F413507

General Info

Members Datasets Scaffolds Average Seq Length
338 224 328 281

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10025032|Ga0163162_100250324
Length 328
Sequence VKAVQKLLAGRSQVTAINNQHHRLPDTLVQSQTRRQRRISQMSRKHLKESPVDATTTKQIRVTRRSPAYWRVSFDNPPLNVMGPKMVQEFQELIDSIEADHALKVVVFDSAVDGFFLNHSDFKARLEDMTSLPAGPTGLPPWPDFLVRLTRAPVASIALIRGRATGNGSEITLACDMAFASREKAVISQWEVGVGMVAGGGPMARLPQLIGRNRAMEVLLSSDDIRAEQAEAYGYVNRSLPDAELDACVDALAIRISGFDKWAIAQTKRLVNTSLPPDVELGAGWDACIASLGRSAAQQGIERLTALGFQAPGDVEDRLGFHLGQIRR

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2643221584 Caulobacter sp. Root656 Isolate Unclassified
4 2739367700 Dyella sp. YR388 Isolate Unclassified
5 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
6 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
7 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
8 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
9 2928963466 Dyella japonica 1073 Isolate Unclassified
10 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
67 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
68 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
124 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
125 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
126 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
142 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
143 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
144 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
145 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
146 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
151 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
162 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
209 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
218 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
219 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.38
Metatranscriptomes 2.66
Isolates 2.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.47
Nodule 1.48
Rhizoplane 5.62
Rhizosphere 73.37
Stem 0
Stem Tuber 0
Unclassified 10.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000490 3300002737 Bacteria 30149
2 JGI25159J45721_1006449 3300002987 Bacteria 3508
3 JGI25160J50197_1000025 3300003354 Bacteria 186706
4 JGI25160J50197_1002716 3300003354 Bacteria 8138
5 Ga0055527_1004941 3300003760 Unclassified 1783
6 Ga0055542_1000082 3300003762 Bacteria 128120
7 Ga0055526_1003729 3300003771 Bacteria 9515
8 Ga0055530_10016950 3300003791 Bacteria 2298
9 Ga0055531_10000767 3300003794 Bacteria 26793
10 Ga0065165_1000173 3300005262 Bacteria 114553
11 Ga0065715_10135896 3300005293 Unclassified 1924
12 Ga0070658_10000132 3300005327 Bacteria 66111
13 Ga0070683_100300828 3300005329 Bacteria 1526
14 Ga0070661_100067709 3300005344 Bacteria 2624
15 Ga0070709_10301515 3300005434 Bacteria 1170
16 Ga0070714_100505347 3300005435 Bacteria 1153
17 Ga0070713_100000454 3300005436 Bacteria 26216
18 Ga0070713_100086520 3300005436 Bacteria 2687
19 Ga0070713_100091907 3300005436 Bacteria 2611
20 Ga0070705_100042270 3300005440 Bacteria 2605
21 Ga0070694_100147958 3300005444 Bacteria 1712
22 Ga0070707_100286173 3300005468 Bacteria 1602
23 Ga0070707_100544742 3300005468 Bacteria 1122
24 Ga0070698_100085838 3300005471 Bacteria 3134
25 Ga0070698_100162436 3300005471 Bacteria 2177
26 Ga0070699_100048369 3300005518 Bacteria 3680
27 Ga0070679_100003204 3300005530 Bacteria 14950
28 Ga0070684_100197841 3300005535 Bacteria 1830
29 Ga0068853_100000203 3300005539 Bacteria 41915
30 Ga0068853_100001391 3300005539 Bacteria 17485
31 Ga0070665_100193366 3300005548 Bacteria 2035
32 Ga0070704_100010999 3300005549 Bacteria 5522
33 Ga0070704_100250056 3300005549 Bacteria 1455
34 Ga0068855_100004107 3300005563 Bacteria 17757
35 Ga0068856_100003050 3300005614 Bacteria 17138
36 Ga0068856_100010369 3300005614 Bacteria 9052
37 Ga0068852_100000082 3300005616 Bacteria 67016
38 Ga0070717_10293630 3300006028 Unclassified 1444
39 Ga0070715_10133149 3300006163 Unclassified 1199
40 Ga0070716_100069825 3300006173 Bacteria 2060
41 Ga0070716_100184234 3300006173 Bacteria 1374
42 Ga0097621_100005575 3300006237 Bacteria 8873
43 Ga0075428_100098346 3300006844 Bacteria 3190
44 Ga0075428_100289399 3300006844 Bacteria 1762
45 Ga0075428_100432309 3300006844 Unclassified 1410
46 Ga0075430_100030010 3300006846 Bacteria 4617
47 Ga0075429_100293524 3300006880 Bacteria 1423
48 Ga0099794_10024220 3300007265 Bacteria 2784
49 Ga0099795_10026663 3300007788 Bacteria 1949
50 Ga0099795_10064710 3300007788 Bacteria 1366
51 Ga0099795_10092909 3300007788 Bacteria 1172
52 Ga0105251_10050415 3300009011 Bacteria 1988
53 Ga0105240_10000001 3300009093 Bacteria 2887840
54 Ga0105240_10001985 3300009093 Bacteria 33800
55 Ga0105240_10003385 3300009093 Bacteria 24799
56 Ga0105240_10139113 3300009093 Unclassified 2905
57 Ga0105240_10172412 3300009093 Bacteria 2561
58 Ga0114129_10104079 3300009147 Bacteria 3923
59 Ga0114129_10166298 3300009147 Bacteria 3010
60 Ga0105241_10000026 3300009174 Bacteria 132695
61 Ga0105242_10730211 3300009176 Bacteria 972
62 Ga0105248_10214125 3300009177 Bacteria 2170
63 Ga0105248_10585228 3300009177 Bacteria 1259
64 Ga0105237_10001153 3300009545 Bacteria 35396
65 Ga0105237_10074344 3300009545 Bacteria 3390
66 Ga0105238_10000218 3300009551 Bacteria 63093
67 Ga0105238_10027464 3300009551 Bacteria 5801
68 Ga0105238_10425587 3300009551 Bacteria 1323
69 Ga0099796_10008948 3300010159 Bacteria 2689
70 Ga0105239_10001628 3300010375 Bacteria 29653
71 Ga0105239_10024776 3300010375 Bacteria 6609
72 Ga0105239_10244325 3300010375 Bacteria 2015
73 Ga0105239_10806582 3300010375 Bacteria 1076
74 Ga0157373_10020382 3300013100 Bacteria 4819
75 Ga0157369_10001028 3300013105 Bacteria 35223
76 Ga0157374_10146668 3300013296 Bacteria 2292
77 Ga0157374_10335453 3300013296 Bacteria 1500
78 Ga0163162_10025032 3300013306 Bacteria 5897
79 Ga0157372_10005707 3300013307 Bacteria 13248
80 Ga0157372_10016409 3300013307 Bacteria 7946
