F413459

General Info

Members Datasets Scaffolds Average Seq Length
338 211 676 169

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100371020|Ga0075428_1003710202
Length 174
Sequence MTVTAVRKDADKLTLTLDAEFEATPERVWQLWADPRQLERWWGPPSYPATFTSLELRAGGRASYFMTGPDGQLTPLGYWEIVTAEPPRRIEMIDGFANADGSPNEEMPGPGAMNVTIEPIGEGRTRMSIENIFPDATAMEQLLAMGQEEGLTEAVGQIDAILAEDTIATAGDRR

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
143 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
144 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
153 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
154 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
155 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
159 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
209 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.92
Rhizosphere 93.49
Stem 0
Stem Tuber 0
Unclassified 1.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100371020 3300006844 Bacteria 1534
2 JGI24749J21850_1009774 3300002076 Bacteria 1340
3 JGI25407J50210_10020739 3300003373 Bacteria 1708
4 Ga0070676_10128497 3300005328 Bacteria 1599
5 Ga0070683_100160141 3300005329 Bacteria 2135
6 Ga0070690_100113221 3300005330 Bacteria 1813
7 Ga0070690_100526205 3300005330 Bacteria 888
8 Ga0070670_100116935 3300005331 Bacteria 2299
9 Ga0068869_100209944 3300005334 Bacteria 1539
10 Ga0070680_101016438 3300005336 Bacteria 716
11 Ga0070680_101153518 3300005336 Bacteria 670
12 Ga0070682_100137820 3300005337 Bacteria 1659
13 Ga0068868_100077245 3300005338 Bacteria 2663
14 Ga0070660_100094860 3300005339 Bacteria 2357
15 Ga0070689_100003663 3300005340 Bacteria 10248
16 Ga0070691_10314585 3300005341 Bacteria 859
17 Ga0070687_100006477 3300005343 Bacteria 4802
18 Ga0070661_100352061 3300005344 Bacteria 1156
19 Ga0070692_10041468 3300005345 Bacteria 2358
20 Ga0070668_100116000 3300005347 Bacteria 2135
21 Ga0070668_100207117 3300005347 Bacteria 1612
22 Ga0070669_100041359 3300005353 Bacteria 3352
23 Ga0070674_100011638 3300005356 Bacteria 5361
24 Ga0070673_100041006 3300005364 Bacteria 3555
25 Ga0070703_10221966 3300005406 Bacteria 753
26 Ga0070701_10015851 3300005438 Bacteria 3491
27 Ga0070705_100028445 3300005440 Bacteria 3061
28 Ga0070700_100003737 3300005441 Bacteria 7872
29 Ga0070694_100222278 3300005444 Bacteria 1417
30 Ga0070663_100429466 3300005455 Bacteria 1085
31 Ga0070678_100088410 3300005456 Bacteria 2369
32 Ga0070662_100013185 3300005457 Bacteria 5495
33 Ga0070662_100497340 3300005457 Bacteria 1017
34 Ga0070681_10811911 3300005458 Bacteria 853
35 Ga0068867_100030460 3300005459 Bacteria 3892
36 Ga0068867_100569234 3300005459 Bacteria 984
37 Ga0070685_10012180 3300005466 Bacteria 4512
38 Ga0070698_100287673 3300005471 Bacteria 1575
39 Ga0070679_100716846 3300005530 Bacteria 943
40 Ga0070679_101492380 3300005530 Bacteria 623
41 Ga0070684_100057494 3300005535 Bacteria 3396
42 Ga0068853_100062712 3300005539 Bacteria 3218
43 Ga0070686_100011732 3300005544 Bacteria 4978
44 Ga0070686_100064036 3300005544 Bacteria 2384
45 Ga0070686_100448264 3300005544 Bacteria 991
46 Ga0070695_100053943 3300005545 Bacteria 2586
47 Ga0070695_100858678 3300005545 Bacteria 731
48 Ga0070696_100002172 3300005546 Bacteria 12926
49 Ga0070696_100027427 3300005546 Bacteria 3881
50 Ga0070696_100761367 3300005546 Bacteria 794
