F413409

General Info

Members Datasets Scaffolds Average Seq Length
338 176 676 143

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100445532|Ga0070663_1004455322
Length 162
Sequence MLRIWRLNEGTTLSRKAHMVQTVAVGTDGSGTASKAVDFAIDLARRYEAKIVFISAYVPVSGARLKREGRDAPDELQWMINPAEDVEATLRECEERAEERGLSWTSEARQGDAAKVLVEVAESVGADLLVIGNKGMERKVLGSVPNTVSHHAPCSVLIVKTT

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
132 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
133 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
134 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
173 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 2.66
Rhizosphere 95.27
Stem 0
Stem Tuber 0
Unclassified 14.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_100445532 3300005455 Bacteria 1066
2 Ga0070683_100156626 3300005329 Unclassified 2161
3 Ga0070690_100629666 3300005330 Bacteria 817
4 Ga0068869_100743334 3300005334 Bacteria 839
5 Ga0070682_101017782 3300005337 Bacteria 689
6 Ga0068868_100224448 3300005338 Bacteria 1574
7 Ga0070691_10303973 3300005341 Bacteria 872
8 Ga0070692_10039477 3300005345 Bacteria 2411
9 Ga0070668_101301744 3300005347 Unclassified 661
10 Ga0070668_101547614 3300005347 Bacteria 607
11 Ga0070671_101018135 3300005355 Unclassified 726
12 Ga0070674_100001649 3300005356 Bacteria 12038
13 Ga0070674_100036322 3300005356 Bacteria 3307
14 Ga0070688_100644140 3300005365 Bacteria 815
15 Ga0070659_100521000 3300005366 Bacteria 1015
16 Ga0070703_10474442 3300005406 Bacteria 558
17 Ga0070714_100097455 3300005435 Bacteria 2585
18 Ga0070713_100489031 3300005436 Bacteria 1160
19 Ga0070701_10089676 3300005438 Bacteria 1682
20 Ga0070705_100235229 3300005440 Bacteria 1277
21 Ga0070700_100341581 3300005441 Bacteria 1107
22 Ga0070694_100363339 3300005444 Bacteria 1125
23 Ga0070663_100363398 3300005455 Bacteria 1175
24 Ga0070663_100625236 3300005455 Bacteria 908
25 Ga0070678_100806553 3300005456 Unclassified 853
26 Ga0070662_100147639 3300005457 Bacteria 1828
27 Ga0070662_100511889 3300005457 Unclassified 1002
28 Ga0068867_100519512 3300005459 Bacteria 1026
29 Ga0068867_101439657 3300005459 Bacteria 640
30 Ga0070685_10543539 3300005466 Bacteria 828
31 Ga0070699_101293418 3300005518 Bacteria 669
32 Ga0070699_101426079 3300005518 Unclassified 635
33 Ga0070697_100811467 3300005536 Bacteria 828
34 Ga0068853_101247246 3300005539 Bacteria 718
35 Ga0070686_100907936 3300005544 Unclassified 717
36 Ga0070695_100296874 3300005545 Bacteria 1193
37 Ga0070696_100085871 3300005546 Bacteria 2234
38 Ga0070693_100481143 3300005547 Bacteria 877
39 Ga0070704_100094149 3300005549 Bacteria 2240
40 Ga0070704_100862802 3300005549 Unclassified 812
41 Ga0070664_100237034 3300005564 Bacteria 1637
42 Ga0070664_101209042 3300005564 Bacteria 713
43 Ga0068854_100315757 3300005578 Bacteria 1268
44 Ga0068854_100549651 3300005578 Bacteria 979
45 Ga0070702_100006089 3300005615 Bacteria 5683
46 Ga0068852_100232266 3300005616 Bacteria 1759
47 Ga0068859_100756075 3300005617 Bacteria 1061
48 Ga0068866_10102946 3300005718 Bacteria 1579
49 Ga0068866_10796614 3300005718 Bacteria 656
50 Ga0068861_100209344 3300005719 Bacteria 1642
51 Ga0068861_100660066 3300005719 Bacteria 967
52 Ga0068861_101151810 3300005719 Bacteria 748
53 Ga0068870_10116361 3300005840 Bacteria 1534
54 Ga0068870_10157990 3300005840 Bacteria 1342
