F413374

General Info

Members Datasets Scaffolds Average Seq Length
338 166 338 289

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100136820|Ga0068869_1001368202
Length 317
Sequence MNWVGRGSALSLGVARSIVHGTFLISALATSFSALGQLPVTILRPTGLMKLLPWSFYDRLLTPSGMAVFKTVMLLSLLLSTFGFLTSFSTRLSFVLVLFYQGLVRSFGHYNHDEMLAVYYLAVLAFTPCGDLFSLDHWTKRKQANQPGFAYGYPILLMQLLMAWLYFSSALVKLRVSGLKYLSPDNFPVLAIYHSLDNLHDTNFKLAFWLPQIRQLLPVMVGLVIFWELLFPLAVFWRRSRWWILGFGVLFHLMTLFFMNLFFPYQLAMYLIFVDWEKVAGWINRPPQHLYDTQLHAVGKGQAQRAPAGNHDSRVKV

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
139 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
142 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
151 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
152 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
153 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
154 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
155 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
156 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
157 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
158 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
159 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.96
Rhizosphere 96.15
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000019 3300000532 Bacteria 10201
2 JGI24748J21848_1000018 3300002074 Bacteria 129847
3 JGI24749J21850_1019311 3300002076 Unclassified 963
4 JGI24034J26672_10000001 3300002239 Bacteria 1118280
5 JGI24751J29686_10000035 3300002459 Bacteria 85216
6 JGI25406J46586_10004656 3300003203 Bacteria 6388
7 rootH2_10126299 3300003320 Bacteria 2707
8 rootH2_10339573 3300003320 Bacteria 1114
9 rootL2_10013251 3300003322 Bacteria 6155
10 Ga0065714_10064667 3300005288 Bacteria 24941
11 Ga0065712_10005623 3300005290 Bacteria 6109
12 Ga0065712_10067861 3300005290 Bacteria 24941
13 Ga0065712_10080719 3300005290 Unclassified 3075
14 Ga0065715_10008264 3300005293 Unclassified 2874
15 Ga0065715_10089040 3300005293 Bacteria 15956
16 Ga0065715_10161817 3300005293 Bacteria 1622
17 Ga0065707_10111943 3300005295 Bacteria 2378
18 Ga0070690_100002256 3300005330 Bacteria 10337
19 Ga0070670_100000055 3300005331 Bacteria 120693
20 Ga0070670_100100504 3300005331 Bacteria 2490
21 Ga0068869_100042713 3300005334 Unclassified 3252
22 Ga0068869_100136820 3300005334 Bacteria 1888
23 Ga0070666_10035865 3300005335 Unclassified 3289
24 Ga0070680_100000302 3300005336 Bacteria 32984
25 Ga0070680_100074837 3300005336 Bacteria 2787
26 Ga0070682_100001589 3300005337 Bacteria 12661
27 Ga0070682_100003467 3300005337 Bacteria 8728
28 Ga0068868_100051309 3300005338 Unclassified 3244
29 Ga0070689_100314791 3300005340 Bacteria 1306
30 Ga0070687_100197496 3300005343 Unclassified 1217
31 Ga0070692_10036640 3300005345 Bacteria 2490
32 Ga0070668_100198906 3300005347 Unclassified 1645
33 Ga0070669_100139509 3300005353 Bacteria 1868
34 Ga0070675_100329090 3300005354 Unclassified 1351
35 Ga0070671_100006086 3300005355 Bacteria 9612
36 Ga0070671_100244729 3300005355 Bacteria 1523
37 Ga0070674_100095512 3300005356 Bacteria 2155
38 Ga0070673_100391115 3300005364 Unclassified 1241
39 Ga0070688_100305773 3300005365 Unclassified 1151
40 Ga0070659_100381839 3300005366 Unclassified 1187
41 Ga0070667_100026408 3300005367 Unclassified 4831
42 Ga0070701_10076232 3300005438 Unclassified 1805
43 Ga0070701_10133190 3300005438 Bacteria 1414
44 Ga0070705_100078741 3300005440 Unclassified 2017
45 Ga0070705_100235581 3300005440 Bacteria 1276
46 Ga0070700_100000092 3300005441 Bacteria 60316
47 Ga0070700_100131860 3300005441 Bacteria 1687
48 Ga0070694_100012090 3300005444 Bacteria 5360
49 Ga0070694_100012288 3300005444 Bacteria 5319
50 Ga0070694_100015495 3300005444 Bacteria 4790
51 Ga0070694_100198505 3300005444 Bacteria 1494
52 Ga0070694_100277012 3300005444 Unclassified 1278
53 Ga0070708_100000388 3300005445 Bacteria 33202
54 Ga0070708_100248925 3300005445 Bacteria 1669
55 Ga0070678_100233351 3300005456 Bacteria 1535
56 Ga0070681_10002802 3300005458 Bacteria 16097
57 Ga0070706_100000097 3300005467 Bacteria 106315
58 Ga0070706_100013009 3300005467 Bacteria 7700
59 Ga0070707_100020907 3300005468 Bacteria 6179
60 Ga0070707_100292532 3300005468 Bacteria 1583
61 Ga0070698_100000507 3300005471 Bacteria 41415
62 Ga0070698_100052823 3300005471 Unclassified 4131
63 Ga0070699_100002809 3300005518 Bacteria 15540
64 Ga0070699_100073762 3300005518 Bacteria 2969
65 Ga0070699_100115262 3300005518 Bacteria 2361
66 Ga0070699_100218892 3300005518 Bacteria 1696
67 Ga0070699_100505572 3300005518 Bacteria 1098
68 Ga0070679_100000106 3300005530 Bacteria 65572
69 Ga0068853_100636214 3300005539 Unclassified 1015
70 Ga0070672_100050669 3300005543 Bacteria 3235
71 Ga0070695_100010001 3300005545 Bacteria 5656
72 Ga0070695_100069369 3300005545 Unclassified 2304
73 Ga0070695_100200125 3300005545 Bacteria 1427
74 Ga0070696_100027217 3300005546 Bacteria 3894
75 Ga0070696_100195956 3300005546 Bacteria 1506
76 Ga0070693_100003450 3300005547 Bacteria 7374