51 Ga0070665_100169897 3300005548 Bacteria 2182
52 Ga0070665_100334101 3300005548 Bacteria 1520
53 Ga0070664_100298418 3300005564 Bacteria 1456
54 Ga0068857_101611899 3300005577 Bacteria 634
55 Ga0068857_101961763 3300005577 Bacteria 574
56 Ga0068854_100161495 3300005578 Bacteria 1736
57 Ga0070702_100028017 3300005615 Bacteria 3048
58 Ga0070702_100408666 3300005615 Bacteria 973
59 Ga0070702_100969778 3300005615 Bacteria 671
60 Ga0068852_100150375 3300005616 Bacteria 2165
61 Ga0068859_100164392 3300005617 Bacteria 2299
62 Ga0068864_100312476 3300005618 Bacteria 1473
63 Ga0068866_10185188 3300005718 Bacteria 1233
64 Ga0068866_10410588 3300005718 Bacteria 876
65 Ga0068861_100460995 3300005719 Bacteria 1141
66 Ga0068870_10013865 3300005840 Bacteria 3796
67 Ga0068863_100192558 3300005841 Bacteria 1960
68 Ga0068858_100402712 3300005842 Bacteria 1315
69 Ga0068860_100036361 3300005843 Bacteria 4719
70 Ga0068860_101216034 3300005843 Bacteria 774
71 Ga0068862_100261782 3300005844 Bacteria 1579
72 Ga0081455_10075194 3300005937 Bacteria 2787
73 Ga0081455_10419729 3300005937 Bacteria 923
74 Ga0081538_10001209 3300005981 Bacteria 27097
75 Ga0081538_10002924 3300005981 Bacteria 16295
76 Ga0081538_10013451 3300005981 Bacteria 6474
77 Ga0081538_10064851 3300005981 Bacteria 2062
78 Ga0075432_10000063 3300006058 Bacteria 20905
79 Ga0075430_100822887 3300006846 Bacteria 765
80 Ga0075431_100901044 3300006847 Bacteria 854
81 Ga0075433_10007453 3300006852 Bacteria 8689
82 Ga0075433_10259537 3300006852 Bacteria 1541
83 Ga0075434_100000170 3300006871 Bacteria 41761
84 Ga0075434_100204665 3300006871 Bacteria 1994
85 Ga0075434_100279290 3300006871 Bacteria 1690
86 Ga0075434_101060955 3300006871 Bacteria 824
87 Ga0075429_100017198 3300006880 Bacteria 6254
88 Ga0068865_100003886 3300006881 Bacteria 8962
89 Ga0075436_100004773 3300006914 Bacteria 9308
90 Ga0097620_100164399 3300006931 Bacteria 2299
91 Ga0075435_100000430 3300007076 Bacteria 25677
92 Ga0075435_100235059 3300007076 Bacteria 1557
93 Ga0075435_100660764 3300007076 Bacteria 908
94 Ga0111539_10001964 3300009094 Bacteria 27450
95 Ga0111539_10118938 3300009094 Bacteria 3096
96 Ga0111539_10530147 3300009094 Bacteria 1372
97 Ga0105245_10005478 3300009098 Bacteria 11150
98 Ga0105245_10364698 3300009098 Bacteria 1435
99 Ga0105245_11342797 3300009098 Bacteria 764
100 Ga0105247_10233965 3300009101 Bacteria 1249
101 Ga0114129_10147192 3300009147 Bacteria 3225
102 Ga0114129_10602101 3300009147 Bacteria 1424
103 Ga0105243_10003169 3300009148 Bacteria 13489
104 Ga0105243_10779315 3300009148 Bacteria 940
105 Ga0105243_11468647 3300009148 Bacteria 704
106 Ga0105241_10203557 3300009174 Bacteria 1655
107 Ga0105242_10240431 3300009176 Bacteria 1627
108 Ga0105242_10832642 3300009176 Bacteria 916
109 Ga0105248_10242177 3300009177 Bacteria 2030
110 Ga0105237_10156522 3300009545 Bacteria 2276
111 Ga0105238_10350582 3300009551 Bacteria 1465
112 Ga0105249_10136854 3300009553 Bacteria 2345
113 Ga0105239_10337916 3300010375 Bacteria 1699
114 Ga0105239_10676053 3300010375 Bacteria 1180
115 Ga0105239_12529894 3300010375 Bacteria 598
116 Ga0105246_10076721 3300011119 Bacteria 2369
117 Ga0157371_11100315 3300013102 Bacteria 609
118 Ga0157378_10226683 3300013297 Bacteria 1779
119 Ga0157378_10484040 3300013297 Bacteria 1233