81 Ga0157372_10187447 3300013307 Bacteria 2396
82 Ga0213873_10014177 3300021358 Bacteria 1762
83 Ga0213872_10030340 3300021361 Bacteria 2478
84 Ga0213872_10033772 3300021361 Unclassified 2344
85 Ga0213872_10052883 3300021361 Bacteria 1842
86 Ga0213871_10000001 3300021441 Bacteria 27505
87 Ga0213871_10010837 3300021441 Bacteria 2078
88 Ga0224572_1010401 3300024225 Bacteria 1748
89 Ga0209566_105350 3300025225 Unclassified 1626
90 Ga0209672_101134 3300025228 Bacteria 11083
91 Ga0207427_101484 3300025231 Bacteria 8392
92 Ga0209437_100194 3300025233 Bacteria 121991
93 Ga0209437_106254 3300025233 Bacteria 1989
94 Ga0209258_101958 3300025242 Bacteria 6003
95 Ga0209026_1004863 3300025250 Bacteria 3813
96 Ga0209148_1000002 3300025254 Bacteria 2399500
97 Ga0209148_1001037 3300025254 Bacteria 17334
98 Ga0209759_1004543 3300025256 Bacteria 5134
99 Ga0209233_1002957 3300025261 Bacteria 6064
100 Ga0209455_1000555 3300025272 Bacteria 25247
101 Ga0209455_1008109 3300025272 Bacteria 2887
102 Ga0209455_1010053 3300025272 Bacteria 2434
103 Ga0209130_1000680 3300025284 Bacteria 30690
104 Ga0209564_1002332 3300025295 Bacteria 15360
105 Ga0209050_1001041 3300025298 Bacteria 34372
106 Ga0207426_1000020 3300025302 Bacteria 558084
107 Ga0207426_1000356 3300025302 Bacteria 83393
108 Ga0207426_1063894 3300025302 Bacteria 1049
109 Ga0209051_1005355 3300025303 Bacteria 7536
110 Ga0209257_1000155 3300025304 Bacteria 182928
111 Ga0207697_10029181 3300025315 Bacteria 2257
112 Ga0207705_10000421 3300025909 Bacteria 37107
113 Ga0207705_10294627 3300025909 Bacteria 1243
114 Ga0207654_10000099 3300025911 Bacteria 57684
115 Ga0207695_10000001 3300025913 Bacteria 2888630
116 Ga0207695_10000561 3300025913 Bacteria 76257
117 Ga0207695_10001631 3300025913 Bacteria 36265
118 Ga0207671_10000123 3300025914 Bacteria 119385
119 Ga0207671_10003901 3300025914 Bacteria 14538
120 Ga0207663_10471622 3300025916 Bacteria 971
121 Ga0207649_10001373 3300025920 Bacteria 14418
122 Ga0207652_10042405 3300025921 Bacteria 3873
123 Ga0207646_10148897 3300025922 Bacteria 2110
124 Ga0207646_10176962 3300025922 Bacteria 1927
125 Ga0207694_10000112 3300025924 Bacteria 85385
126 Ga0207694_10013929 3300025924 Bacteria 6063
127 Ga0207694_10042080 3300025924 Bacteria 3523
128 Ga0207694_10191378 3300025924 Bacteria 1662
129 Ga0207659_10228061 3300025926 Bacteria 1501
130 Ga0207700_10001777 3300025928 Bacteria 12232
131 Ga0207700_10057094 3300025928 Bacteria 2942
132 Ga0207664_10491774 3300025929 Bacteria 1098
133 Ga0207686_10180521 3300025934 Bacteria 1496
134 Ga0207709_10007677 3300025935 Bacteria 5983
135 Ga0207665_10048752 3300025939 Bacteria 2845
136 Ga0207711_10145967 3300025941 Bacteria 2132
137 Ga0207711_10423860 3300025941 Bacteria 1238
138 Ga0207661_10262781 3300025944 Bacteria 1538
139 Ga0207667_10008408 3300025949 Bacteria 12266
140 Ga0207667_10053751 3300025949 Bacteria 4237
141 Ga0207640_10007789 3300025981 Bacteria 5917
142 Ga0207639_10000233 3300026041 Bacteria 41490
143 Ga0207702_10004019 3300026078 Bacteria 13211
144 Ga0207702_10004580 3300026078 Bacteria 12256
145 Ga0207648_10079843 3300026089 Bacteria 2854
146 Ga0207675_100042432 3300026118 Bacteria 4247
147 Ga0207698_10000066 3300026142 Bacteria 70450
148 Ga0207698_10204519 3300026142 Bacteria 1771
149 Ga0268264_10244585 3300028381 Unclassified 1663
150 Ga0265338_10000029 3300028800 Bacteria 271824
151 Ga0265338_10004478 3300028800 Bacteria 18845
152 Ga0265338_10131054 3300028800 Bacteria 1980
153 Ga0265324_10001207 3300029957 Bacteria 15337
154 Ga0265770_1003247 3300030878 Bacteria 2208
155 Ga0265765_1000142 3300030879 Bacteria 4434
156 Ga0265760_10000042 3300031090 Bacteria 38544
157 Ga0265328_10093388 3300031239 Bacteria 1112
158 Ga0265325_10147467 3300031241 Bacteria 1115
159 Ga0265329_10044249 3300031242 Bacteria 1423
160 Ga0265340_10133803 3300031247 Bacteria 1136
161 Ga0265331_10015343 3300031250 Unclassified 4047
162 Ga0265331_10043092 3300031250 Bacteria 2187
163 Ga0265331_10112773 3300031250 Bacteria 1246
164 Ga0265327_10026771 3300031251 Bacteria 3333
165 Ga0265316_10025403 3300031344 Bacteria 4944
166 Ga0265316_10128509 3300031344 Bacteria 1910
167 Ga0265314_10001316 3300031711 Bacteria 28132
168 Ga0265314_10008566 3300031711 Bacteria 8746
169 Ga0265314_10017098 3300031711 Bacteria 5702
170 Ga0265314_10107731 3300031711 Bacteria 1777
171 Ga0316215_1002880 3300033544 Bacteria 1632
172 Ga0316212_1004155 3300033547 Bacteria 2098
173 Ga0373934_0005003 3300035086 Bacteria 4916
174 Ga0373941_0097179 3300035115 Bacteria 1020
175 Ga0373954_0002185 3300035118 Bacteria 8132
176 Ga0373956_0001390 3300035119 Bacteria 10008
177 Ga0373957_0005411 3300035120 Bacteria 3955
178 Ga0373955_0000717 3300035172 Bacteria 14245
179 Ga0373933_0001170 3300035724 Bacteria 15566
180 Ga0373937_0003064 3300036401 Bacteria 13975
181 Ga0373937_0502176 3300036401 Unclassified 1152
182 Ga0373937_0670207 3300036401 Bacteria 983
183 Ga0373925_0084165 3300037068 Bacteria 2424
184 Ga0395899_0311868 3300037312 Unclassified 1062
185 Ga0395905_0000082 3300037471 Bacteria 158963
186 Ga0395905_0093899 3300037471 Bacteria 2814
187 Ga0395901_0300686 3300038443 Bacteria 1664
188 Ga0436365_0691988 3300039437 Bacteria 5034
189 Ga0436360_0227599 3300039438 Bacteria 5249
190 Ga0436360_0339996 3300039438 Bacteria 29371
191 Ga0436360_0404019 3300039438 Bacteria 6846
192 Ga0436361_0335019 3300039447 Bacteria 3621
193 Ga0436361_0688452 3300039447 Unclassified 1801
194 Ga0436361_0729633 3300039447 Bacteria 7125
195 Ga0436361_0866182 3300039447 Bacteria 6393
196 Ga0436362_0240508 3300039453 Bacteria 2612
197 Ga0436362_0350759 3300039453 Bacteria 15327
198 Ga0439436_0010327 3300041404 Bacteria 2850
199 Ga0439461_0002126 3300041410 Bacteria 3133
200 Ga0439465_0006223 3300041413 Bacteria 3793
201 Ga0439431_0002193 3300041997 Bacteria 4306
202 Ga0439445_0000857 3300042004 Bacteria 6445
203 Ga0439446_0007686 3300042156 Bacteria 2842
204 Ga0495638_0000065 3300046460 Bacteria 170849