77 Ga0070693_100005609 3300005547 Bacteria 6050
78 Ga0070665_100174740 3300005548 Bacteria 2149
79 Ga0070704_100054742 3300005549 Unclassified 2825
80 Ga0070704_100086178 3300005549 Bacteria 2327
81 Ga0070704_100089840 3300005549 Bacteria 2286
82 Ga0068854_100274564 3300005578 Unclassified 1355
83 Ga0068856_100078354 3300005614 Bacteria 3276
84 Ga0070702_100015442 3300005615 Bacteria 3899
85 Ga0070702_100025842 3300005615 Unclassified 3150
86 Ga0070702_100223833 3300005615 Unclassified 1260
87 Ga0068852_100387644 3300005616 Unclassified 1372
88 Ga0068859_100001186 3300005617 Bacteria 26604
89 Ga0068859_100018014 3300005617 Bacteria 7097
90 Ga0068859_100040863 3300005617 Bacteria 4658
91 Ga0068859_100057938 3300005617 Bacteria 3902
92 Ga0068859_100094761 3300005617 Unclassified 3038
93 Ga0068859_100145253 3300005617 Unclassified 2447
94 Ga0068859_100166752 3300005617 Bacteria 2282
95 Ga0068859_100261672 3300005617 Bacteria 1821
96 Ga0068859_100277363 3300005617 Bacteria 1769
97 Ga0068859_100293689 3300005617 Bacteria 1718
98 Ga0068859_100398289 3300005617 Bacteria 1472
99 Ga0068864_100028459 3300005618 Unclassified 4724
100 Ga0068864_100070502 3300005618 Bacteria 3041
101 Ga0068864_100113205 3300005618 Unclassified 2419
102 Ga0068864_100292193 3300005618 Bacteria 1524
103 Ga0068866_10022190 3300005718 Bacteria 2935
104 Ga0068861_100083612 3300005719 Bacteria 2504
105 Ga0068861_100435225 3300005719 Unclassified 1172
106 Ga0068851_10001963 3300005834 Bacteria 9038
107 Ga0068870_10062068 3300005840 Bacteria 2011
108 Ga0068863_100032971 3300005841 Bacteria 4934
109 Ga0068863_100156581 3300005841 Unclassified 2181
110 Ga0068863_100191614 3300005841 Unclassified 1965
111 Ga0068863_100384116 3300005841 Bacteria 1371
112 Ga0068858_100000089 3300005842 Bacteria 94932
113 Ga0068858_100019711 3300005842 Bacteria 6306
114 Ga0068858_100057291 3300005842 Unclassified 3601
115 Ga0068858_100116507 3300005842 Bacteria 2497
116 Ga0068858_100216420 3300005842 Unclassified 1813
117 Ga0068860_100023507 3300005843 Bacteria 5956
118 Ga0068860_100105108 3300005843 Bacteria 2696
119 Ga0068860_100157949 3300005843 Unclassified 2186
120 Ga0068860_100216342 3300005843 Unclassified 1859
121 Ga0068860_100289615 3300005843 Bacteria 1602
122 Ga0068860_100316384 3300005843 Bacteria 1531
123 Ga0068860_100814355 3300005843 Unclassified 947
124 Ga0068862_100033458 3300005844 Bacteria 4345
125 Ga0068862_100365399 3300005844 Unclassified 1342
126 Ga0068862_100448551 3300005844 Unclassified 1216
127 Ga0068862_100671086 3300005844 Unclassified 1002
128 Ga0081539_10000067 3300005985 Bacteria 246361
129 Ga0081539_10002185 3300005985 Bacteria 28705
130 Ga0097621_100014748 3300006237 Bacteria 5858
131 Ga0097621_100195075 3300006237 Unclassified 1755
132 Ga0068871_100007091 3300006358 Bacteria 7988
133 Ga0068871_100032453 3300006358 Unclassified 4126
134 Ga0068871_100033374 3300006358 Unclassified 4075
135 Ga0075428_100151215 3300006844 Bacteria 2522
136 Ga0075433_10012976 3300006852 Bacteria 6755
137 Ga0075433_10031376 3300006852 Bacteria 4542
138 Ga0075433_10055577 3300006852 Bacteria 3456
139 Ga0075433_10056596 3300006852 Unclassified 3425
140 Ga0075434_100102097 3300006871 Bacteria 2875
141 Ga0075429_100039243 3300006880 Bacteria 4121
142 Ga0068865_100493228 3300006881 Bacteria 1020
143 Ga0075436_100002857 3300006914 Bacteria 11827
144 Ga0097620_100001186 3300006931 Bacteria 26604
145 Ga0097620_100018012 3300006931 Bacteria 7097
146 Ga0097620_100040866 3300006931 Bacteria 4658
147 Ga0097620_100057937 3300006931 Bacteria 3902
148 Ga0097620_100083597 3300006931 Unclassified 3235
149 Ga0097620_100094758 3300006931 Unclassified 3038
150 Ga0097620_100145250 3300006931 Unclassified 2447
151 Ga0097620_100166751 3300006931 Bacteria 2282
152 Ga0097620_100261680 3300006931 Bacteria 1821
153 Ga0097620_100277383 3300006931 Bacteria 1769
154 Ga0097620_100293664 3300006931 Bacteria 1718
155 Ga0097620_100398272 3300006931 Bacteria 1472
156 Ga0105240_10089576 3300009093 Bacteria 3763
157 Ga0105240_10300202 3300009093 Bacteria 1837
158 Ga0105247_10000002 3300009101 Bacteria 724587
159 Ga0105247_10001902 3300009101 Bacteria 14575
160 Ga0105247_10051112 3300009101 Unclassified 2544
161 Ga0105247_10080205 3300009101 Bacteria 2055
162 Ga0114129_10026163 3300009147 Bacteria 8262
163 Ga0114129_10082161 3300009147 Unclassified 4477
164 Ga0114129_10647411 3300009147 Bacteria 1364
165 Ga0105243_10305219 3300009148 Bacteria 1444
166 Ga0105243_10475956 3300009148 Bacteria 1178
167 Ga0105241_10037020 3300009174 Unclassified 3675
168 Ga0105241_10093222 3300009174 Unclassified 2379
169 Ga0105241_10131949 3300009174 Bacteria 2023
170 Ga0105241_10304604 3300009174 Unclassified 1368
171 Ga0105241_10324236 3300009174 Unclassified 1329
172 Ga0105242_10424725 3300009176 Bacteria 1246
173 Ga0105242_10617192 3300009176 Bacteria 1050
174 Ga0105248_10007848 3300009177 Bacteria 11722
175 Ga0105248_10048214 3300009177 Unclassified 4778
176 Ga0105248_10092123 3300009177 Bacteria 3413