120 Ga0163162_10325665 3300013306 Bacteria 1669
121 Ga0157375_10244629 3300013308 Bacteria 1954
122 Ga0163163_10085085 3300014325 Bacteria 3170
123 Ga0163163_11518583 3300014325 Bacteria 731
124 Ga0157380_10006176 3300014326 Bacteria 8403
125 Ga0182008_10361106 3300014497 Bacteria 772
126 Ga0157377_10044074 3300014745 Bacteria 2486
127 Ga0163161_11039103 3300017792 Bacteria 701
128 Ga0207653_10092279 3300025885 Bacteria 1062
129 Ga0207642_10082720 3300025899 Bacteria 1564
130 Ga0207688_10002557 3300025901 Bacteria 9837
131 Ga0207680_10677555 3300025903 Bacteria 739
132 Ga0207647_10081425 3300025904 Bacteria 1940
133 Ga0207645_10039204 3300025907 Bacteria 3035
134 Ga0207643_10013997 3300025908 Bacteria 4352
135 Ga0207707_11028398 3300025912 Bacteria 675
136 Ga0207660_10289742 3300025917 Bacteria 1301
137 Ga0207662_10000259 3300025918 Bacteria 24494
138 Ga0207662_10050904 3300025918 Bacteria 2463
139 Ga0207649_10056037 3300025920 Bacteria 2460
140 Ga0207652_10383337 3300025921 Bacteria 1269
141 Ga0207652_11146644 3300025921 Bacteria 678
142 Ga0207694_10191225 3300025924 Bacteria 1663
143 Ga0207650_10287387 3300025925 Bacteria 1340
144 Ga0207659_10172939 3300025926 Bacteria 1705
145 Ga0207687_10022927 3300025927 Bacteria 4157
146 Ga0207687_10356356 3300025927 Bacteria 1193
147 Ga0207687_10598225 3300025927 Bacteria 929
148 Ga0207690_10246078 3300025932 Bacteria 1379
149 Ga0207706_10004124 3300025933 Bacteria 13709
150 Ga0207706_10231765 3300025933 Bacteria 1615
151 Ga0207686_10296505 3300025934 Bacteria 1199
152 Ga0207709_10224637 3300025935 Bacteria 1356
153 Ga0207670_10090466 3300025936 Bacteria 2162
154 Ga0207669_10470876 3300025937 Bacteria 999
155 Ga0207704_10085454 3300025938 Bacteria 2054
156 Ga0207704_10333425 3300025938 Bacteria 1175
157 Ga0207691_10244599 3300025940 Bacteria 1550
158 Ga0207711_10192025 3300025941 Bacteria 1861
159 Ga0207689_10180666 3300025942 Bacteria 1740
160 Ga0207679_10440614 3300025945 Bacteria 1153
161 Ga0207651_10259984 3300025960 Bacteria 1425
162 Ga0207712_10009653 3300025961 Bacteria 6116
163 Ga0207668_10386815 3300025972 Bacteria 1179
164 Ga0207640_10127106 3300025981 Bacteria 1837
165 Ga0207640_11237298 3300025981 Bacteria 665
166 Ga0207677_10338801 3300026023 Bacteria 1256
167 Ga0207678_10133227 3300026067 Bacteria 2120
168 Ga0207708_10002360 3300026075 Bacteria 13868
169 Ga0207648_10015061 3300026089 Bacteria 7121
170 Ga0207648_10502496 3300026089 Bacteria 1109
171 Ga0207648_11583130 3300026089 Bacteria 616
172 Ga0207674_10066376 3300026116 Bacteria 3634
173 Ga0207674_10298817 3300026116 Bacteria 1559
174 Ga0207674_11535925 3300026116 Bacteria 635
175 Ga0207683_10033709 3300026121 Bacteria 4449
176 Ga0209974_10075071 3300027876 Bacteria 1157
177 Ga0209974_10110292 3300027876 Bacteria 968
178 Ga0207428_10002923 3300027907 Bacteria 16927
179 Ga0207428_10423266 3300027907 Bacteria 973
180 Ga0268265_10156409 3300028380 Bacteria 1930
181 Ga0268264_10194466 3300028381 Bacteria 1851
182 Ga0307408_100038633 3300031548 Bacteria 3369
183 Ga0307408_100412781 3300031548 Bacteria 1162
184 Ga0316576_10050036 3300031727 Bacteria 3037
185 Ga0316576_10090042 3300031727 Bacteria 2285
186 Ga0307405_10018502 3300031731 Bacteria 3844
187 Ga0307405_10405635 3300031731 Bacteria 1068
188 Ga0307410_10144744 3300031852 Bacteria 1762
