F413342

General Info

Members Datasets Scaffolds Average Seq Length
338 172 338 295

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10090290|rootH1_100902902
Length 330
Sequence MDKRIIFFVIILILLAPGFEAGLKIIHPFLKRKKEMTEEAVIKKESQTMKVLKLLLKIAVTIVCFWYISKKIDFMKAKDAVLQSNWWWLFLSVASFAFSKFLASFRLNIYFKNVGIHLTQKQNIKLYWLGMFYNLFLPGAISGDAYKVVLLTRKYDVSYKKTTAAVLLDRFSGLLALGLILSVYGVIVLDKPLYDAVLIIGSIVAVVGLYVVIRFFLKDFLPGFWPTFLWGIAVQIFQVTCVYSILMALHQPLHQSEWIFIFLVAAVVSVIPIGLGGGLGTREVVFREGAVYFGLDPDLAVVISLLFYLSNLLSSVWGVYFIYHDPLQED

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
127 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
128 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
129 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
155 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
156 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
157 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
158 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
159 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
160 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
161 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
162 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
163 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
169 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
170 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
171 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
172 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.66
Nodule 0
Rhizoplane 0.59
Rhizosphere 95.86
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_1163789 2162886011 Bacteria 1558
2 JGI24740J21852_10019126 3300001979 Bacteria 2418
3 rootH1_10090290 3300003316 Bacteria 1667
4 rootL2_10139687 3300003322 Bacteria 1645
5 rootL2_10241949 3300003322 Bacteria 1949
6 Ga0065712_10000254 3300005290 Bacteria 19295
7 Ga0065712_10024186 3300005290 Bacteria 1528
8 Ga0065712_10031870 3300005290 Bacteria 1194
9 Ga0065712_10071904 3300005290 Bacteria 4987
10 Ga0065712_10097813 3300005290 Bacteria 2139
11 Ga0065707_10102351 3300005295 Bacteria 2811
12 Ga0070676_10092488 3300005328 Bacteria 1855
13 Ga0070683_100005709 3300005329 Bacteria 10398
14 Ga0070683_100006450 3300005329 Bacteria 9843
15 Ga0070683_100096302 3300005329 Bacteria 2783
16 Ga0070683_100237582 3300005329 Bacteria 1733
17 Ga0070690_100092062 3300005330 Bacteria 1999
18 Ga0070690_100204163 3300005330 Bacteria 1377
19 Ga0070670_100047900 3300005331 Bacteria 3679
20 Ga0070670_100056360 3300005331 Unclassified 3373
21 Ga0070670_100167407 3300005331 Bacteria 1906
22 Ga0070670_100246973 3300005331 Bacteria 1554
23 Ga0070677_10149305 3300005333 Bacteria 1086
24 Ga0068869_100034097 3300005334 Bacteria 3598
25 Ga0068869_100097630 3300005334 Bacteria 2219
26 Ga0068869_100108300 3300005334 Bacteria 2111
27 Ga0070666_10026676 3300005335 Bacteria 3777
28 Ga0068868_100024254 3300005338 Bacteria 4601
29 Ga0068868_100094955 3300005338 Bacteria 2406
30 Ga0068868_100320206 3300005338 Bacteria 1321
31 Ga0068868_100327427 3300005338 Unclassified 1307
32 Ga0070689_100091413 3300005340 Bacteria 2399
33 Ga0070689_100097945 3300005340 Bacteria 2319
34 Ga0070689_100155773 3300005340 Bacteria 1844
35 Ga0070687_100068021 3300005343 Bacteria 1903
36 Ga0070661_100004113 3300005344 Bacteria 10031
37 Ga0070661_100019501 3300005344 Bacteria 4833
38 Ga0070661_100165351 3300005344 Bacteria 1678
39 Ga0070661_100188692 3300005344 Unclassified 1571
40 Ga0070669_100111717 3300005353 Bacteria 2074
41 Ga0070675_100023731 3300005354 Bacteria 4907
42 Ga0070675_100080659 3300005354 Bacteria 2712
43 Ga0070671_100249541 3300005355 Unclassified 1507