177 Ga0105248_10138484 3300009177 Unclassified 2746
178 Ga0105248_10159610 3300009177 Bacteria 2544
179 Ga0105248_10169203 3300009177 Bacteria 2463
180 Ga0105238_10009631 3300009551 Bacteria 9664
181 Ga0105249_10012096 3300009553 Bacteria 7597
182 Ga0105239_10218256 3300010375 Bacteria 2138
183 Ga0105246_10097422 3300011119 Unclassified 2134
184 Ga0157374_10096080 3300013296 Bacteria 2834
185 Ga0157374_10479594 3300013296 Bacteria 1247
186 Ga0157378_10010717 3300013297 Bacteria 8015
187 Ga0157378_10525828 3300013297 Unclassified 1185
188 Ga0163162_10006125 3300013306 Bacteria 11646
189 Ga0163162_10032290 3300013306 Bacteria 5199
190 Ga0163162_10081098 3300013306 Bacteria 3314
191 Ga0163162_10207627 3300013306 Unclassified 2088
192 Ga0163162_10561092 3300013306 Bacteria 1269
193 Ga0157372_10011300 3300013307 Bacteria 9500
194 Ga0157375_10004368 3300013308 Bacteria 12271
195 Ga0157375_10092653 3300013308 Unclassified 3086
196 Ga0163163_10000183 3300014325 Bacteria 64505
197 Ga0163163_10016107 3300014325 Bacteria 6935
198 Ga0163163_10044836 3300014325 Unclassified 4339
199 Ga0163163_10510880 3300014325 Bacteria 1264
200 Ga0157380_10033023 3300014326 Bacteria 3983
201 Ga0157377_10022796 3300014745 Unclassified 3311
202 Ga0157377_10202785 3300014745 Unclassified 1260
203 Ga0157379_10286071 3300014968 Unclassified 1500
204 Ga0157379_10399865 3300014968 Unclassified 1263
205 Ga0207672_1000263 3300025223 Bacteria 7145
206 Ga0207697_10050799 3300025315 Bacteria 1712
207 Ga0207710_10000002 3300025900 Bacteria 1251998
208 Ga0207710_10000954 3300025900 Bacteria 15224
209 Ga0207647_10048442 3300025904 Bacteria 2639
210 Ga0207684_10000023 3300025910 Bacteria 334838
211 Ga0207684_10023374 3300025910 Bacteria 5278
212 Ga0207654_10115700 3300025911 Unclassified 1676
213 Ga0207654_10184887 3300025911 Bacteria 1362
214 Ga0207654_10264323 3300025911 Bacteria 1158
215 Ga0207707_10000006 3300025912 Bacteria 374131
216 Ga0207707_10347925 3300025912 Unclassified 1277
217 Ga0207695_10177172 3300025913 Bacteria 2054
218 Ga0207671_10032529 3300025914 Bacteria 3882
219 Ga0207660_10000268 3300025917 Bacteria 34148
220 Ga0207662_10003953 3300025918 Bacteria 7724
221 Ga0207662_10274168 3300025918 Bacteria 1114
222 Ga0207652_10000127 3300025921 Bacteria 82231
223 Ga0207681_10024571 3300025923 Bacteria 3869
224 Ga0207694_10007317 3300025924 Bacteria 8377
225 Ga0207650_10000001 3300025925 Bacteria 1545726
226 Ga0207650_10050097 3300025925 Bacteria 3087
227 Ga0207644_10000476 3300025931 Bacteria 25866
228 Ga0207644_10042629 3300025931 Unclassified 3217
229 Ga0207690_10138934 3300025932 Bacteria 1788
230 Ga0207686_10034755 3300025934 Bacteria 3019
231 Ga0207709_10108249 3300025935 Bacteria 1853
232 Ga0207709_10123199 3300025935 Bacteria 1754
233 Ga0207709_10184433 3300025935 Unclassified 1476
234 Ga0207670_10005368 3300025936 Bacteria 7028
235 Ga0207670_10291699 3300025936 Bacteria 1274
236 Ga0207704_10072304 3300025938 Bacteria 2192
237 Ga0207665_10138383 3300025939 Unclassified 1734
238 Ga0207691_10005170 3300025940 Bacteria 12595
239 Ga0207711_10023975 3300025941 Bacteria 5107
240 Ga0207711_10081028 3300025941 Unclassified 2836
241 Ga0207711_10090005 3300025941 Unclassified 2697
242 Ga0207711_10093501 3300025941 Bacteria 2648
243 Ga0207711_10093838 3300025941 Unclassified 2644
244 Ga0207711_10643603 3300025941 Unclassified 989
245 Ga0207689_10019283 3300025942 Bacteria 5750
246 Ga0207689_10025295 3300025942 Unclassified 4974
247 Ga0207689_10166602 3300025942 Bacteria 1816
248 Ga0207651_10042061 3300025960 Bacteria 3038
249 Ga0207712_10004434 3300025961 Bacteria 8865
250 Ga0207712_10015553 3300025961 Bacteria 4912
251 Ga0207712_10062229 3300025961 Bacteria 2652
252 Ga0207640_10043062 3300025981 Bacteria 2883
253 Ga0207640_10054188 3300025981 Bacteria 2621
254 Ga0207640_10073617 3300025981 Bacteria 2309
255 Ga0207640_10160953 3300025981 Bacteria 1661
256 Ga0207677_10296780 3300026023 Bacteria 1333
257 Ga0207677_10456656 3300026023 Bacteria 1096
258 Ga0207703_10000394 3300026035 Bacteria 46894
259 Ga0207703_10013811 3300026035 Bacteria 6292
260 Ga0207703_10014067 3300026035 Bacteria 6236
261 Ga0207703_10059746 3300026035 Unclassified 3114
262 Ga0207703_10065786 3300026035 Bacteria 2980
263 Ga0207703_10514347 3300026035 Bacteria 1125
264 Ga0207639_10035896 3300026041 Bacteria 3670
265 Ga0207639_10091443 3300026041 Bacteria 2436
266 Ga0207708_10000061 3300026075 Bacteria 92741
267 Ga0207708_10003946 3300026075 Bacteria 10921
268 Ga0207708_10144223 3300026075 Bacteria 1870
269 Ga0207702_10122851 3300026078 Bacteria 2326
270 Ga0207641_10032536 3300026088 Unclassified 4330
271 Ga0207641_10068226 3300026088 Bacteria 3048
272 Ga0207641_10069515 3300026088 Unclassified 3023
273 Ga0207641_10193525 3300026088 Unclassified 1871
274 Ga0207648_10048893 3300026089 Bacteria 3702
275 Ga0207648_10537053 3300026089 Bacteria 1073
276 Ga0207676_10007183 3300026095 Bacteria 7883
277 Ga0207676_10083898 3300026095 Bacteria 2596
278 Ga0207676_10156617 3300026095 Bacteria 1969