189 Ga0307406_10189160 3300031901 Bacteria 1505
190 Ga0307407_10007752 3300031903 Bacteria 4882
191 Ga0307412_10042418 3300031911 Bacteria 2956
192 Ga0307409_100201249 3300031995 Bacteria 1782
193 Ga0307409_100482855 3300031995 Bacteria 1203
194 Ga0307416_100152240 3300032002 Bacteria 2123
195 Ga0307416_100700453 3300032002 Bacteria 1102
196 Ga0307414_10651426 3300032004 Bacteria 949
197 Ga0307411_10074669 3300032005 Bacteria 2311
198 Ga0307411_10953360 3300032005 Bacteria 765
199 Ga0307415_100037472 3300032126 Bacteria 3187
200 Ga0307415_100200098 3300032126 Bacteria 1584
201 Ga0373950_0093991 3300034818 Bacteria 639
202 Ga0373958_0027229 3300034819 Bacteria 1100
203 Ga0373949_0160846 3300035090 Bacteria 655
204 Ga0373941_0043622 3300035115 Bacteria 1397
205 Ga0373941_0193853 3300035115 Bacteria 769
206 Ga0395899_0000927 3300037312 Bacteria 27623
207 Ga0395900_0079051 3300037418 Bacteria 3379
208 Ga0395898_0014693 3300037466 Bacteria 8038
209 Ga0436364_0651836 3300037853 Bacteria 769
210 Ga0395901_0017271 3300038443 Bacteria 7365
211 Ga0395901_0212919 3300038443 Bacteria 2022
212 Ga0395901_0591948 3300038443 Bacteria 1119
213 Ga0436365_1729817 3300039437 Unclassified 828
214 Ga0439453_0028295 3300041408 Bacteria 1049
215 Ga0439463_041425 3300042016 Bacteria 1171
216 Ga0450910_049321 3300042147 Bacteria 694
217 Ga0439440_0015021 3300042993 Bacteria 1679
218 Ga0495584_0271895 3300046491 Bacteria 861
219 Ga0495620_0276900 3300046515 Bacteria 638
220 Ga0495637_0045563 3300046520 Bacteria 1860
221 Ga0495656_0106335 3300046615 Bacteria 1306
222 Ga0495670_0104752 3300046691 Bacteria 1460
223 Ga0495677_0160033 3300047445 Bacteria 869
224 Ga0496101_0217854 3300048904 Bacteria 1481
225 Ga0496101_0280516 3300048904 Bacteria 1302
226 Ga0496101_0597639 3300048904 Bacteria 872
227 Ga0496102_0134556 3300048905 Bacteria 2315
228 Ga0496102_0728472 3300048905 Bacteria 914
229 Ga0496103_0007227 3300048906 Bacteria 6621
230 Ga0496103_0461106 3300048906 Bacteria 815
231 Ga0496104_0442892 3300048907 Bacteria 1211
232 Ga0496106_0030427 3300048909 Bacteria 4026
233 Ga0496106_0040854 3300048909 Bacteria 3475
234 Ga0496106_0773938 3300048909 Bacteria 762
235 Ga0496107_0118525 3300048910 Bacteria 1949
236 Ga0496107_0130320 3300048910 Bacteria 1856
237 Ga0496108_0028340 3300048911 Bacteria 4634
238 Ga0496109_0144560 3300048912 Bacteria 2224
239 Ga0496110_0240455 3300048913 Bacteria 1647
240 Ga0496111_0160458 3300048914 Bacteria 1669
241 Ga0496112_0271585 3300048915 Bacteria 1644
242 Ga0496113_0030140 3300048916 Bacteria 3925
243 Ga0496114_0024182 3300048917 Bacteria 4958
244 Ga0501033_0221601 3300049570 Bacteria 1346
245 Ga0501034_0621091 3300049571 Bacteria 985
246 Ga0501034_0736925 3300049571 Bacteria 882
247 Ga0501037_0048488 3300049573 Bacteria 3112
248 Ga0501039_0014437 3300049575 Bacteria 6048
249 Ga0501039_0085194 3300049575 Bacteria 2462
250 Ga0501040_0025663 3300049576 Bacteria 3964
251 Ga0501040_0067319 3300049576 Bacteria 2468
252 Ga0501040_0174925 3300049576 Bacteria 1521
253 Ga0501040_0245042 3300049576 Bacteria 1278
254 Ga0501041_0013687 3300049577 Bacteria 4813
255 Ga0501041_0761438 3300049577 Bacteria 620
256 Ga0501042_0176179 3300049578 Bacteria 1543
257 Ga0501042_0901530 3300049578 Unclassified 644
258 Ga0501043_0060493 3300049579 Bacteria 2973
