615 Bacteria 1388
266 Ga0495611_0134126 3300046648 Bacteria 1155
267 Ga0495611_0171456 3300046648 Bacteria 1014
268 Ga0495625_0039840 3300046660 Bacteria 3429
269 Ga0495625_0073588 3300046660 Bacteria 2394
270 Ga0495659_0008512 3300046664 Bacteria 3264
271 Ga0495661_0167693 3300046665 Bacteria 1174
272 Ga0495669_0007480 3300046684 Bacteria 4580
273 Ga0495670_0066087 3300046691 Bacteria 1824
274 Ga0495671_0084661 3300046692 Bacteria 1553
275 Ga0495649_0110029 3300046694 Bacteria 1461
276 Ga0495589_0007879 3300046794 Bacteria 5577
277 Ga0495589_0012538 3300046794 Bacteria 4388
278 Ga0495676_0012801 3300047321 Bacteria 7544
279 Ga0495676_0048604 3300047321 Bacteria 3418
280 Ga0495683_0068222 3300047323 Bacteria 1749
281 Ga0495683_0178370 3300047323 Bacteria 972
282 Ga0495677_0002221 3300047445 Bacteria 7680
283 Ga0495677_0098410 3300047445 Bacteria 1106
284 Ga0495679_002218 3300047446 Bacteria 10112
285 Ga0495685_004069 3300047447 Bacteria 4701
286 Ga0495681_0035058 3300047470 Bacteria 2495
287 Ga0496126_0001121 3300048929 Bacteria 44841
288 Ga0496126_0004764 3300048929 Bacteria 15975
289 Ga0496126_0043586 3300048929 Bacteria 4138
290 Ga0495678_060997 3300049459 Bacteria 1416
291 Ga0501032_0105974 3300049569 Bacteria 1862
292 Ga0501034_0708356 3300049571 Bacteria 905
293 Ga0501043_0001751 3300049579 Bacteria 18712
294 Ga0501046_0008135 3300049580 Bacteria 9161
295 Ga0501047_0000546 3300049581 Bacteria 40630
296 Ga0501048_0000832 3300049582 Bacteria 22775
297 Ga0501035_0004633 3300049822 Bacteria 13044
298 Ga0501035_0011407 3300049822 Bacteria 8239
299 Ga0501044_0000045 3300049823 Bacteria 148353
300 Ga0501045_0047356 3300049824 Bacteria 3132
301 nmdc:mga0k408_1020_c1 3300050493 Bacteria 15354
302 nmdc:mga0k408_121964_c1 3300050493 Bacteria 1544
303 nmdc:mga06r32_149103_c1 3300050510 Bacteria 2317
304 nmdc:mga0sz30_53102_c1 3300050516 Bacteria 1721
305 Ga0500578_0032015 3300053086 Bacteria 3381
306 Ga0500651_0000787 3300053093 Bacteria 15478
307 Ga0500645_006873 3300053730 Bacteria 4018
308 Ga0466962_0014425 3300061719 Bacteria 3808
309 2515680183 2515154122 Bacteria 8609520
310 2599741461 2599185239 Bacteria 8686614
311 2599748777 2599185240 Bacteria 7968121
312 2600210678 2599185355 Bacteria 7968906
313 2623589263 2622736626 Bacteria 7181580
314 2644302454 2643221654 Bacteria 5273570
315 2676746937 2675903129 Bacteria 7964495
316 2793985500 2791355406 Bacteria 11364898
317 2819635130 2818991452 Bacteria 8442785
318 2862584039 2862574272 Bacteria 10567477
319 2863427178 2863421361 Bacteria 7300805
320 2870073615 2870068957 Bacteria 8925310
321 2921647882 2921643360 Bacteria 11448031
322 2928158319 2928157003 Bacteria 7522202
323 2928167476 2928163908 Bacteria 7561269
324 2928178322 2928170801 Bacteria 8785406
325 2928543014 2928536128 Bacteria 7657547
326 2981991781 2981990288 Bacteria 7590678
327 642414554 641736154 Bacteria 7689995
328 8018852529 8018845410 Bacteria 8933938
329 8020943352 8020938398 Bacteria 7472757
330 8020952718 8020945358 Bacteria 8467355
331 8020954543 8020953355 Bacteria 7439080
332 8021123806 8021120328 Bacteria 8782274
333 8039100617 8039098773 Bacteria 6602928
334 8047903625 8047893842 Bacteria 11723082