279 Ga0207674_10076153 3300026116 Bacteria 3364
280 Ga0207674_10124257 3300026116 Bacteria 2546
281 Ga0207674_10165023 3300026116 Bacteria 2169
282 Ga0207674_10248790 3300026116 Bacteria 1724
283 Ga0207675_100005235 3300026118 Bacteria 12483
284 Ga0207675_100012872 3300026118 Bacteria 7815
285 Ga0207675_100099629 3300026118 Bacteria 2737
286 Ga0207675_100178655 3300026118 Bacteria 2032
287 Ga0207428_10001514 3300027907 Bacteria 24274
288 Ga0207428_10144974 3300027907 Bacteria 1810
289 Ga0268265_10077203 3300028380 Unclassified 2616
290 Ga0268264_10126016 3300028381 Bacteria 2263
291 Ga0268264_10340585 3300028381 Unclassified 1424
292 Ga0268264_10580832 3300028381 Unclassified 1102
293 Ga0268264_10624345 3300028381 Bacteria 1064
294 Ga0314311_1095856 3300030733 Bacteria 1502
295 Ga0307414_10045736 3300032004 Unclassified 3000
296 Ga0373951_0000780 3300035091 Bacteria 8693
297 Ga0373942_0017070 3300035207 Bacteria 1786
298 Ga0395900_0638860 3300037418 Unclassified 1002
299 Ga0242420_004306 3300038996 Bacteria 2146
300 Ga0242420_013773 3300038996 Bacteria 1381
301 Ga0439458_0002670 3300042157 Bacteria 4304
302 Ga0496103_0056722 3300048906 Bacteria 2432
303 Ga0496104_0051185 3300048907 Bacteria 3898
304 Ga0496104_0183651 3300048907 Bacteria 2002
305 Ga0496106_0127067 3300048909 Bacteria 1997
306 Ga0496108_0106745 3300048911 Unclassified 2391
307 Ga0496109_0464742 3300048912 Unclassified 1195
308 Ga0496112_0216884 3300048915 Bacteria 1870
309 Ga0496112_0239375 3300048915 Bacteria 1768
310 Ga0496112_0583613 3300048915 Unclassified 1050
311 Ga0496113_0173361 3300048916 Bacteria 1709
312 Ga0501292_003012 3300049515 Bacteria 2219
313 Ga0501298_002357 3300049521 Unclassified 2851
314 Ga0501198_001398 3300049649 Unclassified 3142
315 Ga0501217_025201 3300049661 Bacteria 1429
316 Ga0501223_001330 3300049663 Bacteria 5720
317 Ga0501223_013614 3300049663 Bacteria 1619
318 Ga0501243_004362 3300049675 Bacteria 2119
319 Ga0501246_003279 3300049676 Unclassified 1303
320 Ga0501225_0030810 3300049705 Bacteria 1476
321 Ga0501234_003043 3300049707 Bacteria 2634
322 Ga0501234_004233 3300049707 Unclassified 2251
323 Ga0501212_001863 3300049851 Unclassified 2454
324 Ga0501212_004038 3300049851 Bacteria 1873
325 nmdc:mga05p37_124746_c1 3300050507 Bacteria 3162
326 nmdc:mga05p37_273722_c1 3300050507 Unclassified 2016
327 nmdc:mga09592_36111_c1 3300050508 Bacteria 4139
328 nmdc:mga09592_96940_c1 3300050508 Bacteria 2523
329 nmdc:mga08y16_28252_c1 3300050511 Bacteria 5912
330 nmdc:mga08y16_3441_c1 3300050511 Bacteria 16429
331 nmdc:mga0n895_273497_c1 3300050512 Bacteria 1713
332 nmdc:mga0n895_273516_c1 3300050512 Bacteria 1713
333 nmdc:mga0n895_658369_c1 3300050512 Unclassified 1045
334 nmdc:mga0rr50_97653_c1 3300050513 Bacteria 2301
335 nmdc:mga08x19_2215_c1 3300050514 Bacteria 11881
336 nmdc:mga0a205_185181_c1 3300050515 Bacteria 1975
337 nmdc:mga0a205_59198_c1 3300050515 Unclassified 3700
338 nmdc:mga0a205_69940_c1 3300050515 Bacteria 3389

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005340 Ga0070689_100314791 Ga0070689_1003147912 236
2 3300005615 Ga0070702_100223833 Ga0070702_1002238332 236
3 3300005518 Ga0070699_100505572 Ga0070699_1005055721 240
4 3300005547 Ga0070693_100003450 Ga0070693_1000034505 240
5 3300005615 Ga0070702_100025842 Ga0070702_1000258424 240
6 3300002076 JGI24749J21850_1019311 JGI24749J21850_10193111 242
7 3300005366 Ga0070659_100381839 Ga0070659_1003818392 242
8 3300005355 Ga0070671_100244729 Ga0070671_1002447292 248
9 3300009176 Ga0105242_10424725 Ga0105242_104247251 248
10 3300009177 Ga0105248_10007848 Ga0105248_100078486 248
11 3300013296 Ga0157374_10479594 Ga0157374_104795941 248
12 3300013306 Ga0163162_10006125 Ga0163162_100061254 248
13 3300014325 Ga0163163_10016107 Ga0163163_100161072 248
14 3300005618 Ga0068864_100292193 Ga0068864_1002921932 252
15 3300025939 Ga0207665_10138383 Ga0207665_101383833 257
16 3300050508 nmdc:mga09592_96940_c1 nmdc:mga09592_96940_c1_1416_2306 260
17 3300005290 Ga0065712_10080719 Ga0065712_100807192 266
18 3300005293 Ga0065715_10008264 Ga0065715_100082643 266
19 3300005295 Ga0065707_10111943 Ga0065707_101119432 266
20 3300005345 Ga0070692_10036640 Ga0070692_100366402 266
21 3300005364 Ga0070673_100391115 Ga0070673_1003911151 266
22 3300005843 Ga0068860_100157949 Ga0068860_1001579492 266
23 3300025960 Ga0207651_10042061 Ga0207651_100420612 266
24 3300026035 Ga0207703_10514347 Ga0207703_105143472 266
25 3300025904 Ga0207647_10048442 Ga0207647_100484424 267
26 3300025981 Ga0207640_10054188 Ga0207640_100541882 267
27 3300003203 JGI25406J46586_10004656 JGI25406J46586_100046567 268
28 3300005844 Ga0068862_100671086 Ga0068862_1006710861 268
29 3300005985 Ga0081539_10000067 Ga0081539_10000067110 268
30 3300006881 Ga0068865_100493228 Ga0068865_1004932281 268
31 3300026075 Ga0207708_10144223 Ga0207708_101442234 268
32 3300050514 nmdc:mga08x19_2215_c1 nmdc:mga08x19_2215_c1_7064_7879 268
33 3300005353 Ga0070669_100139509 Ga0070669_1001395092 270