259 Ga0501046_0040902 3300049580 Bacteria 3701
260 Ga0501048_0347924 3300049582 Bacteria 1057
261 Ga0501067_0071021 3300049583 Bacteria 1928
262 Ga0501067_0110170 3300049583 Bacteria 1531
263 Ga0501067_0329905 3300049583 Bacteria 850
264 Ga0501068_0130927 3300049584 Bacteria 1568
265 Ga0501068_0710712 3300049584 Bacteria 657
266 Ga0501069_0186340 3300049585 Bacteria 1200
267 Ga0501069_0222680 3300049585 Bacteria 1097
268 Ga0501069_0307234 3300049585 Bacteria 931
269 Ga0501069_0318157 3300049585 Bacteria 914
270 Ga0501071_0052323 3300049587 Bacteria 2944
271 Ga0501071_0108493 3300049587 Bacteria 2051
272 Ga0501071_0141439 3300049587 Bacteria 1792
273 Ga0501071_0207907 3300049587 Bacteria 1471
274 Ga0501071_0576739 3300049587 Bacteria 864
275 Ga0501072_0010011 3300049588 Bacteria 7211
276 Ga0501072_0025267 3300049588 Bacteria 4627
277 Ga0501072_0027075 3300049588 Bacteria 4473
278 Ga0501072_0044166 3300049588 Bacteria 3504
279 Ga0501072_1056751 3300049588 Unclassified 632
280 Ga0501074_0068223 3300049590 Bacteria 2556
281 Ga0501074_0285504 3300049590 Bacteria 1173
282 Ga0501075_0109586 3300049591 Bacteria 2099
283 Ga0501075_0290298 3300049591 Bacteria 1246
284 Ga0501075_0291195 3300049591 Bacteria 1244
285 Ga0501075_0307606 3300049591 Bacteria 1208
286 Ga0501075_0350286 3300049591 Bacteria 1125
287 Ga0501075_0874764 3300049591 Bacteria 683
288 Ga0501076_0253537 3300049592 Bacteria 1440
289 Ga0501076_0329982 3300049592 Bacteria 1252
290 Ga0501076_0461221 3300049592 Bacteria 1046
291 Ga0501077_0012327 3300049593 Bacteria 5354
292 Ga0501077_0116969 3300049593 Bacteria 1690
293 Ga0501079_0041031 3300049741 Bacteria 3571
294 Ga0501079_0053096 3300049741 Bacteria 3127
295 Ga0501080_0027928 3300049742 Bacteria 5247
296 Ga0501080_0181599 3300049742 Bacteria 1936
297 Ga0501080_0728171 3300049742 Bacteria 874
298 Ga0501081_0031980 3300049743 Bacteria 3567
299 Ga0501081_0179397 3300049743 Bacteria 1531
300 Ga0501081_0338787 3300049743 Bacteria 1107
301 Ga0501081_0636283 3300049743 Bacteria 799
302 Ga0501081_0811336 3300049743 Bacteria 704
303 Ga0501044_0483105 3300049823 Bacteria 1142
304 Ga0501045_0193311 3300049824 Bacteria 1516
305 Ga0501045_0334575 3300049824 Bacteria 1127
306 Ga0501045_0899282 3300049824 Bacteria 650
307 nmdc:mga05p37_1038187_c1 3300050507 Bacteria 866
308 nmdc:mga05p37_1561846_c1 3300050507 Bacteria 653
309 nmdc:mga09592_79354_c1 3300050508 Bacteria 2794
310 nmdc:mga06r32_1296246_c1 3300050510 Bacteria 672
311 nmdc:mga06r32_1696889_c1 3300050510 Bacteria 569
312 nmdc:mga08y16_145901_c1 3300050511 Bacteria 2460
313 nmdc:mga08y16_3061_c1 3300050511 Bacteria 17289
314 nmdc:mga0n895_277454_c1 3300050512 Bacteria 1700
315 nmdc:mga0n895_3852_c1 3300050512 Bacteria 12174
316 nmdc:mga0n895_62236_c1 3300050512 Bacteria 3687
317 nmdc:mga0rr50_1035_c1 3300050513 Bacteria 15062
318 nmdc:mga0rr50_285943_c1 3300050513 Bacteria 1377
319 nmdc:mga0rr50_390132_c1 3300050513 Bacteria 1175
320 nmdc:mga08x19_3921_c1 3300050514 Bacteria 8858
321 nmdc:mga0a205_2944_c1 3300050515 Bacteria 15088
322 nmdc:mga0a205_372994_c1 3300050515 Bacteria 1293
323 nmdc:mga0a205_769691_c1 3300050515 Bacteria 811
324 Ga0501084_0059209 3300054114 Bacteria 3205
325 Ga0501084_0137547 3300054114 Bacteria 2056
326 Ga0501084_0141101 3300054114 Bacteria 2029