205 Ga0495638_0000134 3300046460 Bacteria 119114
206 Ga0495638_0001868 3300046460 Bacteria 18222
207 Ga0495638_0080549 3300046460 Bacteria 1978
208 Ga0495650_0000007 3300046471 Bacteria 718072
209 Ga0495605_0002597 3300046474 Bacteria 11109
210 Ga0495584_0023771 3300046491 Bacteria 3106
211 Ga0495596_0063183 3300046500 Bacteria 1440
212 Ga0495606_0016997 3300046507 Bacteria 5518
213 Ga0495606_0241635 3300046507 Bacteria 1007
214 Ga0495616_0000044 3300046513 Bacteria 117255
215 Ga0495628_0049427 3300046516 Bacteria 3330
216 Ga0495628_0059943 3300046516 Bacteria 2987
217 Ga0495630_0000829 3300046517 Bacteria 21787
218 Ga0495630_0029948 3300046517 Bacteria 4047
219 Ga0495663_0092623 3300046525 Unclassified 986
220 Ga0495642_0090265 3300046528 Unclassified 1296
221 Ga0495654_0000053 3300046530 Bacteria 145014
222 Ga0495665_0122727 3300046531 Bacteria 1360
223 Ga0495587_0002201 3300046536 Bacteria 13033
224 Ga0495609_0047102 3300046538 Bacteria 1930
225 Ga0495609_0061606 3300046538 Unclassified 1657
226 Ga0495597_0047370 3300046542 Bacteria 1903
227 Ga0495597_0085165 3300046542 Bacteria 1347
228 Ga0495645_0031780 3300046543 Bacteria 3847
229 Ga0495622_0082967 3300046557 Bacteria 1474
230 Ga0495622_0099511 3300046557 Unclassified 1333
231 Ga0495633_0056012 3300046558 Bacteria 1853
232 Ga0495656_0003760 3300046615 Bacteria 5156
233 Ga0495668_0000071 3300046616 Bacteria 168801
234 Ga0495668_0000084 3300046616 Bacteria 153179
235 Ga0495634_0151069 3300046642 Bacteria 1469
236 Ga0495611_0033677 3300046648 Bacteria 2262
237 Ga0495625_0000088 3300046660 Bacteria 150352
238 Ga0495625_0016248 3300046660 Bacteria 5863
239 Ga0495625_0059626 3300046660 Bacteria 2707
240 Ga0495659_0004491 3300046664 Bacteria 4395
241 Ga0495623_0022015 3300046679 Bacteria 4117
242 Ga0495646_0028811 3300046680 Bacteria 3474
243 Ga0495646_0062856 3300046680 Bacteria 2206
244 Ga0495669_0000059 3300046684 Bacteria 76021
245 Ga0495669_0001954 3300046684 Bacteria 8470
246 Ga0495669_0194360 3300046684 Bacteria 969
247 Ga0495624_0002986 3300046690 Bacteria 12654
248 Ga0495670_0098849 3300046691 Unclassified 1501
249 Ga0495671_0049720 3300046692 Bacteria 2089
250 Ga0495649_0001405 3300046694 Bacteria 18177
251 Ga0495589_0051236 3300046794 Bacteria 2041
252 Ga0495604_0001121 3300047317 Bacteria 22236
253 Ga0495604_0129469 3300047317 Bacteria 1816
254 Ga0495604_0266978 3300047317 Bacteria 1161
255 Ga0495674_0051372 3300047319 Bacteria 3634
256 Ga0495672_0018079 3300047320 Bacteria 4693
257 Ga0495672_0043669 3300047320 Bacteria 2693
258 Ga0495683_0081432 3300047323 Bacteria 1578
259 Ga0495675_0011229 3300047444 Bacteria 5619
260 Ga0495675_0263888 3300047444 Bacteria 1031
261 Ga0495679_000036 3300047446 Bacteria 161473
262 Ga0495684_0003920 3300047471 Bacteria 11597
263 Ga0495686_0043263 3300047472 Bacteria 2857
264 Ga0495593_0132969 3300047673 Bacteria 1262
265 Ga0496100_0000094 3300048903 Bacteria 50690
266 Ga0496101_0000181 3300048904 Bacteria 50837
267 Ga0496101_0104223 3300048904 Unclassified 2127
268 Ga0496102_0000066 3300048905 Bacteria 159020
269 Ga0496102_0000397 3300048905 Bacteria 50794
270 Ga0496103_0000102 3300048906 Bacteria 93559
271 Ga0496103_0000361 3300048906 Bacteria 41064
272 Ga0496104_0007784 3300048907 Bacteria 9496
273 Ga0496104_0010650 3300048907 Bacteria 8218
274 Ga0496105_0000233 3300048908 Bacteria 37716
275 Ga0496105_0005340 3300048908 Bacteria 9736
276 Ga0496105_0027809 3300048908 Bacteria 4623
277 Ga0496106_0084974 3300048909 Bacteria 2436
278 Ga0496110_0071009 3300048913 Plasmid 3086
279 Ga0496111_0003214 3300048914 Bacteria 10086
280 Ga0496114_0006489 3300048917 Bacteria 9218
281 Ga0496115_0000054 3300048918 Bacteria 106423
282 Ga0496115_0000072 3300048918 Bacteria 91408
283 Ga0496115_0002159 3300048918 Bacteria 14064
284 Ga0496116_0003534 3300048919 Bacteria 15386
285 Ga0496116_0039993 3300048919 Bacteria 3234
286 Ga0496117_0000210 3300048920 Bacteria 112808
287 Ga0496117_0000225 3300048920 Bacteria 106485
288 Ga0496117_0001056 3300048920 Bacteria 42021
289 Ga0496117_0029297 3300048920 Bacteria 4247
290 Ga0496118_0000197 3300048921 Bacteria 106272
291 Ga0496118_0000788 3300048921 Bacteria 50781
292 Ga0496118_0010020 3300048921 Bacteria 9448
293 Ga0496118_0027203 3300048921 Bacteria 4847
294 Ga0496119_0003058 3300048922 Bacteria 17693
295 Ga0496121_0000279 3300048924 Bacteria 106475
296 Ga0496121_0000457 3300048924 Bacteria 80467
297 Ga0496121_0010426 3300048924 Bacteria 10485
298 Ga0496121_0019642 3300048924 Bacteria 6747
299 Ga0496121_0028257 3300048924 Bacteria 5226
300 Ga0496121_0197219 3300048924 Bacteria 1438
301 Ga0496122_0062187 3300048925 Bacteria 2735
302 Ga0496124_0000240 3300048927 Bacteria 106486
303 Ga0496124_0196328 3300048927 Bacteria 1539
304 Ga0496126_0000083 3300048929 Bacteria 217567
305 Ga0496126_0000295 3300048929 Bacteria 106266
306 Ga0496126_0008588 3300048929 Bacteria 10998
307 Ga0496126_0145554 3300048929 Bacteria 2035
308 Ga0496126_0395105 3300048929 Bacteria 1123
309 Ga0495678_027493 3300049459 Bacteria 2413
310 Ga0495682_0014552 3300049460 Bacteria 2982
311 nmdc:mga05p37_190611_c1 3300050507 Bacteria 2490
312 nmdc:mga05p37_419741_c1 3300050507 Bacteria 1557
313 nmdc:mga05p37_53452_c1 3300050507 Bacteria 4967
314 nmdc:mga09592_122986_c1 3300050508 Bacteria 2230
315 nmdc:mga09592_76088_c1 3300050508 Bacteria 2854
316 nmdc:mga06r32_166601_c1 3300050510 Bacteria 2187
317 nmdc:mga0n895_17924_c1 3300050512 Bacteria 2091
318 nmdc:mga0rr50_594152_c1 3300050513 Bacteria 944
319 nmdc:mga08x19_211666_c1 3300050514 Bacteria 1331
320 nmdc:mga0a205_204558_c1 3300050515 Unclassified 1864
321 Ga0500614_006828 3300053123 Bacteria 2400
322 Ga0500604_0007500 3300053151 Bacteria 2889
323 Ga0587070_001296 3300059491 Bacteria 2538
324 Ga0587073_0005086 3300059492 Bacteria 1934
325 Ga0587083_0000588 3300059505 Bacteria 3410
326 Ga0587067_002943 3300059640 Bacteria 2080
327 Ga0587068_003697 3300059641 Bacteria 1977
328 Ga0587079_000576 3300059647 Bacteria 3410