55 Ga0068870_10215496 3300005840 Unclassified 1172
56 Ga0068870_10843873 3300005840 Bacteria 643
57 Ga0068870_11005910 3300005840 Unclassified 595
58 Ga0068862_100884148 3300005844 Bacteria 877
59 Ga0068862_102540280 3300005844 Bacteria 524
60 Ga0081455_10360049 3300005937 Bacteria 1023
61 Ga0081538_10000263 3300005981 Bacteria 59895
62 Ga0081538_10001296 3300005981 Bacteria 25915
63 Ga0081538_10001372 3300005981 Bacteria 25077
64 Ga0081538_10016210 3300005981 Bacteria 5727
65 Ga0081538_10020201 3300005981 Bacteria 4915
66 Ga0081538_10021928 3300005981 Bacteria 4643
67 Ga0081538_10030127 3300005981 Bacteria 3691
68 Ga0081538_10067294 3300005981 Bacteria 2001
69 Ga0081538_10079254 3300005981 Bacteria 1758
70 Ga0081538_10110411 3300005981 Bacteria 1352
71 Ga0081539_10299819 3300005985 Bacteria 691
72 Ga0070717_10214842 3300006028 Bacteria 1689
73 Ga0075432_10266615 3300006058 Bacteria 700
74 Ga0075428_100374391 3300006844 Bacteria 1527
75 Ga0075430_100002619 3300006846 Bacteria 15035
76 Ga0075430_100027268 3300006846 Bacteria 4855
77 Ga0075430_101271407 3300006846 Unclassified 605
78 Ga0075431_100034536 3300006847 Bacteria 5209
79 Ga0075431_100046118 3300006847 Bacteria 4493
80 Ga0075431_100080563 3300006847 Bacteria 3361
81 Ga0075431_100165889 3300006847 Bacteria 2270
82 Ga0075431_100850291 3300006847 Bacteria 884
83 Ga0075433_10009163 3300006852 Bacteria 7906
84 Ga0075434_100007560 3300006871 Bacteria 10068
85 Ga0075429_100035557 3300006880 Bacteria 4333
86 Ga0068865_100526018 3300006881 Bacteria 990
87 Ga0075436_100277762 3300006914 Unclassified 1197
88 Ga0097620_100756197 3300006931 Bacteria 1061
89 Ga0075435_100175250 3300007076 Unclassified 1811
90 Ga0111539_10796962 3300009094 Bacteria 1100
91 Ga0111539_11562826 3300009094 Bacteria 765
92 Ga0105245_10412587 3300009098 Bacteria 1352
93 Ga0105245_10837134 3300009098 Bacteria 960
94 Ga0105245_11179353 3300009098 Bacteria 813
95 Ga0105245_11316655 3300009098 Bacteria 771
96 Ga0105247_10284625 3300009101 Bacteria 1141
97 Ga0114129_10000737 3300009147 Bacteria 41607
98 Ga0114129_10199828 3300009147 Bacteria 2708
99 Ga0114129_10235516 3300009147 Bacteria 2463
100 Ga0114129_10341035 3300009147 Bacteria 1987
101 Ga0114129_11131806 3300009147 Bacteria 978
102 Ga0114129_12090675 3300009147 Bacteria 683
103 Ga0114129_12253746 3300009147 Unclassified 654
104 Ga0114129_12306215 3300009147 Unclassified 646
105 Ga0105243_10044388 3300009148 Bacteria 3487
106 Ga0105243_10161539 3300009148 Bacteria 1932
107 Ga0105243_10246359 3300009148 Bacteria 1593
108 Ga0105243_11888180 3300009148 Bacteria 630
109 Ga0105242_10054478 3300009176 Bacteria 3269
110 Ga0105248_10450885 3300009177 Bacteria 1450
111 Ga0105249_10215403 3300009553 Bacteria 1887
112 Ga0105249_10262441 3300009553 Bacteria 1717
113 Ga0105249_11841890 3300009553 Bacteria 678
114 Ga0105249_11843582 3300009553 Unclassified 677
115 Ga0105249_13062871 3300009553 Bacteria 537
116 Ga0105239_10541272 3300010375 Bacteria 1326
117 Ga0105239_10542411 3300010375 Bacteria 1324
118 Ga0105239_11345623 3300010375 Bacteria 824
119 Ga0105246_10280827 3300011119 Bacteria 1336
120 Ga0157378_10193666 3300013297 Bacteria 1919
121 Ga0163162_10326387 3300013306 Bacteria 1667
122 Ga0163162_10567440 3300013306 Bacteria 1262
123 Ga0157375_10485271 3300013308 Bacteria 1401