327 Ga0501084_0479870 3300054114 Bacteria 1051
328 Ga0590075_038483 3300059424 Bacteria 1221
329 Ga0587073_0151815 3300059492 Bacteria 656
330 Ga0501082_0068370 3300060353 Bacteria 3059
331 Ga0501082_0099660 3300060353 Bacteria 2512
332 Ga0501082_0125147 3300060353 Bacteria 2229
333 Ga0501082_0646686 3300060353 Bacteria 925
334 Ga0501082_0820750 3300060353 Bacteria 813
335 Ga0530510_0016273 3300061734 Bacteria 5260
336 Ga0530510_0268814 3300061734 Bacteria 1272
337 Ga0530510_0273301 3300061734 Unclassified 1261
338 Ga0530510_0389925 3300061734 Bacteria 1049
339 Ga0075428_100371020
340 JGI24749J21850_1009774
341 JGI25407J50210_10020739
342 Ga0070676_10128497
343 Ga0070683_100160141
344 Ga0070690_100113221
345 Ga0070690_100526205
346 Ga0070670_100116935
347 Ga0068869_100209944
348 Ga0070680_101016438
349 Ga0070680_101153518
350 Ga0070682_100137820
351 Ga0068868_100077245
352 Ga0070660_100094860
353 Ga0070689_100003663
354 Ga0070691_10314585
355 Ga0070687_100006477
356 Ga0070661_100352061
357 Ga0070692_10041468
358 Ga0070668_100116000
359 Ga0070668_100207117
360 Ga0070669_100041359
361 Ga0070674_100011638
362 Ga0070673_100041006
363 Ga0070703_10221966
364 Ga0070701_10015851
365 Ga0070705_100028445
366 Ga0070700_100003737
367 Ga0070694_100222278
368 Ga0070663_100429466
369 Ga0070678_100088410
370 Ga0070662_100013185
371 Ga0070662_100497340
372 Ga0070681_10811911
373 Ga0068867_100030460
374 Ga0068867_100569234
375 Ga0070685_10012180
376 Ga0070698_100287673
377 Ga0070679_100716846
378 Ga0070679_101492380
379 Ga0070684_100057494
380 Ga0068853_100062712
381 Ga0070686_100011732
382 Ga0070686_100064036
383 Ga0070686_100448264
384 Ga0070695_100053943
385 Ga0070695_100858678
386 Ga0070696_100002172
387 Ga0070696_100027427
388 Ga0070696_100761367
389 Ga0070665_100169897
390 Ga0070665_100334101
391 Ga0070664_100298418
392 Ga0068857_101611899
393 Ga0068857_101961763
394 Ga0068854_100161495
395 Ga0070702_100028017
396 Ga0070702_100408666
397 Ga0070702_100969778
398 Ga0068852_100150375
399 Ga0068859_100164392
400 Ga0068864_100312476
401 Ga0068866_10185188
402 Ga0068866_10410588
403 Ga0068861_100460995
404 Ga0068870_10013865
405 Ga0068863_100192558
406 Ga0068858_100402712
407 Ga0068860_100036361
408 Ga0068860_101216034
409 Ga0068862_100261782
410 Ga0081455_10075194
411 Ga0081455_10419729
412 Ga0081538_10001209
413 Ga0081538_10002924
414 Ga0081538_10013451
415 Ga0081538_10064851
416 Ga0075432_10000063
417 Ga0075430_100822887
418 Ga0075431_100901044
419 Ga0075433_10007453
420 Ga0075433_10259537
421 Ga0075434_100000170
422 Ga0075434_100204665
423 Ga0075434_100279290
424 Ga0075434_101060955
425 Ga0075429_100017198
426 Ga0068865_100003886
427 Ga0075436_100004773
428 Ga0097620_100164399
429 Ga0075435_100000430
430 Ga0075435_100235059
431 Ga0075435_100660764
432 Ga0111539_10001964
433 Ga0111539_10118938
434 Ga0111539_10530147
435 Ga0105245_10005478
436 Ga0105245_10364698
437 Ga0105245_11342797
438 Ga0105247_10233965
439 Ga0114129_10147192
440 Ga0114129_10602101
441 Ga0105243_10003169
442 Ga0105243_10779315
443 Ga0105243_11468647
444 Ga0105241_10203557
445 Ga0105242_10240431
446 Ga0105242_10832642
447 Ga0105248_10242177
448 Ga0105237_10156522
449 Ga0105238_10350582
450 Ga0105249_10136854
451 Ga0105239_10337916
452 Ga0105239_10676053
453 Ga0105239_12529894
454 Ga0105246_10076721