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10024776 Ga0105239_100247763 249
2 3300025926 Ga0207659_10228061 Ga0207659_102280612 250
3 3300005327 Ga0070658_10000132 Ga0070658_1000013232 255
4 3300025909 Ga0207705_10000421 Ga0207705_100004216 255
5 3300031239 Ga0265328_10093388 Ga0265328_100933881 257
6 3300031250 Ga0265331_10015343 Ga0265331_100153433 257
7 3300009551 Ga0105238_10425587 Ga0105238_104255871 259
8 3300025924 Ga0207694_10191378 Ga0207694_101913782 259
9 3300048904 Ga0496101_0104223 Ga0496101_0104223_990_1868 259
10 3300048905 Ga0496102_0000066 Ga0496102_0000066_48728_49606 259
11 3300048906 Ga0496103_0000102 Ga0496103_0000102_44220_45098 259
12 3300048907 Ga0496104_0010650 Ga0496104_0010650_1816_2694 259
13 3300048908 Ga0496105_0000233 Ga0496105_0000233_28363_29241 259
14 3300048913 Ga0496110_0071009 Ga0496110_0071009_1192_2070 259
15 3300048914 Ga0496111_0003214 Ga0496111_0003214_8401_9279 259
16 3300048917 Ga0496114_0006489 Ga0496114_0006489_6446_7324 259
17 3300048918 Ga0496115_0000054 Ga0496115_0000054_48477_49355 259
18 3300048919 Ga0496116_0003534 Ga0496116_0003534_7026_7904 259
19 3300048920 Ga0496117_0000225 Ga0496117_0000225_57131_58009 259
20 3300048921 Ga0496118_0000197 Ga0496118_0000197_48262_49140 259
21 3300048922 Ga0496119_0003058 Ga0496119_0003058_8587_9465 259
22 3300048924 Ga0496121_0000279 Ga0496121_0000279_48462_49340 259
23 3300048927 Ga0496124_0000240 Ga0496124_0000240_57132_58010 259
24 3300048929 Ga0496126_0000295 Ga0496126_0000295_48274_49152 259
25 3300005539 Ga0068853_100000203 Ga0068853_10000020323 260
26 3300005563 Ga0068855_100004107 Ga0068855_1000041072 260
27 3300005614 Ga0068856_100003050 Ga0068856_1000030504 260
28 3300005616 Ga0068852_100000082 Ga0068852_10000008239 260
29 3300009093 Ga0105240_10003385 Ga0105240_1000338514 260
30 3300009174 Ga0105241_10000026 Ga0105241_1000002693 260
31 3300009545 Ga0105237_10001153 Ga0105237_1000115314 260
32 3300009551 Ga0105238_10000218 Ga0105238_1000021838 260
33 3300010375 Ga0105239_10001628 Ga0105239_100016285 260
34 3300013100 Ga0157373_10020382 Ga0157373_100203823 260
35 3300013105 Ga0157369_10001028 Ga0157369_100010289 260
36 3300013307 Ga0157372_10005707 Ga0157372_1000570710 260
37 3300025911 Ga0207654_10000099 Ga0207654_1000009928 260
38 3300025913 Ga0207695_10000561 Ga0207695_1000056133 260
39 3300025914 Ga0207671_10000123 Ga0207671_1000012319 260
40 3300025920 Ga0207649_10001373 Ga0207649_100013734 260
41 3300025924 Ga0207694_10000112 Ga0207694_1000011226 260
42 3300025949 Ga0207667_10008408 Ga0207667_100084086 260
43 3300025981 Ga0207640_10007789 Ga0207640_100077892 260
44 3300026041 Ga0207639_10000233 Ga0207639_1000023320 260
45 3300026078 Ga0207702_10004580 Ga0207702_100045804 260
46 3300026142 Ga0207698_10000066 Ga0207698_1000006619 260
47 3300005436 Ga0070713_100091907 Ga0070713_1000919072 262
48 3300025928 Ga0207700_10057094 Ga0207700_100570943 262
49 3300007788 Ga0099795_10026663 Ga0099795_100266632 264
50 3300035115 Ga0373941_0097179 Ga0373941_0097179_18_812 264
51 3300046491 Ga0495584_0023771 Ga0495584_0023771_715_1509 264
52 3300046525 Ga0495663_0092623 Ga0495663_0092623_60_854 264
53 3300046538 Ga0495609_0061606 Ga0495609_0061606_345_1139 264
54 3300046648 Ga0495611_0033677 Ga0495611_0033677_1385_2179 264
55 3300046664 Ga0495659_0004491 Ga0495659_0004491_2134_2928 264
56 3300046684 Ga0495669_0194360 Ga0495669_0194360_129_923 264
57 3300046691 Ga0495670_0098849 Ga0495670_0098849_187_981 264
58 3300048909 Ga0496106_0084974 Ga0496106_0084974_315_1109 264
59 3300050507 nmdc:mga05p37_190611_c1 nmdc:mga05p37_190611_c1_122_916 264
60 3300050508 nmdc:mga09592_122986_c1 nmdc:mga09592_122986_c1_600_1394 264
61 3300050508 nmdc:mga09592_76088_c1 nmdc:mga09592_76088_c1_37_831 264
62 3300050512 nmdc:mga0n895_17924_c1 nmdc:mga0n895_17924_c1_74_868 264
63 3300050513 nmdc:mga0rr50_594152_c1 nmdc:mga0rr50_594152_c1_21_815 264
64 3300035086 Ga0373934_0005003 Ga0373934_0005003_2038_2886 265
65 3300035118 Ga0373954_0002185 Ga0373954_0002185_5100_5948 265
66 3300035119 Ga0373956_0001390 Ga0373956_0001390_4695_5543 265
67 3300035120 Ga0373957_0005411 Ga0373957_0005411_3026_3874 265
68 3300035172 Ga0373955_0000717 Ga0373955_0000717_11592_12440 265
69 3300035724 Ga0373933_0001170 Ga0373933_0001170_1135_1983 265
70 3300036401 Ga0373937_0003064 Ga0373937_0003064_3313_4161 265
71 3300046536 Ga0495587_0002201 Ga0495587_0002201_6927_7775 265
72 3300046642 Ga0495634_0151069 Ga0495634_0151069_371_1219 265
73 3300046679 Ga0495623_0022015 Ga0495623_0022015_2060_2908 265
74 3300047317 Ga0495604_0001121 Ga0495604_0001121_6979_7827 265
75 3300047471 Ga0495684_0003920 Ga0495684_0003920_2549_3397 265
76 3300007788 Ga0099795_10092909 Ga0099795_100929091 266
77 3300010159 Ga0099796_10008948 Ga0099796_100089482 266
78 3300046660 Ga0495625_0000088 Ga0495625_0000088_31896_32735 266
79 3300046684 Ga0495669_0000059 Ga0495669_0000059_250_1110 266
80 3300046684 Ga0495669_0001954 Ga0495669_0001954_1531_2391 266
81 3300037068 Ga0373925_0084165 Ga0373925_0084165_1395_2231 267
82 3300046460 Ga0495638_0080549 Ga0495638_0080549_12_815 267
83 3300006028 Ga0070717_10293630 Ga0070717_102936303 269