124 Ga0157375_11065172 3300013308 Bacteria 945
125 Ga0157375_11773931 3300013308 Unclassified 731
126 Ga0163163_11013140 3300014325 Unclassified 894
127 Ga0163163_12092313 3300014325 Bacteria 626
128 Ga0157380_10310333 3300014326 Bacteria 1457
129 Ga0157380_10491184 3300014326 Bacteria 1190
130 Ga0157380_10915239 3300014326 Bacteria 904
131 Ga0157377_10231774 3300014745 Bacteria 1188
132 Ga0157377_10305665 3300014745 Bacteria 1051
133 Ga0157379_10968412 3300014968 Bacteria 810
134 Ga0206354_10899570 3300020081 Bacteria 719
135 Ga0213876_10569919 3300021384 Bacteria 602
136 Ga0213875_10218701 3300021388 Bacteria 897
137 Ga0207653_10045170 3300025885 Bacteria 1455
138 Ga0207688_10172626 3300025901 Bacteria 1286
139 Ga0207688_10338565 3300025901 Unclassified 925
140 Ga0207643_10084890 3300025908 Bacteria 1838
141 Ga0207643_10104950 3300025908 Bacteria 1660
142 Ga0207643_10118545 3300025908 Bacteria 1565
143 Ga0207643_10156592 3300025908 Bacteria 1369
144 Ga0207643_10582436 3300025908 Bacteria 719
145 Ga0207643_10856248 3300025908 Bacteria 589
146 Ga0207660_10361642 3300025917 Bacteria 1164
147 Ga0207662_10078842 3300025918 Bacteria 2006
148 Ga0207687_10202735 3300025927 Bacteria 1552
149 Ga0207687_10401601 3300025927 Bacteria 1127
150 Ga0207700_10257496 3300025928 Bacteria 1493
151 Ga0207664_10000976 3300025929 Bacteria 19279
152 Ga0207706_10144645 3300025933 Bacteria 2092
153 Ga0207709_10113422 3300025935 Bacteria 1817
154 Ga0207709_10180526 3300025935 Bacteria 1490
155 Ga0207709_10284721 3300025935 Bacteria 1222
156 Ga0207670_10553656 3300025936 Bacteria 940
157 Ga0207669_10001107 3300025937 Bacteria 11523
158 Ga0207669_10749232 3300025937 Bacteria 806
159 Ga0207704_10573955 3300025938 Bacteria 920
160 Ga0207704_10611357 3300025938 Bacteria 893
161 Ga0207679_10102296 3300025945 Bacteria 2243
162 Ga0207679_10504703 3300025945 Bacteria 1080
163 Ga0207651_11327921 3300025960 Bacteria 647
164 Ga0207712_10343662 3300025961 Bacteria 1238
165 Ga0207712_11414404 3300025961 Bacteria 622
166 Ga0207712_11567588 3300025961 Bacteria 590
167 Ga0207668_10548498 3300025972 Bacteria 1001
168 Ga0207668_11128295 3300025972 Bacteria 703
169 Ga0207668_11372595 3300025972 Unclassified 637
170 Ga0207640_10194392 3300025981 Bacteria 1532
171 Ga0207640_10435019 3300025981 Bacteria 1077
172 Ga0207678_10092969 3300026067 Bacteria 2577
173 Ga0207678_10152754 3300026067 Bacteria 1972
174 Ga0207678_10545855 3300026067 Bacteria 1013
175 Ga0207708_10322323 3300026075 Bacteria 1261
176 Ga0207708_10420785 3300026075 Bacteria 1108
177 Ga0207648_10063006 3300026089 Unclassified 3232
178 Ga0207648_10318238 3300026089 Bacteria 1398
179 Ga0207648_10515731 3300026089 Unclassified 1095
180 Ga0207648_10940501 3300026089 Bacteria 808
181 Ga0207648_11091807 3300026089 Bacteria 748
182 Ga0207648_11842791 3300026089 Bacteria 567
183 Ga0207676_11222242 3300026095 Bacteria 745
184 Ga0207675_100181715 3300026118 Bacteria 2014
185 Ga0207675_100242155 3300026118 Bacteria 1743
186 Ga0207675_101008104 3300026118 Bacteria 851
187 Ga0207683_10561389 3300026121 Bacteria 1056
188 Ga0207683_10658100 3300026121 Bacteria 970
189 Ga0207683_11206401 3300026121 Unclassified 701
190 Ga0207683_11684674 3300026121 Bacteria 583
191 Ga0207698_10527482 3300026142 Bacteria 1153
192 Ga0268265_10802152 3300028380 Bacteria 918