34 3300005354 Ga0070675_100329090 Ga0070675_1003290901 270
35 3300005441 Ga0070700_100131860 Ga0070700_1001318602 270
36 3300005518 Ga0070699_100115262 Ga0070699_1001152622 270
37 3300005617 Ga0068859_100166752 Ga0068859_1001667524 270
38 3300005719 Ga0068861_100083612 Ga0068861_1000836122 270
39 3300005842 Ga0068858_100057291 Ga0068858_1000572913 270
40 3300005843 Ga0068860_100316384 Ga0068860_1003163842 270
41 3300006914 Ga0075436_100002857 Ga0075436_1000028577 270
42 3300006931 Ga0097620_100166751 Ga0097620_1001667514 270
43 3300025936 Ga0207670_10291699 Ga0207670_102916992 270
44 3300025941 Ga0207711_10081028 Ga0207711_100810282 270
45 3300026088 Ga0207641_10032536 Ga0207641_100325362 270
46 3300026089 Ga0207648_10048893 Ga0207648_100488932 270
47 3300026089 Ga0207648_10537053 Ga0207648_105370531 270
48 3300026116 Ga0207674_10124257 Ga0207674_101242574 270
49 3300026118 Ga0207675_100099629 Ga0207675_1000996292 270
50 3300028380 Ga0268265_10077203 Ga0268265_100772031 270
51 3300005334 Ga0068869_100042713 Ga0068869_1000427134 272
52 3300005440 Ga0070705_100078741 Ga0070705_1000787412 272
53 3300005617 Ga0068859_100261672 Ga0068859_1002616722 272
54 3300005842 Ga0068858_100216420 Ga0068858_1002164202 272
55 3300005843 Ga0068860_100023507 Ga0068860_1000235076 272
56 3300006931 Ga0097620_100261680 Ga0097620_1002616802 272
57 3300025942 Ga0207689_10025295 Ga0207689_100252957 272
58 3300026095 Ga0207676_10156617 Ga0207676_101566172 272
59 3300028381 Ga0268264_10580832 Ga0268264_105808322 272
60 3300009148 Ga0105243_10475956 Ga0105243_104759562 273
61 3300025935 Ga0207709_10184433 Ga0207709_101844331 273
62 3300050515 nmdc:mga0a205_59198_c1 nmdc:mga0a205_59198_c1_11_832 273
63 3300003320 rootH2_10126299 rootH2_101262994 274
64 3300005844 Ga0068862_100365399 Ga0068862_1003653991 274
65 3300005844 Ga0068862_100448551 Ga0068862_1004485512 274
66 3300025941 Ga0207711_10643603 Ga0207711_106436031 274
67 3300025961 Ga0207712_10062229 Ga0207712_100622295 275
68 3300026023 Ga0207677_10456656 Ga0207677_104566561 275
69 3300005545 Ga0070695_100069369 Ga0070695_1000693692 276
70 3300038996 Ga0242420_013773 Ga0242420_013773_424_1332 276
71 3300025911 Ga0207654_10115700 Ga0207654_101157002 277
72 3300011119 Ga0105246_10097422 Ga0105246_100974222 278
73 3300028381 Ga0268264_10624345 Ga0268264_106243451 278
74 3300005841 Ga0068863_100191614 Ga0068863_1001916142 280
75 3300025912 Ga0207707_10347925 Ga0207707_103479252 280
76 3300026095 Ga0207676_10083898 Ga0207676_100838982 280
77 3300026116 Ga0207674_10165023 Ga0207674_101650233 280
78 3300048907 Ga0496104_0183651 Ga0496104_0183651_871_1725 280
79 3300003320 rootH2_10339573 rootH2_103395731 281
80 3300005293 Ga0065715_10161817 Ga0065715_101618172 282
81 3300005336 Ga0070680_100000302 Ga0070680_10000030216 282
82 3300005458 Ga0070681_10002802 Ga0070681_1000280210 282
83 3300005468 Ga0070707_100292532 Ga0070707_1002925322 282
84 3300005518 Ga0070699_100073762 Ga0070699_1000737622 282
85 3300005530 Ga0070679_100000106 Ga0070679_10000010636 282
86 3300005546 Ga0070696_100195956 Ga0070696_1001959562 282
87 3300005614 Ga0068856_100078354 Ga0068856_1000783544 282
88 3300006852 Ga0075433_10012976 Ga0075433_100129765 282
89 3300006852 Ga0075433_10055577 Ga0075433_100555772 282
90 3300006871 Ga0075434_100102097 Ga0075434_1001020973 282
91 3300009093 Ga0105240_10300202 Ga0105240_103002022 282
92 3300009101 Ga0105247_10080205 Ga0105247_100802052 282
93 3300009147 Ga0114129_10026163 Ga0114129_100261634 282
94 3300009147 Ga0114129_10082161 Ga0114129_100821613 282
95 3300009174 Ga0105241_10304604 Ga0105241_103046042 282
96 3300009176 Ga0105242_10617192 Ga0105242_106171922 282
97 3300013306 Ga0163162_10561092 Ga0163162_105610922 282
98 3300025911 Ga0207654_10264323 Ga0207654_102643231 282
99 3300025912 Ga0207707_10000006 Ga0207707_1000000640 282
100 3300025917 Ga0207660_10000268 Ga0207660_1000026817 282
101 3300025921 Ga0207652_10000127 Ga0207652_1000012739 282
102 3300025942 Ga0207689_10166602 Ga0207689_101666022 282
103 3300025961 Ga0207712_10015553 Ga0207712_100155536 282
104 3300025981 Ga0207640_10043062 Ga0207640_100430622 282
105 3300026041 Ga0207639_10035896 Ga0207639_100358961 282
106 3300026078 Ga0207702_10122851 Ga0207702_101228511 282
107 3300037418 Ga0395900_0638860 Ga0395900_0638860_97_957 282
108 3300048906 Ga0496103_0056722 Ga0496103_0056722_1413_2273 282
109 3300048907 Ga0496104_0051185 Ga0496104_0051185_317_1177 282
110 3300048912 Ga0496109_0464742 Ga0496109_0464742_68_928 282
111 3300050507 nmdc:mga05p37_124746_c1 nmdc:mga05p37_124746_c1_1448_2344 282
112 3300050512 nmdc:mga0n895_273497_c1 nmdc:mga0n895_273497_c1_428_1288 282
113 3300050512 nmdc:mga0n895_273516_c1 nmdc:mga0n895_273516_c1_48_908 282
114 3300050515 nmdc:mga0a205_185181_c1 nmdc:mga0a205_185181_c1_724_1620 282
115 3300005549 Ga0070704_100086178 Ga0070704_1000861784 283
116 3300005842 Ga0068858_100019711 Ga0068858_1000197112 283
117 3300026035 Ga0207703_10014067 Ga0207703_100140672 283
118 3300050511 nmdc:mga08y16_3441_c1 nmdc:mga08y16_3441_c1_4845_5696 283