84 3300028381 Ga0268264_10244585 Ga0268264_102445853 270
85 iso_pu_bacteria 2842298080 2842303677 270
86 iso_pu_bacteria 2857504554 2857509167 270
87 3300003760 Ga0055527_1004941 Ga0055527_10049412 271
88 3300009177 Ga0105248_10214125 Ga0105248_102141253 271
89 3300009177 Ga0105248_10585228 Ga0105248_105852281 271
90 3300025228 Ga0209672_101134 Ga0209672_1011348 271
91 3300025272 Ga0209455_1008109 Ga0209455_10081092 271
92 3300025941 Ga0207711_10145967 Ga0207711_101459672 271
93 3300025941 Ga0207711_10423860 Ga0207711_104238601 271
94 3300039438 Ga0436360_0227599 Ga0436360_0227599_1665_2489 271
95 3300046460 Ga0495638_0000065 Ga0495638_0000065_53769_54605 271
96 3300046507 Ga0495606_0016997 Ga0495606_0016997_89_925 271
97 3300046542 Ga0495597_0085165 Ga0495597_0085165_64_900 271
98 3300046557 Ga0495622_0082967 Ga0495622_0082967_403_1239 271
99 3300046660 Ga0495625_0059626 Ga0495625_0059626_1234_2070 271
100 3300046694 Ga0495649_0001405 Ga0495649_0001405_5625_6461 271
101 3300047472 Ga0495686_0043263 Ga0495686_0043263_1231_2073 271
102 3300048918 Ga0496115_0000072 Ga0496115_0000072_77955_78791 271
103 3300048918 Ga0496115_0002159 Ga0496115_0002159_10661_11497 271
104 3300048919 Ga0496116_0039993 Ga0496116_0039993_1227_2069 271
105 3300048924 Ga0496121_0197219 Ga0496121_0197219_83_925 271
106 3300048929 Ga0496126_0008588 Ga0496126_0008588_2291_3127 271
107 3300048929 Ga0496126_0145554 Ga0496126_0145554_721_1557 271
108 3300049459 Ga0495678_027493 Ga0495678_027493_1226_2062 271
109 3300049460 Ga0495682_0014552 Ga0495682_0014552_265_1101 271
110 iso_pu_bacteria 2503198000 2503202469 271
111 iso_pu_bacteria 2643221584 2643931163 271
112 iso_pu_bacteria 2739367700 2739730502 271
113 iso_pu_bacteria 2844009547 2844012115 271
114 iso_pu_bacteria 2874168670 2874170025 271
115 iso_pu_bacteria 3004268573 3004273344 271
116 3300005435 Ga0070714_100505347 Ga0070714_1005053472 273
117 3300005436 Ga0070713_100000454 Ga0070713_1000004543 273
118 3300025929 Ga0207664_10491774 Ga0207664_104917741 273
119 3300025949 Ga0207667_10053751 Ga0207667_100537512 273
120 3300046474 Ga0495605_0002597 Ga0495605_0002597_1429_2265 273
121 3300046500 Ga0495596_0063183 Ga0495596_0063183_37_873 273
122 3300046516 Ga0495628_0049427 Ga0495628_0049427_349_1185 273
123 3300046517 Ga0495630_0029948 Ga0495630_0029948_1452_2288 273
124 3300046531 Ga0495665_0122727 Ga0495665_0122727_303_1139 273
125 3300046538 Ga0495609_0047102 Ga0495609_0047102_113_949 273
126 3300046542 Ga0495597_0047370 Ga0495597_0047370_191_1027 273
127 3300046680 Ga0495646_0028811 Ga0495646_0028811_382_1218 273
128 3300046680 Ga0495646_0062856 Ga0495646_0062856_1246_2082 273
129 3300046690 Ga0495624_0002986 Ga0495624_0002986_303_1139 273
130 3300046692 Ga0495671_0049720 Ga0495671_0049720_886_1722 273
131 3300046794 Ga0495589_0051236 Ga0495589_0051236_1118_1954 273
132 3300047317 Ga0495604_0266978 Ga0495604_0266978_182_1018 273
133 3300047319 Ga0495674_0051372 Ga0495674_0051372_452_1288 273
134 3300047320 Ga0495672_0043669 Ga0495672_0043669_972_1808 273
135 3300047323 Ga0495683_0081432 Ga0495683_0081432_488_1324 273
136 3300047446 Ga0495679_000036 Ga0495679_000036_63404_64240 273
137 3300047673 Ga0495593_0132969 Ga0495593_0132969_130_966 273
138 3300048907 Ga0496104_0007784 Ga0496104_0007784_5967_6815 273
139 3300048908 Ga0496105_0005340 Ga0496105_0005340_40_888 273
140 3300048920 Ga0496117_0029297 Ga0496117_0029297_3226_4062 273
141 3300048921 Ga0496118_0027203 Ga0496118_0027203_3724_4560 273
142 3300048924 Ga0496121_0010426 Ga0496121_0010426_6799_7647 273
143 3300048924 Ga0496121_0019642 Ga0496121_0019642_1784_2620 273
144 3300048929 Ga0496126_0395105 Ga0496126_0395105_228_1076 273
145 iso_pu_bacteria 2928963466 2928964441 273
146 3300003354 JGI25160J50197_1000025 JGI25160J50197_100002562 274
147 3300005262 Ga0065165_1000173 Ga0065165_100017398 274
148 3300006237 Ga0097621_100005575 Ga0097621_1000055753 274
149 3300007265 Ga0099794_10024220 Ga0099794_100242202 274
150 3300007788 Ga0099795_10064710 Ga0099795_100647102 274
151 3300009011 Ga0105251_10050415 Ga0105251_100504153 274
152 3300009093 Ga0105240_10000001 Ga0105240_100000012192 274
153 3300009093 Ga0105240_10139113 Ga0105240_101391132 274
154 3300009176 Ga0105242_10730211 Ga0105242_107302111 274
155 3300009551 Ga0105238_10027464 Ga0105238_100274644 274
156 3300013307 Ga0157372_10016409 Ga0157372_100164092 274
157 3300021361 Ga0213872_10033772 Ga0213872_100337722 274
158 3300021361 Ga0213872_10052883 Ga0213872_100528832 274
159 3300021441 Ga0213871_10000001 Ga0213871_100000015 274
160 3300025272 Ga0209455_1010053 Ga0209455_10100533 274
161 3300025302 Ga0207426_1000020 Ga0207426_1000020313 274
162 3300025302 Ga0207426_1063894 Ga0207426_10638942 274
163 3300025303 Ga0209051_1005355 Ga0209051_10053553 274
164 3300025909 Ga0207705_10294627 Ga0207705_102946271 274
165 3300025913 Ga0207695_10000001 Ga0207695_100000012195 274
166 3300025916 Ga0207663_10471622 Ga0207663_104716221 274
167 3300028800 Ga0265338_10000029 Ga0265338_1000002927 274
168 3300028800 Ga0265338_10131054 Ga0265338_101310542 274
169 3300029957 Ga0265324_10001207 Ga0265324_100012074 274
170 3300030878 Ga0265770_1003247 Ga0265770_10032472 274