193 Ga0265327_10364371 3300031251 Unclassified 630
194 Ga0307408_100371122 3300031548 Bacteria 1220
195 Ga0307408_100430928 3300031548 Bacteria 1139
196 Ga0307408_100508208 3300031548 Bacteria 1056
197 Ga0307408_100539085 3300031548 Bacteria 1028
198 Ga0307405_10091673 3300031731 Bacteria 2014
199 Ga0307413_10110918 3300031824 Unclassified 1836
200 Ga0307413_10219633 3300031824 Bacteria 1387
201 Ga0307413_10293182 3300031824 Bacteria 1230
202 Ga0307413_10608266 3300031824 Bacteria 895
203 Ga0307413_10869737 3300031824 Bacteria 763
204 Ga0307410_10033318 3300031852 Bacteria 3325
205 Ga0307410_10057017 3300031852 Bacteria 2658
206 Ga0307410_10210877 3300031852 Bacteria 1488
207 Ga0307410_10767636 3300031852 Bacteria 817
208 Ga0326468_10023930 3300031889 Bacteria 755
209 Ga0307406_10012390 3300031901 Bacteria 4864
210 Ga0307406_10072651 3300031901 Bacteria 2259
211 Ga0307406_10086676 3300031901 Bacteria 2097
212 Ga0307406_10139756 3300031901 Bacteria 1712
213 Ga0307406_10147206 3300031901 Bacteria 1675
214 Ga0307406_10193845 3300031901 Bacteria 1490
215 Ga0307407_10043767 3300031903 Bacteria 2519
216 Ga0307407_10374794 3300031903 Bacteria 1014
217 Ga0307407_10384024 3300031903 Bacteria 1003
218 Ga0307407_11176031 3300031903 Bacteria 598
219 Ga0307412_10180553 3300031911 Bacteria 1587
220 Ga0307412_10620194 3300031911 Bacteria 919
221 Ga0307409_100041501 3300031995 Bacteria 3437
222 Ga0307409_100196334 3300031995 Bacteria 1801
223 Ga0307409_100216807 3300031995 Bacteria 1725
224 Ga0307409_100279008 3300031995 Bacteria 1543
225 Ga0307409_100420133 3300031995 Bacteria 1282
226 Ga0307409_100464431 3300031995 Bacteria 1224
227 Ga0307409_100721892 3300031995 Bacteria 998
228 Ga0307409_100905505 3300031995 Bacteria 896
229 Ga0307409_101424200 3300031995 Bacteria 719
230 Ga0307416_100022619 3300032002 Bacteria 4541
231 Ga0307416_100045055 3300032002 Bacteria 3470
232 Ga0307416_100236330 3300032002 Bacteria 1766
233 Ga0307416_101592263 3300032002 Unclassified 758
234 Ga0307416_101990121 3300032002 Bacteria 684
235 Ga0307416_103363024 3300032002 Bacteria 535
236 Ga0307414_10255480 3300032004 Bacteria 1459
237 Ga0307414_10276753 3300032004 Bacteria 1408
238 Ga0307414_10469689 3300032004 Bacteria 1107
239 Ga0307411_10078595 3300032005 Bacteria 2262
240 Ga0307411_10206853 3300032005 Bacteria 1512
241 Ga0307411_11134622 3300032005 Bacteria 706
242 Ga0307411_11939138 3300032005 Bacteria 549
243 Ga0307415_100048566 3300032126 Bacteria 2865
244 Ga0307415_100076316 3300032126 Bacteria 2375
245 Ga0307415_100889960 3300032126 Bacteria 820
246 Ga0307415_102106588 3300032126 Bacteria 551
247 Ga0316214_1002124 3300033545 Bacteria 2417
248 Ga0395899_0078865 3300037312 Bacteria 2400
249 Ga0395899_0598296 3300037312 Unclassified 703
250 Ga0395905_0337020 3300037471 Bacteria 1399
251 Ga0436364_0274572 3300037853 Bacteria 930
252 Ga0395901_1015111 3300038443 Unclassified 805
253 Ga0436365_0572507 3300039437 Bacteria 598
254 Ga0436365_1610966 3300039437 Unclassified 567
255 Ga0466969_0287264 3300044656 Bacteria 744
256 Ga0466966_0072780 3300044684 Bacteria 2151
257 Ga0466961_0010706 3300044693 Bacteria 5859
258 Ga0466963_0040410 3300044694 Bacteria 3057
259 Ga0466971_0003636 3300044719 Bacteria 6591
260 Ga0466957_0062420 3300044842 Bacteria 2288
261 Ga0466959_0085272 3300045049 Bacteria 2273