335 8048131988 8048127548 Bacteria 11053136
336 8048356887 8048356638 Bacteria 11044339
337 8048378938 8048369669 Bacteria 11666822
338 8048388041 8048379754 Bacteria 11877923
339 Ga0307409_100358714
340 JGI24739J22299_10008043
341 JGI25151J46595_10001553
342 rootH1_10025618
343 rootH2_10018558
344 Ga0055532_1000422
345 Ga0055532_1000486
346 Ga0055532_1000548
347 Ga0055527_1000288
348 Ga0055527_1000359
349 Ga0055535_1000604
350 Ga0055535_1000845
351 Ga0055542_1000633
352 Ga0055542_1000944
353 Ga0055529_1000568
354 Ga0055529_1000659
355 Ga0055526_1011012
356 Ga0055537_1004761
357 Ga0055524_1000647
358 Ga0055528_1001220
359 Ga0058692_1016051
360 Ga0065714_10075842
361 Ga0070658_10018007
362 Ga0070676_10007786
363 Ga0070690_100290598
364 Ga0070677_10101200
365 Ga0070677_10115979
366 Ga0068869_100012129
367 Ga0070680_100240127
368 Ga0070660_100000006
369 Ga0070660_100000965
370 Ga0070687_100216553
371 Ga0070675_100589674
372 Ga0070671_100543262
373 Ga0070674_100342733
374 Ga0070673_100043260
375 Ga0070673_100185825
376 Ga0070659_100000082
377 Ga0070659_100807644
378 Ga0070709_10348899
379 Ga0070713_100405179
380 Ga0070663_100006199
381 Ga0070678_100271881
382 Ga0070678_100425027
383 Ga0070662_100129323
384 Ga0070681_10003713
385 Ga0068867_100030456
386 Ga0068867_100062936
387 Ga0068867_100107085
388 Ga0068867_100231253
389 Ga0068867_100238393
390 Ga0070706_100221268
391 Ga0070679_100001120
392 Ga0070686_100175438
393 Ga0070693_100522726
394 Ga0070665_100061178
395 Ga0070665_100070516
396 Ga0068855_100019387
397 Ga0068855_100042237
398 Ga0068855_100773125
399 Ga0070664_100135664
400 Ga0068857_100045080
401 Ga0068857_100050579
402 Ga0068857_100460801
403 Ga0068856_100002983
404 Ga0068856_100286394
405 Ga0068856_100296965
406 Ga0068856_101023281
407 Ga0068852_100002020
408 Ga0068852_100910518
409 Ga0068866_10040445
410 Ga0068866_10232145
411 Ga0068860_100734623
412 Ga0068862_100083087
413 Ga0068862_100089683
414 Ga0081455_10253261
415 Ga0070717_10596215
416 Ga0075369_10006157
417 Ga0075366_10010199
418 Ga0075366_10066802
419 Ga0075366_10072883
420 Ga0075366_10100411
421 Ga0075370_10089521
422 Ga0075428_100002412
423 Ga0075431_100011563
424 Ga0068865_100064949
425 Ga0099795_10153000
426 Ga0105251_10004244
427 Ga0105244_10119850
428 Ga0105250_10002909
429 Ga0105240_10002065
430 Ga0105240_10002523
431 Ga0105240_10009041
432 Ga0105240_10018427
433 Ga0105245_10300945
434 Ga0114129_10275997
435 Ga0105243_10020397
436 Ga0105242_10001707
437 Ga0105248_10132506
438 Ga0105237_10001734
439 Ga0105237_10018081
440 Ga0105237_10112557
441 Ga0105238_10001410
442 Ga0105238_10051850
443 Ga0105238_10407460
444 Ga0105249_11016940
445 Ga0105239_10001342
446 Ga0105239_10917583
447 Ga0157373_10010249
448 Ga0157370_10004909
449 Ga0157369_10111187
450 Ga0157369_10658774
451 Ga0157374_10014937
452 Ga0157378_11232655
453 Ga0157372_10002510
454 Ga0157372_10069982
455 Ga0157375_10603419
456 Ga0157379_10376612
457 Ga0182006_1053191
458 Ga0182007_10014332
459 Ga0163161_10019408
460 Ga0209566_100917
461 Ga0209674_101407
462 Ga0209672_100020
463 Ga0209672_100066
464 Ga0209672_108994
465 Ga0209147_100024
466 Ga0209147_100084