171 3300030879 Ga0265765_1000142 Ga0265765_10001425 274
172 3300031090 Ga0265760_10000042 Ga0265760_1000004220 274
173 3300031241 Ga0265325_10147467 Ga0265325_101474671 274
174 3300031242 Ga0265329_10044249 Ga0265329_100442492 274
175 3300031250 Ga0265331_10043092 Ga0265331_100430922 274
176 3300031344 Ga0265316_10025403 Ga0265316_100254033 274
177 3300031344 Ga0265316_10128509 Ga0265316_101285093 274
178 3300031711 Ga0265314_10008566 Ga0265314_100085669 274
179 3300033547 Ga0316212_1004155 Ga0316212_10041552 274
180 3300036401 Ga0373937_0670207 Ga0373937_0670207_92_958 274
181 3300037471 Ga0395905_0000082 Ga0395905_0000082_145080_145916 274
182 3300037471 Ga0395905_0093899 Ga0395905_0093899_1402_2238 274
183 3300039438 Ga0436360_0339996 Ga0436360_0339996_4046_4900 274
184 3300039447 Ga0436361_0335019 Ga0436361_0335019_2052_2912 274
185 3300039447 Ga0436361_0688452 Ga0436361_0688452_715_1566 274
186 3300039447 Ga0436361_0729633 Ga0436361_0729633_4988_5842 274
187 3300046507 Ga0495606_0241635 Ga0495606_0241635_106_957 274
188 3300046516 Ga0495628_0059943 Ga0495628_0059943_1847_2692 274
189 3300046517 Ga0495630_0000829 Ga0495630_0000829_17922_18767 274
190 3300046543 Ga0495645_0031780 Ga0495645_0031780_1965_2810 274
191 3300047317 Ga0495604_0129469 Ga0495604_0129469_139_984 274
192 3300047320 Ga0495672_0018079 Ga0495672_0018079_494_1345 274
193 3300047444 Ga0495675_0011229 Ga0495675_0011229_4669_5514 274
194 3300047444 Ga0495675_0263888 Ga0495675_0263888_139_984 274
195 3300048903 Ga0496100_0000094 Ga0496100_0000094_40049_40885 274
196 3300048904 Ga0496101_0000181 Ga0496101_0000181_40036_40872 274
197 3300048905 Ga0496102_0000397 Ga0496102_0000397_40011_40847 274
198 3300048906 Ga0496103_0000361 Ga0496103_0000361_40038_40874 274
199 3300048908 Ga0496105_0027809 Ga0496105_0027809_3155_3991 274
200 3300048920 Ga0496117_0000210 Ga0496117_0000210_10040_10876 274
201 3300048920 Ga0496117_0001056 Ga0496117_0001056_9310_10146 274
202 3300048921 Ga0496118_0000788 Ga0496118_0000788_9916_10752 274
203 3300048921 Ga0496118_0010020 Ga0496118_0010020_5646_6482 274
204 3300048924 Ga0496121_0000457 Ga0496121_0000457_69699_70535 274
205 3300048925 Ga0496122_0062187 Ga0496122_0062187_79_915 274
206 3300048927 Ga0496124_0196328 Ga0496124_0196328_103_939 274
207 3300048929 Ga0496126_0000083 Ga0496126_0000083_176103_176939 274
208 3300002987 JGI25159J45721_1006449 JGI25159J45721_10064494 275
209 3300003354 JGI25160J50197_1002716 JGI25160J50197_10027166 275
210 3300003771 Ga0055526_1003729 Ga0055526_10037296 275
211 3300003791 Ga0055530_10016950 Ga0055530_100169502 275
212 3300003794 Ga0055531_10000767 Ga0055531_100007679 275
213 3300005293 Ga0065715_10135896 Ga0065715_101358963 275
214 3300005329 Ga0070683_100300828 Ga0070683_1003008282 275
215 3300005344 Ga0070661_100067709 Ga0070661_1000677093 275
216 3300005434 Ga0070709_10301515 Ga0070709_103015151 275
217 3300005440 Ga0070705_100042270 Ga0070705_1000422703 275
218 3300005444 Ga0070694_100147958 Ga0070694_1001479583 275
219 3300005468 Ga0070707_100286173 Ga0070707_1002861732 275
220 3300005468 Ga0070707_100544742 Ga0070707_1005447422 275
221 3300005471 Ga0070698_100085838 Ga0070698_1000858382 275
222 3300005471 Ga0070698_100162436 Ga0070698_1001624362 275
223 3300005518 Ga0070699_100048369 Ga0070699_1000483692 275
224 3300005530 Ga0070679_100003204 Ga0070679_10000320415 275
225 3300005535 Ga0070684_100197841 Ga0070684_1001978412 275
226 3300005549 Ga0070704_100010999 Ga0070704_1000109993 275
227 3300005549 Ga0070704_100250056 Ga0070704_1002500562 275
228 3300005614 Ga0068856_100010369 Ga0068856_1000103699 275
229 3300006163 Ga0070715_10133149 Ga0070715_101331492 275
230 3300006173 Ga0070716_100069825 Ga0070716_1000698252 275
231 3300006173 Ga0070716_100184234 Ga0070716_1001842341 275
232 3300006844 Ga0075428_100098346 Ga0075428_1000983463 275
233 3300006844 Ga0075428_100289399 Ga0075428_1002893992 275
234 3300006844 Ga0075428_100432309 Ga0075428_1004323092 275
235 3300006846 Ga0075430_100030010 Ga0075430_1000300106 275
236 3300006880 Ga0075429_100293524 Ga0075429_1002935242 275
237 3300009093 Ga0105240_10001985 Ga0105240_1000198522 275
238 3300009147 Ga0114129_10104079 Ga0114129_101040795 275
239 3300009147 Ga0114129_10166298 Ga0114129_101662982 275
240 3300009545 Ga0105237_10074344 Ga0105237_100743442 275
241 3300013296 Ga0157374_10146668 Ga0157374_101466682 275
242 3300013296 Ga0157374_10335453 Ga0157374_103354531 275
243 3300013306 Ga0163162_10025032 Ga0163162_100250324 275
244 3300021358 Ga0213873_10014177 Ga0213873_100141772 275
245 3300021361 Ga0213872_10030340 Ga0213872_100303402 275
246 3300021441 Ga0213871_10010837 Ga0213871_100108372 275
247 3300024225 Ga0224572_1010401 Ga0224572_10104012 275
248 3300025225 Ga0209566_105350 Ga0209566_1053502 275
249 3300025233 Ga0209437_106254 Ga0209437_1062542 275
250 3300025254 Ga0209148_1001037 Ga0209148_100103713 275
251 3300025256 Ga0209759_1004543 Ga0209759_10045435 275
252 3300025261 Ga0209233_1002957 Ga0209233_10029574 275
253 3300025272 Ga0209455_1000555 Ga0209455_100055513 275
254 3300025284 Ga0209130_1000680 Ga0209130_100068019 275