262 Ga0466958_0004852 3300045836 Bacteria 7160
263 Ga0466958_0102327 3300045836 Bacteria 1782
264 Ga0495605_0318299 3300046474 Bacteria 656
265 Ga0495605_0439198 3300046474 Unclassified 539
266 Ga0495607_0140693 3300046501 Bacteria 1245
267 Ga0495620_0307762 3300046515 Bacteria 602
268 Ga0495663_0309414 3300046525 Bacteria 570
269 Ga0495642_0321713 3300046528 Bacteria 679
270 Ga0495609_0451910 3300046538 Unclassified 510
271 Ga0495668_0213384 3300046616 Bacteria 1057
272 Ga0495649_0274495 3300046694 Bacteria 862
273 Ga0495676_0581905 3300047321 Unclassified 730
274 Ga0495679_118832 3300047446 Bacteria 724
275 Ga0496100_0883310 3300048903 Unclassified 702
276 Ga0496101_0462921 3300048904 Bacteria 1001
277 Ga0496101_0555324 3300048904 Bacteria 908
278 Ga0496102_0196370 3300048905 Bacteria 1902
279 Ga0496102_0299356 3300048905 Unclassified 1516
280 Ga0496102_0406945 3300048905 Bacteria 1279
281 Ga0496109_0127988 3300048912 Unclassified 2369
282 Ga0496109_1362220 3300048912 Bacteria 645
283 Ga0496113_0185219 3300048916 Unclassified 1651
284 Ga0501036_0674241 3300049572 Unclassified 855
285 Ga0501039_0149140 3300049575 Bacteria 1837
286 Ga0501039_0339166 3300049575 Bacteria 1181
287 Ga0501040_0134854 3300049576 Bacteria 1738
288 Ga0501040_0487711 3300049576 Bacteria 888
289 Ga0501040_0617639 3300049576 Unclassified 783
290 Ga0501042_0737215 3300049578 Bacteria 717
291 Ga0501067_0299441 3300049583 Bacteria 895
292 Ga0501067_0622324 3300049583 Bacteria 606
293 Ga0501068_0161620 3300049584 Bacteria 1412
294 Ga0501068_0452452 3300049584 Bacteria 831
295 Ga0501069_0608974 3300049585 Bacteria 656
296 Ga0501072_0225005 3300049588 Bacteria 1495
297 Ga0501072_0367240 3300049588 Bacteria 1142
298 Ga0501072_1309960 3300049588 Unclassified 561
299 Ga0501073_0168182 3300049589 Bacteria 1518
300 Ga0501075_0400185 3300049591 Bacteria 1047
301 Ga0501075_0560507 3300049591 Bacteria 872
302 Ga0501076_0560631 3300049592 Bacteria 942
303 Ga0501077_0306308 3300049593 Bacteria 1012
304 Ga0501080_1049691 3300049742 Bacteria 705
305 Ga0501081_0064101 3300049743 Bacteria 2552
306 Ga0501081_0898829 3300049743 Unclassified 668
307 Ga0501081_0963520 3300049743 Unclassified 644
308 Ga0501274_043475 3300049771 Bacteria 546
309 Ga0501045_0195392 3300049824 Bacteria 1508
310 nmdc:mga06z11_278493_c1 3300050494 Bacteria 990
311 nmdc:mga05p37_1464243_c1 3300050507 Bacteria 683
312 nmdc:mga05p37_1590145_c1 3300050507 Unclassified 645
313 nmdc:mga05p37_2530_c1 3300050507 Bacteria 21249
314 nmdc:mga05p37_588685_c1 3300050507 Unclassified 1258
315 nmdc:mga05p37_690215_c1 3300050507 Bacteria 1136
316 nmdc:mga05p37_731609_c1 3300050507 Bacteria 1094
317 nmdc:mga09592_109514_c1 3300050508 Bacteria 2369
318 nmdc:mga09592_648933_c1 3300050508 Bacteria 901
319 nmdc:mga0qj67_1590_c1 3300050509 Bacteria 15978
320 nmdc:mga06r32_216805_c1 3300050510 Unclassified 1902
321 nmdc:mga06r32_346615_c1 3300050510 Bacteria 1470
322 nmdc:mga06r32_4182_c1 3300050510 Bacteria 12930
323 nmdc:mga08y16_1503687_c1 3300050511 Bacteria 634
324 nmdc:mga0n895_1689_c1 3300050512 Bacteria 16676
325 nmdc:mga0n895_720843_c1 3300050512 Bacteria 992
326 nmdc:mga0rr50_95106_c1 3300050513 Unclassified 2328
327 nmdc:mga08x19_142887_c1 3300050514 Unclassified 1617
328 nmdc:mga0a205_24401_c1 3300050515 Bacteria 5750