119 3300005330 Ga0070690_100002256 Ga0070690_1000022567 284
120 3300005343 Ga0070687_100197496 Ga0070687_1001974961 284
121 3300005347 Ga0070668_100198906 Ga0070668_1001989062 284
122 3300005356 Ga0070674_100095512 Ga0070674_1000955122 284
123 3300005365 Ga0070688_100305773 Ga0070688_1003057731 284
124 3300005438 Ga0070701_10076232 Ga0070701_100762323 284
125 3300005444 Ga0070694_100277012 Ga0070694_1002770122 284
126 3300005539 Ga0068853_100636214 Ga0068853_1006362141 284
127 3300005543 Ga0070672_100050669 Ga0070672_1000506693 284
128 3300005578 Ga0068854_100274564 Ga0068854_1002745642 284
129 3300005615 Ga0070702_100015442 Ga0070702_1000154422 284
130 3300005618 Ga0068864_100070502 Ga0068864_1000705023 284
131 3300005718 Ga0068866_10022190 Ga0068866_100221904 284
132 3300005841 Ga0068863_100032971 Ga0068863_1000329712 284
133 3300005843 Ga0068860_100216342 Ga0068860_1002163421 284
134 3300005844 Ga0068862_100033458 Ga0068862_1000334583 284
135 3300006237 Ga0097621_100195075 Ga0097621_1001950752 284
136 3300006358 Ga0068871_100007091 Ga0068871_1000070916 284
137 3300009174 Ga0105241_10131949 Ga0105241_101319492 284
138 3300009177 Ga0105248_10159610 Ga0105248_101596103 284
139 3300010375 Ga0105239_10218256 Ga0105239_102182562 284
140 3300013296 Ga0157374_10096080 Ga0157374_100960803 284
141 3300013297 Ga0157378_10010717 Ga0157378_100107178 284
142 3300014326 Ga0157380_10033023 Ga0157380_100330233 284
143 3300014745 Ga0157377_10022796 Ga0157377_100227963 284
144 3300025315 Ga0207697_10050799 Ga0207697_100507992 284
145 3300025918 Ga0207662_10003953 Ga0207662_100039537 284
146 3300025938 Ga0207704_10072304 Ga0207704_100723043 284
147 3300025940 Ga0207691_10005170 Ga0207691_100051709 284
148 3300025942 Ga0207689_10019283 Ga0207689_100192833 284
149 3300026118 Ga0207675_100012872 Ga0207675_1000128722 284
150 3300005290 Ga0065712_10005623 Ga0065712_100056234 285
151 3300005438 Ga0070701_10133190 Ga0070701_101331902 285
152 3300005547 Ga0070693_100005609 Ga0070693_1000056094 285
153 3300009101 Ga0105247_10001902 Ga0105247_100019025 285
154 3300014745 Ga0157377_10202785 Ga0157377_102027852 285
155 3300025900 Ga0207710_10000954 Ga0207710_1000095413 285
156 3300026088 Ga0207641_10193525 Ga0207641_101935252 285
157 3300032004 Ga0307414_10045736 Ga0307414_100457362 285
158 3300048909 Ga0496106_0127067 Ga0496106_0127067_538_1422 285
159 3300048916 Ga0496113_0173361 Ga0496113_0173361_298_1182 285
160 3300049515 Ga0501292_003012 Ga0501292_003012_77_982 285
161 3300049676 Ga0501246_003279 Ga0501246_003279_272_1177 285
162 3300049707 Ga0501234_004233 Ga0501234_004233_1238_2143 285
163 3300049851 Ga0501212_001863 Ga0501212_001863_1206_2111 285
164 3300005441 Ga0070700_100000092 Ga0070700_10000009220 286
165 3300005617 Ga0068859_100398289 Ga0068859_1003982892 286
166 3300005985 Ga0081539_10002185 Ga0081539_100021855 286
167 3300006931 Ga0097620_100398272 Ga0097620_1003982722 286
168 3300009174 Ga0105241_10037020 Ga0105241_100370205 286
169 3300009174 Ga0105241_10324236 Ga0105241_103242362 286
170 3300025918 Ga0207662_10274168 Ga0207662_102741682 286
171 3300026075 Ga0207708_10000061 Ga0207708_1000006120 286
172 3300038996 Ga0242420_004306 Ga0242420_004306_956_1843 286
173 3300048911 Ga0496108_0106745 Ga0496108_0106745_1097_1966 286
174 3300005617 Ga0068859_100040863 Ga0068859_1000408634 287
175 3300005617 Ga0068859_100293689 Ga0068859_1002936891 287
176 3300005618 Ga0068864_100113205 Ga0068864_1001132052 287
177 3300006931 Ga0097620_100040866 Ga0097620_1000408664 287
178 3300006931 Ga0097620_100293664 Ga0097620_1002936643 287
179 3300025935 Ga0207709_10108249 Ga0207709_101082492 287
180 3300026116 Ga0207674_10076153 Ga0207674_100761532 287
181 3300026116 Ga0207674_10248790 Ga0207674_102487902 288
182 3300049675 Ga0501243_004362 Ga0501243_004362_1139_2023 288
183 3300002459 JGI24751J29686_10000035 JGI24751J29686_1000003513 289
184 3300005331 Ga0070670_100000055 Ga0070670_10000005589 289
185 3300005616 Ga0068852_100387644 Ga0068852_1003876442 289
186 3300005617 Ga0068859_100018014 Ga0068859_1000180146 289
187 3300005843 Ga0068860_100814355 Ga0068860_1008143551 289
188 3300006931 Ga0097620_100018012 Ga0097620_1000180123 289
189 3300009148 Ga0105243_10305219 Ga0105243_103052191 289
190 3300009174 Ga0105241_10093222 Ga0105241_100932222 289
191 3300009551 Ga0105238_10009631 Ga0105238_100096319 289
192 3300009553 Ga0105249_10012096 Ga0105249_100120969 289
193 3300013297 Ga0157378_10525828 Ga0157378_105258281 289
194 3300013306 Ga0163162_10207627 Ga0163162_102076273 289
195 3300014325 Ga0163163_10000183 Ga0163163_1000018320 289
196 3300014325 Ga0163163_10510880 Ga0163163_105108801 289
197 3300025911 Ga0207654_10184887 Ga0207654_101848872 289
198 3300025923 Ga0207681_10024571 Ga0207681_100245712 289
199 3300025924 Ga0207694_10007317 Ga0207694_100073179 289
200 3300025925 Ga0207650_10000001 Ga0207650_10000001532 289
201 3300025934 Ga0207686_10034755 Ga0207686_100347553 289