255 3300025295 Ga0209564_1002332 Ga0209564_100233211 275
256 3300025298 Ga0209050_1001041 Ga0209050_100104128 275
257 3300025302 Ga0207426_1000356 Ga0207426_100035612 275
258 3300025304 Ga0209257_1000155 Ga0209257_100015591 275
259 3300025315 Ga0207697_10029181 Ga0207697_100291812 275
260 3300025913 Ga0207695_10001631 Ga0207695_1000163123 275
261 3300025914 Ga0207671_10003901 Ga0207671_1000390111 275
262 3300025921 Ga0207652_10042405 Ga0207652_100424053 275
263 3300025922 Ga0207646_10148897 Ga0207646_101488972 275
264 3300025922 Ga0207646_10176962 Ga0207646_101769622 275
265 3300025924 Ga0207694_10013929 Ga0207694_100139295 275
266 3300025924 Ga0207694_10042080 Ga0207694_100420803 275
267 3300025934 Ga0207686_10180521 Ga0207686_101805212 275
268 3300025935 Ga0207709_10007677 Ga0207709_100076773 275
269 3300025939 Ga0207665_10048752 Ga0207665_100487523 275
270 3300025944 Ga0207661_10262781 Ga0207661_102627811 275
271 3300026078 Ga0207702_10004019 Ga0207702_1000401917 275
272 3300026089 Ga0207648_10079843 Ga0207648_100798433 275
273 3300026118 Ga0207675_100042432 Ga0207675_1000424325 275
274 3300026142 Ga0207698_10204519 Ga0207698_102045193 275
275 3300028800 Ga0265338_10004478 Ga0265338_100044786 275
276 3300031247 Ga0265340_10133803 Ga0265340_101338031 275
277 3300031250 Ga0265331_10112773 Ga0265331_101127732 275
278 3300031251 Ga0265327_10026771 Ga0265327_100267711 275
279 3300031711 Ga0265314_10001316 Ga0265314_100013169 275
280 3300031711 Ga0265314_10017098 Ga0265314_100170984 275
281 3300033544 Ga0316215_1002880 Ga0316215_10028802 275
282 3300036401 Ga0373937_0502176 Ga0373937_0502176_276_1124 275
283 3300037312 Ga0395899_0311868 Ga0395899_0311868_143_979 275
284 3300038443 Ga0395901_0300686 Ga0395901_0300686_412_1248 275
285 3300039437 Ga0436365_0691988 Ga0436365_0691988_3603_4511 275
286 3300039438 Ga0436360_0404019 Ga0436360_0404019_4446_5282 275
287 3300039447 Ga0436361_0866182 Ga0436361_0866182_1852_2688 275
288 3300039453 Ga0436362_0240508 Ga0436362_0240508_1100_1936 275
289 3300039453 Ga0436362_0350759 Ga0436362_0350759_1670_2506 275
290 3300041404 Ga0439436_0010327 Ga0439436_0010327_1077_1937 275
291 3300041410 Ga0439461_0002126 Ga0439461_0002126_1251_2111 275
292 3300041413 Ga0439465_0006223 Ga0439465_0006223_1188_2048 275
293 3300041997 Ga0439431_0002193 Ga0439431_0002193_1398_2258 275
294 3300042004 Ga0439445_0000857 Ga0439445_0000857_4147_5007 275
295 3300042156 Ga0439446_0007686 Ga0439446_0007686_1824_2684 275
296 3300046460 Ga0495638_0000134 Ga0495638_0000134_50416_51252 275
297 3300046460 Ga0495638_0001868 Ga0495638_0001868_16600_17457 275
298 3300046471 Ga0495650_0000007 Ga0495650_0000007_560020_560865 275
299 3300046513 Ga0495616_0000044 Ga0495616_0000044_7670_8527 275
300 3300046528 Ga0495642_0090265 Ga0495642_0090265_20_856 275
301 3300046530 Ga0495654_0000053 Ga0495654_0000053_63479_64324 275
302 3300046557 Ga0495622_0099511 Ga0495622_0099511_95_952 275
303 3300046558 Ga0495633_0056012 Ga0495633_0056012_422_1267 275
304 3300046615 Ga0495656_0003760 Ga0495656_0003760_192_1028 275
305 3300046616 Ga0495668_0000084 Ga0495668_0000084_2493_3368 275
306 3300046660 Ga0495625_0016248 Ga0495625_0016248_475_1320 275
307 3300050507 nmdc:mga05p37_419741_c1 nmdc:mga05p37_419741_c1_500_1372 275
308 3300050507 nmdc:mga05p37_53452_c1 nmdc:mga05p37_53452_c1_1861_2697 275
309 3300050510 nmdc:mga06r32_166601_c1 nmdc:mga06r32_166601_c1_1058_1912 275
310 3300050514 nmdc:mga08x19_211666_c1 nmdc:mga08x19_211666_c1_347_1183 275
311 3300050515 nmdc:mga0a205_204558_c1 nmdc:mga0a205_204558_c1_986_1822 275
312 3300053123 Ga0500614_006828 Ga0500614_006828_20_922 275
313 3300053151 Ga0500604_0007500 Ga0500604_0007500_426_1271 275
314 3300059491 Ga0587070_001296 Ga0587070_001296_590_1483 275
315 3300059492 Ga0587073_0005086 Ga0587073_0005086_580_1473 275
316 3300059505 Ga0587083_0000588 Ga0587083_0000588_581_1474 275
317 3300059640 Ga0587067_002943 Ga0587067_002943_591_1484 275
318 3300059641 Ga0587068_003697 Ga0587068_003697_128_1021 275
319 3300059647 Ga0587079_000576 Ga0587079_000576_1929_2822 275
320 3300005436 Ga0070713_100086520 Ga0070713_1000865203 276
321 3300005539 Ga0068853_100001391 Ga0068853_1000013914 276
322 3300010375 Ga0105239_10806582 Ga0105239_108065821 276
323 3300025928 Ga0207700_10001777 Ga0207700_100017779 276
324 3300031711 Ga0265314_10107731 Ga0265314_101077312 276
325 iso_pu_bacteria 2571042365 2572255033 276
326 3300002737 JGI25162J39368_1000490 JGI25162J39368_100049021 277
327 3300003762 Ga0055542_1000082 Ga0055542_100008269 277
328 3300005548 Ga0070665_100193366 Ga0070665_1001933661 277
329 3300009093 Ga0105240_10172412 Ga0105240_101724123 277
330 3300010375 Ga0105239_10244325 Ga0105239_102443252 277
331 3300013307 Ga0157372_10187447 Ga0157372_101874472 277
332 3300025231 Ga0207427_101484 Ga0207427_1014843 277
333 3300025233 Ga0209437_100194 Ga0209437_10019448 277
334 3300025242 Ga0209258_101958 Ga0209258_1019586 277
335 3300025250 Ga0209026_1004863 Ga0209026_10048633 277
336 3300025254 Ga0209148_1000002 Ga0209148_10000021678 277
337 3300046616 Ga0495668_0000071 Ga0495668_0000071_25122_26063 277
338 3300048924 Ga0496121_0028257 Ga0496121_0028257_2682_3587 277