455 Ga0157371_11100315
456 Ga0157378_10226683
457 Ga0157378_10484040
458 Ga0163162_10325665
459 Ga0157375_10244629
460 Ga0163163_10085085
461 Ga0163163_11518583
462 Ga0157380_10006176
463 Ga0182008_10361106
464 Ga0157377_10044074
465 Ga0163161_11039103
466 Ga0207653_10092279
467 Ga0207642_10082720
468 Ga0207688_10002557
469 Ga0207680_10677555
470 Ga0207647_10081425
471 Ga0207645_10039204
472 Ga0207643_10013997
473 Ga0207707_11028398
474 Ga0207660_10289742
475 Ga0207662_10000259
476 Ga0207662_10050904
477 Ga0207649_10056037
478 Ga0207652_10383337
479 Ga0207652_11146644
480 Ga0207694_10191225
481 Ga0207650_10287387
482 Ga0207659_10172939
483 Ga0207687_10022927
484 Ga0207687_10356356
485 Ga0207687_10598225
486 Ga0207690_10246078
487 Ga0207706_10004124
488 Ga0207706_10231765
489 Ga0207686_10296505
490 Ga0207709_10224637
491 Ga0207670_10090466
492 Ga0207669_10470876
493 Ga0207704_10085454
494 Ga0207704_10333425
495 Ga0207691_10244599
496 Ga0207711_10192025
497 Ga0207689_10180666
498 Ga0207679_10440614
499 Ga0207651_10259984
500 Ga0207712_10009653
501 Ga0207668_10386815
502 Ga0207640_10127106
503 Ga0207640_11237298
504 Ga0207677_10338801
505 Ga0207678_10133227
506 Ga0207708_10002360
507 Ga0207648_10015061
508 Ga0207648_10502496
509 Ga0207648_11583130
510 Ga0207674_10066376
511 Ga0207674_10298817
512 Ga0207674_11535925
513 Ga0207683_10033709
514 Ga0209974_10075071
515 Ga0209974_10110292
516 Ga0207428_10002923
517 Ga0207428_10423266
518 Ga0268265_10156409
519 Ga0268264_10194466
520 Ga0307408_100038633
521 Ga0307408_100412781
522 Ga0316576_10050036
523 Ga0316576_10090042
524 Ga0307405_10018502
525 Ga0307405_10405635
526 Ga0307410_10144744
527 Ga0307406_10189160
528 Ga0307407_10007752
529 Ga0307412_10042418
530 Ga0307409_100201249
531 Ga0307409_100482855
532 Ga0307416_100152240
533 Ga0307416_100700453
534 Ga0307414_10651426
535 Ga0307411_10074669
536 Ga0307411_10953360
537 Ga0307415_100037472
538 Ga0307415_100200098
539 Ga0373950_0093991
540 Ga0373958_0027229
541 Ga0373949_0160846
542 Ga0373941_0043622
543 Ga0373941_0193853
544 Ga0395899_0000927
545 Ga0395900_0079051
546 Ga0395898_0014693
547 Ga0436364_0651836
548 Ga0395901_0017271
549 Ga0395901_0212919
550 Ga0395901_0591948
551 Ga0436365_1729817
552 Ga0439453_0028295
553 Ga0439463_041425
554 Ga0450910_049321
555 Ga0439440_0015021
556 Ga0495584_0271895
557 Ga0495620_0276900
558 Ga0495637_0045563
559 Ga0495656_0106335
560 Ga0495670_0104752
561 Ga0495677_0160033
562 Ga0496101_0217854
563 Ga0496101_0280516
564 Ga0496101_0597639
565 Ga0496102_0134556
566 Ga0496102_0728472
567 Ga0496103_0007227
568 Ga0496103_0461106
569 Ga0496104_0442892
570 Ga0496106_0030427
571 Ga0496106_0040854
572 Ga0496106_0773938
573 Ga0496107_0118525
574 Ga0496107_0130320
575 Ga0496108_0028340
576 Ga0496109_0144560
577 Ga0496110_0240455
578 Ga0496111_0160458
579 Ga0496112_0271585
580 Ga0496113_0030140
581 Ga0496114_0024182
582 Ga0501033_0221601
583 Ga0501034_0621091
584 Ga0501034_0736925
585 Ga0501037_0048488
586 Ga0501039_0014437
587 Ga0501039_0085194
588 Ga0501040_0025663
589 Ga0501040_0067319
590 Ga0501040_0174925
591 Ga0501040_0245042
592 Ga0501041_0013687
593 Ga0501041_0761438
594 Ga0501042_0176179
595 Ga0501042_0901530
596 Ga0501043_0060493
597 Ga0501046_0040902
598 Ga0501048_0347924
599 Ga0501067_0071021
600 Ga0501067_0110170