329 Ga0495655_0082287 3300053083 Unclassified 923
330 Ga0495655_0272351 3300053083 Bacteria 575
331 Ga0495595_0557565 3300053084 Bacteria 585
332 Ga0495619_0483279 3300053085 Bacteria 852
333 Ga0495619_0567489 3300053085 Bacteria 778
334 Ga0501084_0588835 3300054114 Archaea 940
335 Ga0501082_0234508 3300060353 Bacteria 1597
336 Ga0501082_0686758 3300060353 Unclassified 896
337 Ga0501082_1155573 3300060353 Unclassified 677
338 Ga0501082_1534037 3300060353 Unclassified 582
339 Ga0070663_100445532
340 Ga0070683_100156626
341 Ga0070690_100629666
342 Ga0068869_100743334
343 Ga0070682_101017782
344 Ga0068868_100224448
345 Ga0070691_10303973
346 Ga0070692_10039477
347 Ga0070668_101301744
348 Ga0070668_101547614
349 Ga0070671_101018135
350 Ga0070674_100001649
351 Ga0070674_100036322
352 Ga0070688_100644140
353 Ga0070659_100521000
354 Ga0070703_10474442
355 Ga0070714_100097455
356 Ga0070713_100489031
357 Ga0070701_10089676
358 Ga0070705_100235229
359 Ga0070700_100341581
360 Ga0070694_100363339
361 Ga0070663_100363398
362 Ga0070663_100625236
363 Ga0070678_100806553
364 Ga0070662_100147639
365 Ga0070662_100511889
366 Ga0068867_100519512
367 Ga0068867_101439657
368 Ga0070685_10543539
369 Ga0070699_101293418
370 Ga0070699_101426079
371 Ga0070697_100811467
372 Ga0068853_101247246
373 Ga0070686_100907936
374 Ga0070695_100296874
375 Ga0070696_100085871
376 Ga0070693_100481143
377 Ga0070704_100094149
378 Ga0070704_100862802
379 Ga0070664_100237034
380 Ga0070664_101209042
381 Ga0068854_100315757
382 Ga0068854_100549651
383 Ga0070702_100006089
384 Ga0068852_100232266
385 Ga0068859_100756075
386 Ga0068866_10102946
387 Ga0068866_10796614
388 Ga0068861_100209344
389 Ga0068861_100660066
390 Ga0068861_101151810
391 Ga0068870_10116361
392 Ga0068870_10157990
393 Ga0068870_10215496
394 Ga0068870_10843873
395 Ga0068870_11005910
396 Ga0068862_100884148
397 Ga0068862_102540280
398 Ga0081455_10360049
399 Ga0081538_10000263
400 Ga0081538_10001296
401 Ga0081538_10001372
402 Ga0081538_10016210
403 Ga0081538_10020201
404 Ga0081538_10021928
405 Ga0081538_10030127
406 Ga0081538_10067294
407 Ga0081538_10079254
408 Ga0081538_10110411
409 Ga0081539_10299819
410 Ga0070717_10214842
411 Ga0075432_10266615
412 Ga0075428_100374391
413 Ga0075430_100002619
414 Ga0075430_100027268
415 Ga0075430_101271407
416 Ga0075431_100034536
417 Ga0075431_100046118
418 Ga0075431_100080563
419 Ga0075431_100165889
420 Ga0075431_100850291
421 Ga0075433_10009163
422 Ga0075434_100007560
423 Ga0075429_100035557
424 Ga0068865_100526018
425 Ga0075436_100277762
426 Ga0097620_100756197
427 Ga0075435_100175250
428 Ga0111539_10796962
429 Ga0111539_11562826
430 Ga0105245_10412587
431 Ga0105245_10837134
432 Ga0105245_11179353
433 Ga0105245_11316655
434 Ga0105247_10284625
435 Ga0114129_10000737
436 Ga0114129_10199828
437 Ga0114129_10235516
438 Ga0114129_10341035
439 Ga0114129_11131806
440 Ga0114129_12090675
441 Ga0114129_12253746
442 Ga0114129_12306215
443 Ga0105243_10044388
444 Ga0105243_10161539
445 Ga0105243_10246359
446 Ga0105243_11888180
447 Ga0105242_10054478
448 Ga0105248_10450885
449 Ga0105249_10215403
450 Ga0105249_10262441
451 Ga0105249_11841890
452 Ga0105249_11843582
453 Ga0105249_13062871
454 Ga0105239_10541272
455 Ga0105239_10542411
456 Ga0105239_11345623
457 Ga0105246_10280827
458 Ga0157378_10193666