202 3300025935 Ga0207709_10123199 Ga0207709_101231992 289
203 3300025941 Ga0207711_10023975 Ga0207711_100239754 289
204 3300025961 Ga0207712_10004434 Ga0207712_100044346 289
205 3300026035 Ga0207703_10059746 Ga0207703_100597463 289
206 3300026075 Ga0207708_10003946 Ga0207708_100039463 289
207 3300026118 Ga0207675_100005235 Ga0207675_1000052353 289
208 3300028381 Ga0268264_10126016 Ga0268264_101260162 289
209 3300005444 Ga0070694_100012090 Ga0070694_1000120903 290
210 3300005617 Ga0068859_100145253 Ga0068859_1001452533 290
211 3300006931 Ga0097620_100145250 Ga0097620_1001452503 290
212 3300013306 Ga0163162_10081098 Ga0163162_100810984 290
213 3300013308 Ga0157375_10004368 Ga0157375_100043684 290
214 3300013308 Ga0157375_10092653 Ga0157375_100926533 290
215 3300048915 Ga0496112_0583613 Ga0496112_0583613_123_1007 290
216 3300049663 Ga0501223_013614 Ga0501223_013614_243_1115 290
217 3300002074 JGI24748J21848_1000018 JGI24748J21848_100001894 291
218 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001437 291
219 3300005445 Ga0070708_100000388 Ga0070708_10000038817 291
220 3300005445 Ga0070708_100248925 Ga0070708_1002489252 291
221 3300005467 Ga0070706_100013009 Ga0070706_1000130095 291
222 3300005468 Ga0070707_100020907 Ga0070707_1000209076 291
223 3300005471 Ga0070698_100052823 Ga0070698_1000528234 291
224 3300005518 Ga0070699_100002809 Ga0070699_1000028095 291
225 3300005518 Ga0070699_100218892 Ga0070699_1002188922 291
226 3300005842 Ga0068858_100000089 Ga0068858_10000008933 291
227 3300009101 Ga0105247_10000002 Ga0105247_10000002550 291
228 3300025223 Ga0207672_1000263 Ga0207672_10002635 291
229 3300025900 Ga0207710_10000002 Ga0207710_10000002550 291
230 3300025910 Ga0207684_10023374 Ga0207684_100233745 291
231 3300025931 Ga0207644_10000476 Ga0207644_1000047610 291
232 3300026035 Ga0207703_10000394 Ga0207703_1000039430 291
233 3300026088 Ga0207641_10069515 Ga0207641_100695152 291
234 3300005617 Ga0068859_100277363 Ga0068859_1002773632 292
235 3300006844 Ga0075428_100151215 Ga0075428_1001512152 292
236 3300006880 Ga0075429_100039243 Ga0075429_1000392432 292
237 3300006931 Ga0097620_100277383 Ga0097620_1002773832 292
238 3300009177 Ga0105248_10169203 Ga0105248_101692032 292
239 3300013306 Ga0163162_10032290 Ga0163162_100322904 292
240 3300027907 Ga0207428_10001514 Ga0207428_1000151420 292
241 3300050508 nmdc:mga09592_36111_c1 nmdc:mga09592_36111_c1_572_1462 292
242 3300005288 Ga0065714_10064667 Ga0065714_1006466716 293
243 3300005290 Ga0065712_10067861 Ga0065712_1006786116 293
244 3300005293 Ga0065715_10089040 Ga0065715_100890409 293
245 3300005337 Ga0070682_100001589 Ga0070682_1000015899 293
246 3300005355 Ga0070671_100006086 Ga0070671_1000060864 293
247 3300005617 Ga0068859_100057938 Ga0068859_1000579385 293
248 3300005834 Ga0068851_10001963 Ga0068851_100019635 293
249 3300006931 Ga0097620_100057937 Ga0097620_1000579372 293
250 3300009177 Ga0105248_10092123 Ga0105248_100921234 293
251 3300014968 Ga0157379_10286071 Ga0157379_102860711 293
252 3300014968 Ga0157379_10399865 Ga0157379_103998651 293
253 3300025914 Ga0207671_10032529 Ga0207671_100325292 293
254 3300025925 Ga0207650_10050097 Ga0207650_100500972 293
255 3300003322 rootL2_10013251 rootL2_100132515 294
256 3300005336 Ga0070680_100074837 Ga0070680_1000748372 294
257 3300005440 Ga0070705_100235581 Ga0070705_1002355811 294
258 3300005444 Ga0070694_100012288 Ga0070694_1000122882 294
259 3300005444 Ga0070694_100015495 Ga0070694_1000154951 294
260 3300005456 Ga0070678_100233351 Ga0070678_1002333511 294
261 3300005467 Ga0070706_100000097 Ga0070706_1000000973 294
262 3300005545 Ga0070695_100200125 Ga0070695_1002001252 294
263 3300005546 Ga0070696_100027217 Ga0070696_1000272172 294
264 3300005617 Ga0068859_100094761 Ga0068859_1000947614 294
265 3300005843 Ga0068860_100289615 Ga0068860_1002896152 294
266 3300006931 Ga0097620_100094758 Ga0097620_1000947584 294
267 3300009093 Ga0105240_10089576 Ga0105240_100895765 294
268 3300009177 Ga0105248_10138484 Ga0105248_101384842 294
269 3300013307 Ga0157372_10011300 Ga0157372_100113007 294
270 3300025910 Ga0207684_10000023 Ga0207684_10000023174 294
271 3300025913 Ga0207695_10177172 Ga0207695_101771722 294
272 3300025941 Ga0207711_10090005 Ga0207711_100900052 294
273 3300025981 Ga0207640_10160953 Ga0207640_101609532 294
274 3300028381 Ga0268264_10340585 Ga0268264_103405851 294
275 3300048915 Ga0496112_0216884 Ga0496112_0216884_931_1821 294
276 3300049521 Ga0501298_002357 Ga0501298_002357_460_1350 294
277 3300049649 Ga0501198_001398 Ga0501198_001398_1401_2291 294
278 3300049661 Ga0501217_025201 Ga0501217_025201_44_934 294
279 3300049663 Ga0501223_001330 Ga0501223_001330_668_1558 294
280 3300049705 Ga0501225_0030810 Ga0501225_0030810_557_1447 294
281 3300049707 Ga0501234_003043 Ga0501234_003043_1628_2518 294
282 3300049851 Ga0501212_004038 Ga0501212_004038_349_1239 294
283 3300005331 Ga0070670_100100504 Ga0070670_1001005042 295
284 3300005471 Ga0070698_100000507 Ga0070698_1000005073 295
285 3300006852 Ga0075433_10031376 Ga0075433_100313765 295