601 Ga0501067_0329905
602 Ga0501068_0130927
603 Ga0501068_0710712
604 Ga0501069_0186340
605 Ga0501069_0222680
606 Ga0501069_0307234
607 Ga0501069_0318157
608 Ga0501071_0052323
609 Ga0501071_0108493
610 Ga0501071_0141439
611 Ga0501071_0207907
612 Ga0501071_0576739
613 Ga0501072_0010011
614 Ga0501072_0025267
615 Ga0501072_0027075
616 Ga0501072_0044166
617 Ga0501072_1056751
618 Ga0501074_0068223
619 Ga0501074_0285504
620 Ga0501075_0109586
621 Ga0501075_0290298
622 Ga0501075_0291195
623 Ga0501075_0307606
624 Ga0501075_0350286
625 Ga0501075_0874764
626 Ga0501076_0253537
627 Ga0501076_0329982
628 Ga0501076_0461221
629 Ga0501077_0012327
630 Ga0501077_0116969
631 Ga0501079_0041031
632 Ga0501079_0053096
633 Ga0501080_0027928
634 Ga0501080_0181599
635 Ga0501080_0728171
636 Ga0501081_0031980
637 Ga0501081_0179397
638 Ga0501081_0338787
639 Ga0501081_0636283
640 Ga0501081_0811336
641 Ga0501044_0483105
642 Ga0501045_0193311
643 Ga0501045_0334575
644 Ga0501045_0899282
645 nmdc:mga05p37_1038187_c1
646 nmdc:mga05p37_1561846_c1
647 nmdc:mga09592_79354_c1
648 nmdc:mga06r32_1296246_c1
649 nmdc:mga06r32_1696889_c1
650 nmdc:mga08y16_145901_c1
651 nmdc:mga08y16_3061_c1
652 nmdc:mga0n895_277454_c1
653 nmdc:mga0n895_3852_c1
654 nmdc:mga0n895_62236_c1
655 nmdc:mga0rr50_1035_c1
656 nmdc:mga0rr50_285943_c1
657 nmdc:mga0rr50_390132_c1
658 nmdc:mga08x19_3921_c1
659 nmdc:mga0a205_2944_c1
660 nmdc:mga0a205_372994_c1
661 nmdc:mga0a205_769691_c1
662 Ga0501084_0059209
663 Ga0501084_0137547
664 Ga0501084_0141101
665 Ga0501084_0479870
666 Ga0590075_038483
667 Ga0587073_0151815
668 Ga0501082_0068370
669 Ga0501082_0099660
670 Ga0501082_0125147
671 Ga0501082_0646686
672 Ga0501082_0820750
673 Ga0530510_0016273
674 Ga0530510_0268814
675 Ga0530510_0273301
676 Ga0530510_0389925

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

22

163

0.94

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

12

157

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ldk-assembly1.cif.gz_A solution nmr structure of protein aaur_3427 from arthrobacter aurescens, northeast structural genomics consortium target aar96 0.9361 2 160
3pu2-assembly8.cif.gz_H crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9228 5 160
1xuv-assembly2.cif.gz_B-2 x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. 0.9221 5 165
3pu2-assembly7.cif.gz_G crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9211 5 160
3pu2-assembly1.cif.gz_A crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9206 5 160
ID Description Score Start End Superfamily
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9361 2 160 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.917 2 161 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9083 5 164 3.30.530.20
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9074 5 159 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9058 2 161 3.30.530.20
ID Description Score Start End GO Terms
AF-U5W1B6-F1-model_v4 Activator of Hsp90 ATPase 1 family protein 0.9634 1 160
AF-A0A1V4ZBK2-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9537 5 167
AF-U5W1B6-F1-model_v4 Activator of Hsp90 ATPase 1 family protein 0.9514 1 160
AF-A0A841SMP9-F1-model_v4 SRPBCC family protein 0.9481 1 160
AF-A0A7X0GGL7-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.9479 14 164

Map