459 Ga0163162_10326387
460 Ga0163162_10567440
461 Ga0157375_10485271
462 Ga0157375_11065172
463 Ga0157375_11773931
464 Ga0163163_11013140
465 Ga0163163_12092313
466 Ga0157380_10310333
467 Ga0157380_10491184
468 Ga0157380_10915239
469 Ga0157377_10231774
470 Ga0157377_10305665
471 Ga0157379_10968412
472 Ga0206354_10899570
473 Ga0213876_10569919
474 Ga0213875_10218701
475 Ga0207653_10045170
476 Ga0207688_10172626
477 Ga0207688_10338565
478 Ga0207643_10084890
479 Ga0207643_10104950
480 Ga0207643_10118545
481 Ga0207643_10156592
482 Ga0207643_10582436
483 Ga0207643_10856248
484 Ga0207660_10361642
485 Ga0207662_10078842
486 Ga0207687_10202735
487 Ga0207687_10401601
488 Ga0207700_10257496
489 Ga0207664_10000976
490 Ga0207706_10144645
491 Ga0207709_10113422
492 Ga0207709_10180526
493 Ga0207709_10284721
494 Ga0207670_10553656
495 Ga0207669_10001107
496 Ga0207669_10749232
497 Ga0207704_10573955
498 Ga0207704_10611357
499 Ga0207679_10102296
500 Ga0207679_10504703
501 Ga0207651_11327921
502 Ga0207712_10343662
503 Ga0207712_11414404
504 Ga0207712_11567588
505 Ga0207668_10548498
506 Ga0207668_11128295
507 Ga0207668_11372595
508 Ga0207640_10194392
509 Ga0207640_10435019
510 Ga0207678_10092969
511 Ga0207678_10152754
512 Ga0207678_10545855
513 Ga0207708_10322323
514 Ga0207708_10420785
515 Ga0207648_10063006
516 Ga0207648_10318238
517 Ga0207648_10515731
518 Ga0207648_10940501
519 Ga0207648_11091807
520 Ga0207648_11842791
521 Ga0207676_11222242
522 Ga0207675_100181715
523 Ga0207675_100242155
524 Ga0207675_101008104
525 Ga0207683_10561389
526 Ga0207683_10658100
527 Ga0207683_11206401
528 Ga0207683_11684674
529 Ga0207698_10527482
530 Ga0268265_10802152
531 Ga0265327_10364371
532 Ga0307408_100371122
533 Ga0307408_100430928
534 Ga0307408_100508208
535 Ga0307408_100539085
536 Ga0307405_10091673
537 Ga0307413_10110918
538 Ga0307413_10219633
539 Ga0307413_10293182
540 Ga0307413_10608266
541 Ga0307413_10869737
542 Ga0307410_10033318
543 Ga0307410_10057017
544 Ga0307410_10210877
545 Ga0307410_10767636
546 Ga0326468_10023930
547 Ga0307406_10012390
548 Ga0307406_10072651
549 Ga0307406_10086676
550 Ga0307406_10139756
551 Ga0307406_10147206
552 Ga0307406_10193845
553 Ga0307407_10043767
554 Ga0307407_10374794
555 Ga0307407_10384024
556 Ga0307407_11176031
557 Ga0307412_10180553
558 Ga0307412_10620194
559 Ga0307409_100041501
560 Ga0307409_100196334
561 Ga0307409_100216807
562 Ga0307409_100279008
563 Ga0307409_100420133
564 Ga0307409_100464431
565 Ga0307409_100721892
566 Ga0307409_100905505
567 Ga0307409_101424200
568 Ga0307416_100022619
569 Ga0307416_100045055
570 Ga0307416_100236330
571 Ga0307416_101592263
572 Ga0307416_101990121
573 Ga0307416_103363024
574 Ga0307414_10255480
575 Ga0307414_10276753
576 Ga0307414_10469689
577 Ga0307411_10078595
578 Ga0307411_10206853
579 Ga0307411_11134622
580 Ga0307411_11939138
581 Ga0307415_100048566
582 Ga0307415_100076316
583 Ga0307415_100889960
584 Ga0307415_102106588
585 Ga0316214_1002124
586 Ga0395899_0078865
587 Ga0395899_0598296
588 Ga0395905_0337020
589 Ga0436364_0274572
590 Ga0395901_1015111
591 Ga0436365_0572507
592 Ga0436365_1610966
593 Ga0466969_0287264
594 Ga0466966_0072780
595 Ga0466961_0010706
596 Ga0466963_0040410
597 Ga0466971_0003636
598 Ga0466957_0062420
599 Ga0466959_0085272
600 Ga0466958_0004852
601 Ga0466958_0102327
602 Ga0495605_0318299