286 3300035207 Ga0373942_0017070 Ga0373942_0017070_672_1595 295
287 3300050515 nmdc:mga0a205_69940_c1 nmdc:mga0a205_69940_c1_236_1126 295
288 3300005334 Ga0068869_100136820 Ga0068869_1001368202 296
289 3300005335 Ga0070666_10035865 Ga0070666_100358655 296
290 3300005338 Ga0068868_100051309 Ga0068868_1000513094 296
291 3300005367 Ga0070667_100026408 Ga0070667_1000264086 296
292 3300005444 Ga0070694_100198505 Ga0070694_1001985052 296
293 3300005548 Ga0070665_100174740 Ga0070665_1001747402 296
294 3300005618 Ga0068864_100028459 Ga0068864_1000284592 296
295 3300005719 Ga0068861_100435225 Ga0068861_1004352252 296
296 3300005840 Ga0068870_10062068 Ga0068870_100620682 296
297 3300005841 Ga0068863_100384116 Ga0068863_1003841162 296
298 3300005842 Ga0068858_100116507 Ga0068858_1001165072 296
299 3300006358 Ga0068871_100033374 Ga0068871_1000333745 296
300 3300006852 Ga0075433_10056596 Ga0075433_100565964 296
301 3300014325 Ga0163163_10044836 Ga0163163_100448363 296
302 3300025931 Ga0207644_10042629 Ga0207644_100426291 296
303 3300025941 Ga0207711_10093501 Ga0207711_100935012 296
304 3300025981 Ga0207640_10073617 Ga0207640_100736172 296
305 3300026023 Ga0207677_10296780 Ga0207677_102967801 296
306 3300026035 Ga0207703_10065786 Ga0207703_100657862 296
307 3300026118 Ga0207675_100178655 Ga0207675_1001786553 296
308 3300030733 Ga0314311_1095856 Ga0314311_10958562 296
309 3300042157 Ga0439458_0002670 Ga0439458_0002670_94_987 296
310 3300005337 Ga0070682_100003467 Ga0070682_1000034675 297
311 3300005549 Ga0070704_100089840 Ga0070704_1000898402 297
312 3300005841 Ga0068863_100156581 Ga0068863_1001565812 297
313 3300005843 Ga0068860_100105108 Ga0068860_1001051082 297
314 3300006237 Ga0097621_100014748 Ga0097621_1000147485 297
315 3300006358 Ga0068871_100032453 Ga0068871_1000324532 297
316 3300006931 Ga0097620_100083597 Ga0097620_1000835975 297
317 3300009147 Ga0114129_10647411 Ga0114129_106474112 297
318 3300025936 Ga0207670_10005368 Ga0207670_100053686 297
319 3300026035 Ga0207703_10013811 Ga0207703_100138114 297
320 3300026041 Ga0207639_10091443 Ga0207639_100914432 297
321 3300026088 Ga0207641_10068226 Ga0207641_100682263 297
322 3300027907 Ga0207428_10144974 Ga0207428_101449741 297
323 3300048915 Ga0496112_0239375 Ga0496112_0239375_287_1183 297
324 3300050507 nmdc:mga05p37_273722_c1 nmdc:mga05p37_273722_c1_1095_1988 297
325 3300050511 nmdc:mga08y16_28252_c1 nmdc:mga08y16_28252_c1_1116_2021 297
326 3300050513 nmdc:mga0rr50_97653_c1 nmdc:mga0rr50_97653_c1_1128_2021 297
327 3300050512 nmdc:mga0n895_658369_c1 nmdc:mga0n895_658369_c1_74_976 298
328 3300005545 Ga0070695_100010001 Ga0070695_1000100018 299
329 3300005549 Ga0070704_100054742 Ga0070704_1000547422 299
330 3300005617 Ga0068859_100001186 Ga0068859_10000118614 299
331 3300006931 Ga0097620_100001186 Ga0097620_10000118614 299
332 3300009101 Ga0105247_10051112 Ga0105247_100511124 299
333 3300009177 Ga0105248_10048214 Ga0105248_100482144 299
334 3300025941 Ga0207711_10093838 Ga0207711_100938382 299
335 3300026095 Ga0207676_10007183 Ga0207676_100071833 299
336 3300025932 Ga0207690_10138934 Ga0207690_101389342 300
337 3300035091 Ga0373951_0000780 Ga0373951_0000780_86_994 300
338 3300000532 CNAas_1000019 CNAas_10000191 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05090

HTTM

HTTM domain

8

277

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e8g-assembly2.cif.gz_B the structure of protein from p. horikoshii at 1.7 angstrom resolution 0.2563 10 155
7e96-assembly1.cif.gz_D oxy-deoxy intermediate of 400 kda giant hemoglobin at 69% oxygen saturation 0.2504 12 163
7e96-assembly1.cif.gz_D oxy-deoxy intermediate of 400 kda giant hemoglobin at 69% oxygen saturation 0.2356 12 163
7zec-assembly1.cif.gz_C if(heme/confined) conformation of cyddc in atp(cydd) bound state (dataset-15) 0.2268 14 283
7zec-assembly1.cif.gz_C if(heme/confined) conformation of cyddc in atp(cydd) bound state (dataset-15) 0.2093 14 283
ID Description Score Start End Superfamily
af_Q10333_13_233_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.2473 17 278 1.20.1420.10
af_Q54P13_973_1326_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.2365 2 278 1.20.1560.10
af_Q10333_13_233_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.2345 17 278 1.20.1420.10
af_Q10MN3_29_251_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.2331 2 279 1.20.1420.10
af_K7KMD1_49_380_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.2303 12 286 1.20.1560.10
ID Description Score Start End GO Terms
AF-A0A2V8QEP6-F1-model_v4 HTTM-like domain-containing protein 0.9621 13 291 GO:0012505
GO:0016020
AF-A0A2V8STJ1-F1-model_v4 Uncharacterized protein 0.9436 11 206 GO:0016020
AF-A0A352FPP3-F1-model_v4 HTTM domain-containing protein 0.9336 24 300 GO:0016020
AF-A0A2V8STJ1-F1-model_v4 Uncharacterized protein 0.9079 11 206 GO:0016020
AF-A0A534QNR1-F1-model_v4 HTTM domain-containing protein 0.9006 13 280 GO:0016020

Feature Viewer

pLDDT pTM Quality
85.66 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map