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

65

284

0.91

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

71

276

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h0u-assembly1.cif.gz_A crystal structure of a putative enoyl-coa hydratase from streptomyces avermitilis 0.9424 8 277
3h0u-assembly1.cif.gz_A crystal structure of a putative enoyl-coa hydratase from streptomyces avermitilis 0.9161 8 277
4lk5-assembly1.cif.gz_C crystal structure of a enoyl-coa hydratase from mycobacterium avium subsp. paratuberculosis k-10 0.9136 7 256
3fdu-assembly2.cif.gz_F crystal structure of a putative enoyl-coa hydratase/isomerase from acinetobacter baumannii 0.9084 9 239
3p5m-assembly1.cif.gz_D crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium 0.9018 5 256
ID Description Score Start End Superfamily
3h0uA00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9424 8 277 3.90.226.10
3h0uA00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9161 8 277 3.90.226.10
3fduF00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9084 9 239 3.90.226.10
5jbwA01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9024 6 205 3.90.226.10
3gkbA00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9014 5 277 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A2V6H7A7-F1-model_v4 Enoyl-CoA hydratase 0.9868 8 126
AF-A0A5P2HBN3-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9785 5 277 GO:0016853
AF-A0A2V5XMN6-F1-model_v4 Enoyl-CoA hydratase 0.9781 6 275
AF-A0A1G5UZS0-F1-model_v4 deleted 0.9781 6 277
AF-A0A109D0R8-F1-model_v4 deleted 0.9774 22 275

Feature Viewer

pLDDT pTM Quality
90.05 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map