603 Ga0495605_0439198
604 Ga0495607_0140693
605 Ga0495620_0307762
606 Ga0495663_0309414
607 Ga0495642_0321713
608 Ga0495609_0451910
609 Ga0495668_0213384
610 Ga0495649_0274495
611 Ga0495676_0581905
612 Ga0495679_118832
613 Ga0496100_0883310
614 Ga0496101_0462921
615 Ga0496101_0555324
616 Ga0496102_0196370
617 Ga0496102_0299356
618 Ga0496102_0406945
619 Ga0496109_0127988
620 Ga0496109_1362220
621 Ga0496113_0185219
622 Ga0501036_0674241
623 Ga0501039_0149140
624 Ga0501039_0339166
625 Ga0501040_0134854
626 Ga0501040_0487711
627 Ga0501040_0617639
628 Ga0501042_0737215
629 Ga0501067_0299441
630 Ga0501067_0622324
631 Ga0501068_0161620
632 Ga0501068_0452452
633 Ga0501069_0608974
634 Ga0501072_0225005
635 Ga0501072_0367240
636 Ga0501072_1309960
637 Ga0501073_0168182
638 Ga0501075_0400185
639 Ga0501075_0560507
640 Ga0501076_0560631
641 Ga0501077_0306308
642 Ga0501080_1049691
643 Ga0501081_0064101
644 Ga0501081_0898829
645 Ga0501081_0963520
646 Ga0501274_043475
647 Ga0501045_0195392
648 nmdc:mga06z11_278493_c1
649 nmdc:mga05p37_1464243_c1
650 nmdc:mga05p37_1590145_c1
651 nmdc:mga05p37_2530_c1
652 nmdc:mga05p37_588685_c1
653 nmdc:mga05p37_690215_c1
654 nmdc:mga05p37_731609_c1
655 nmdc:mga09592_109514_c1
656 nmdc:mga09592_648933_c1
657 nmdc:mga0qj67_1590_c1
658 nmdc:mga06r32_216805_c1
659 nmdc:mga06r32_346615_c1
660 nmdc:mga06r32_4182_c1
661 nmdc:mga08y16_1503687_c1
662 nmdc:mga0n895_1689_c1
663 nmdc:mga0n895_720843_c1
664 nmdc:mga0rr50_95106_c1
665 nmdc:mga08x19_142887_c1
666 nmdc:mga0a205_24401_c1
667 Ga0495655_0082287
668 Ga0495655_0272351
669 Ga0495595_0557565
670 Ga0495619_0483279
671 Ga0495619_0567489
672 Ga0501084_0588835
673 Ga0501082_0234508
674 Ga0501082_0686758
675 Ga0501082_1155573
676 Ga0501082_1534037

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00582

Usp

Universal stress protein family

19

160

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ab7-assembly3.cif.gz_B crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 0.8853 4 139
5ahw-assembly3.cif.gz_E crystal structure of universal stress protein msmeg_3811 in complex with camp 0.8825 2 139
5ahw-assembly2.cif.gz_D crystal structure of universal stress protein msmeg_3811 in complex with camp 0.8725 2 139
5ahw-assembly3.cif.gz_E crystal structure of universal stress protein msmeg_3811 in complex with camp 0.8627 2 139
3loq-assembly1.cif.gz_A the crystal structure of a universal stress protein from archaeoglobus fulgidus dsm 4304 0.8576 4 138
ID Description Score Start End Superfamily
af_Q54L57_1_123_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8616 4 137 3.40.50.620
af_Q54L57_1_123_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8487 4 137 3.40.50.620
3loqB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8426 5 137 3.40.50.620
af_Q2FXL6_6_143_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8359 5 137 3.40.50.620
af_Q57951_25_170_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8348 1 139 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7V0UH70-F1-model_v4 Universal stress protein 0.8894 2 138
AF-A0A5C6ZA07-F1-model_v4 Universal stress protein 0.8852 1 139
AF-A0A532AWY1-F1-model_v4 Universal stress protein 0.8829 1 137
AF-A0A5C6ZA07-F1-model_v4 Universal stress protein 0.8793 1 139
AF-A0A532DW73-F1-model_v4 Universal stress protein 0.8721 1 137

Map