467 Ga0209147_100562
468 Ga0209258_100084
469 Ga0209258_100117
470 Ga0209148_1000442
471 Ga0209148_1000644
472 Ga0209759_1004404
473 Ga0209565_1000066
474 Ga0209455_1000110
475 Ga0209455_1000414
476 Ga0209455_1000627
477 Ga0209673_1000057
478 Ga0209675_1000930
479 Ga0209675_1006100
480 Ga0209025_1003952
481 Ga0209564_1001787
482 Ga0209758_1010144
483 Ga0209256_1000600
484 Ga0209256_1001560
485 Ga0209051_1062249
486 Ga0207696_1007555
487 Ga0207696_1011009
488 Ga0207682_10006158
489 Ga0207642_10184060
490 Ga0207647_10014824
491 Ga0207699_10321269
492 Ga0207645_10005869
493 Ga0207705_10008289
494 Ga0207705_10131768
495 Ga0207707_10008247
496 Ga0207695_10001034
497 Ga0207695_10004360
498 Ga0207695_10012371
499 Ga0207671_10044649
500 Ga0207671_10354068
501 Ga0207660_10208256
502 Ga0207657_10000003
503 Ga0207657_10001776
504 Ga0207652_10001985
505 Ga0207652_10382929
506 Ga0207694_10007403
507 Ga0207694_10053339
508 Ga0207659_10051046
509 Ga0207659_10216549
510 Ga0207644_10034000
511 Ga0207644_10561491
512 Ga0207690_10000007
513 Ga0207706_10145881
514 Ga0207686_10001711
515 Ga0207709_10111648
516 Ga0207669_10116855
517 Ga0207691_10032476
518 Ga0207691_10034663
519 Ga0207691_10514520
520 Ga0207689_10018692
521 Ga0207667_10003444
522 Ga0207667_10036084
523 Ga0207658_10018517
524 Ga0207678_10001015
525 Ga0207702_10006926
526 Ga0207702_10365193
527 Ga0207648_10015068
528 Ga0207648_10016378
529 Ga0207648_10087409
530 Ga0207648_10103885
531 Ga0207648_10313185
532 Ga0207674_10005973
533 Ga0207674_10201771
534 Ga0207683_10050579
535 Ga0207683_10063863
536 Ga0207683_10365656
537 Ga0207698_10011334
538 Ga0207698_10132219
539 Ga0207698_10158856
540 Ga0207698_10172554
541 Ga0209371_1000255
542 Ga0268266_10221517
543 Ga0268265_10113266
544 Ga0265336_10025545
545 Ga0265338_10030681
546 Ga0265338_10078202
547 Ga0268256_1000210
548 Ga0265330_10007809
549 Ga0265332_10015028
550 Ga0265325_10004021
551 Ga0265339_10185634
552 Ga0307513_10026344
553 Ga0307509_10164174
554 Ga0307408_100641238
555 Ga0265313_10005985
556 Ga0265314_10000552
557 Ga0265342_10005622
558 Ga0307410_10272347
559 Ga0307406_10283565
560 Ga0307406_10508825
561 Ga0307414_10923495
562 Ga0307411_10623304
563 Ga0307415_100384533
564 Ga0307510_10015777
565 Ga0373929_0048328
566 Ga0373931_0332056
567 Ga0395905_0002320
568 Ga0395905_0013468
569 Ga0395905_0141011
570 Ga0451853_0032473
571 Ga0439432_017591
572 Ga0450896_018564
573 Ga0451577_0012180
574 Ga0451577_0772276
575 Ga0466969_0002024
576 Ga0466973_0024812
577 Ga0466965_0017038
578 Ga0466965_0066682
579 Ga0466961_0053811
580 Ga0466961_0226490
581 Ga0466963_0000069
582 Ga0466971_0001214
583 Ga0466970_0031883
584 Ga0466957_0003376
585 Ga0466959_0030887
586 Ga0451576_0646742
587 Ga0466958_0078641
588 Ga0495603_0002758
589 Ga0495603_0044046
590 Ga0495590_0013851
591 Ga0495638_0026589
592 Ga0495638_0145534
593 Ga0495651_0000983
594 Ga0495650_0006343
595 Ga0495616_0035431
596 Ga0495632_0000963
597 Ga0495637_0006338
598 Ga0495648_0024838
599 Ga0495642_0000154
600 Ga0495654_0009615
601 Ga0495597_0000116
602 Ga0495633_0049648
603 Ga0495656_0091960
604 Ga0495611_0134126
605 Ga0495611_0171456
606 Ga0495625_0039840
607 Ga0495625_0073588
608 Ga0495659_0008512
609 Ga0495661_0167693
610 Ga0495669_0007480
611 Ga0495670_0066087
612 Ga0495671_0084661
613 Ga0495649_0110029
614 Ga0495589_0007879
615 Ga0495589_0012538
616 Ga0495676_0012801
617 Ga0495676_0048604
618 Ga0495683_0068222
619 Ga0495683_0178370
620 Ga0495677_0002221
621 Ga0495677_0098410
622 Ga0495679_002218
623 Ga0495685_004069
624 Ga0495681_0035058
625 Ga0496126_0001121
626 Ga0496126_0004764
627 Ga0496126_0043586
628 Ga0495678_060997
629 Ga0501032_0105974
630 Ga0501034_0708356
631 Ga0501043_0001751
632 Ga0501046_0008135
633 Ga0501047_0000546
634 Ga0501048_0000832
635 Ga0501035_0004633
636 Ga0501035_0011407
637 Ga0501044_0000045
638 Ga0501045_0047356
639 nmdc:mga0k408_1020_c1
640 nmdc:mga0k408_121964_c1
641 nmdc:mga06r32_149103_c1
642 nmdc:mga0sz30_53102_c1
643 Ga0500578_0032015
644 Ga0500651_0000787
645 Ga0500645_006873
646 Ga0466962_0014425
647 2515680183
648 2599741461
649 2599748777
650 2600210678
651 2623589263
652 2644302454
653 2676746937
654 2793985500
655 2819635130
656 2862584039
657 2863427178
658 2870073615
659 2921647882
660 2928158319
661 2928167476
662 2928178322
663 2928543014
664 2981991781
665 642414554
666 8018852529
667 8020943352
668 8020952718
669 8020954543
670 8021123806
671 8039100617
672 8047903625
673 8048131988
674 8048356887
675 8048378938
676 8048388041

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

28

213

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vop-assembly1.cif.gz_A crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from escherichia coli 0.9448 4 205
6voq-assembly1.cif.gz_A crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from klebsiella pneumoniae 0.9412 4 205
6vop-assembly1.cif.gz_A crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from escherichia coli 0.9185 4 205
6voq-assembly1.cif.gz_A crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from klebsiella pneumoniae 0.915 4 205
2opi-assembly1.cif.gz_B crystal structure of l-fuculose-1-phosphate aldolase from bacteroides thetaiotaomicron 0.8944 9 207
ID Description Score Start End Superfamily
af_Q46890_7_212_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9466 4 205 3.40.225.10
af_Q46890_7_212_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9245 4 205 3.40.225.10
af_Q58813_1_180_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9004 8 188 3.40.225.10
af_P95075_7_208_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8946 8 204 3.40.225.10
6btgA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8901 5 208 3.40.225.10
ID Description Score Start End GO Terms
AF-A0A3M4JP80-F1-model_v4 3-oxo-tetronate 4-phosphate decarboxylase (EC 4.1.1.104) 0.9961 3 212 GO:0005829
GO:0016832
GO:0019323
GO:0046872
AF-A0A2N5C5S4-F1-model_v4 3-oxo-tetronate 4-phosphate decarboxylase (EC 4.1.1.104) 0.996 1 212 GO:0005829
GO:0016832
GO:0019323
GO:0046872
AF-A0A3N8E765-F1-model_v4 3-oxo-tetronate 4-phosphate decarboxylase (EC 4.1.1.104) 0.9947 1 212 GO:0005829
GO:0016832
GO:0019323
GO:0046872
AF-A0A2N5C5S4-F1-model_v4 3-oxo-tetronate 4-phosphate decarboxylase (EC 4.1.1.104) 0.9913 1 212 GO:0005829
GO:0016832
GO:0019323
GO:0046872
AF-A0A656H5S0-F1-model_v4 deleted 0.989 115 212

Map