44 Ga0070671_100448973 3300005355 Bacteria 1106
45 Ga0070673_100038366 3300005364 Bacteria 3658
46 Ga0070673_100064903 3300005364 Bacteria 2910
47 Ga0070673_100200437 3300005364 Bacteria 1719
48 Ga0070688_100009880 3300005365 Bacteria 5243
49 Ga0070688_100051932 3300005365 Bacteria 2559
50 Ga0070659_100088106 3300005366 Bacteria 2485
51 Ga0070659_100271330 3300005366 Bacteria 1410
52 Ga0070659_100566257 3300005366 Unclassified 974
53 Ga0070667_100283285 3300005367 Bacteria 1489
54 Ga0070663_100563212 3300005455 Unclassified 954
55 Ga0070678_100169739 3300005456 Bacteria 1776
56 Ga0070662_100008990 3300005457 Bacteria 6518
57 Ga0070662_100056544 3300005457 Bacteria 2849
58 Ga0070662_100099352 3300005457 Bacteria 2200
59 Ga0068867_100037815 3300005459 Bacteria 3510
60 Ga0070685_10011713 3300005466 Bacteria 4596
61 Ga0070685_10094265 3300005466 Bacteria 1818
62 Ga0070685_10149838 3300005466 Bacteria 1477
63 Ga0070698_100002339 3300005471 Bacteria 20947
64 Ga0070698_100003738 3300005471 Bacteria 16732
65 Ga0070698_100019818 3300005471 Bacteria 7056
66 Ga0070684_100143480 3300005535 Bacteria 2160
67 Ga0070684_100287731 3300005535 Bacteria 1506
68 Ga0068853_100055024 3300005539 Bacteria 3429
69 Ga0068853_100143051 3300005539 Bacteria 2148
70 Ga0070672_100106405 3300005543 Bacteria 2282
71 Ga0070672_100205982 3300005543 Bacteria 1646
72 Ga0070686_100169814 3300005544 Bacteria 1542
73 Ga0070665_100158454 3300005548 Bacteria 2265
74 Ga0070665_100494817 3300005548 Bacteria 1234
75 Ga0070665_100540048 3300005548 Unclassified 1178
76 Ga0070704_100313435 3300005549 Bacteria 1312
77 Ga0068855_100241986 3300005563 Bacteria 2016
78 Ga0070664_100010697 3300005564 Bacteria 7440
79 Ga0070664_100028830 3300005564 Bacteria 4623
80 Ga0070664_100073581 3300005564 Bacteria 2932
81 Ga0070664_100080279 3300005564 Bacteria 2809
82 Ga0070664_100127697 3300005564 Bacteria 2232
83 Ga0070664_100254014 3300005564 Bacteria 1581
84 Ga0070664_100640679 3300005564 Bacteria 987
85 Ga0068857_100123505 3300005577 Bacteria 2332
86 Ga0068857_100149633 3300005577 Bacteria 2114
87 Ga0068854_100027744 3300005578 Bacteria 3905
88 Ga0068854_100060276 3300005578 Unclassified 2745
89 Ga0068852_100055929 3300005616 Bacteria 3407
90 Ga0068852_100083134 3300005616 Bacteria 2847
91 Ga0068852_100243486 3300005616 Bacteria 1720
92 Ga0068859_100106657 3300005617 Bacteria 2861
93 Ga0068859_100108640 3300005617 Bacteria 2835
94 Ga0068859_100130692 3300005617 Bacteria 2582
95 Ga0068859_100170295 3300005617 Bacteria 2259
96 Ga0068859_100220214 3300005617 Bacteria 1985
97 Ga0068859_100334146 3300005617 Bacteria 1609
98 Ga0068859_100401413 3300005617 Bacteria 1467
99 Ga0068864_100002302 3300005618 Bacteria 15797
100 Ga0068864_100039410 3300005618 Bacteria 4039
101 Ga0068866_10055268 3300005718 Bacteria 2038
102 Ga0068861_100263063 3300005719 Bacteria 1478
103 Ga0068870_10084451 3300005840 Bacteria 1762
104 Ga0068870_10169026 3300005840 Bacteria 1303
105 Ga0068870_10224723 3300005840 Unclassified 1151
106 Ga0068863_100066459 3300005841 Bacteria 3410
107 Ga0068863_100112249 3300005841 Bacteria 2596
108 Ga0068858_100040619 3300005842 Bacteria 4315
109 Ga0068858_100147309 3300005842 Bacteria 2211
110 Ga0068860_100391164 3300005843 Unclassified 1374
111 Ga0068860_100401163 3300005843 Bacteria 1357
112 Ga0068862_100223312 3300005844 Bacteria 1706
113 Ga0068862_100373290 3300005844 Bacteria 1328
114 Ga0081539_10026436 3300005985 Bacteria 3703
115 Ga0075366_10009786 3300006195 Bacteria 5359
116 Ga0097621_100008235 3300006237 Bacteria 7497
117 Ga0097621_100206085 3300006237 Bacteria 1709
118 Ga0068871_100053370 3300006358 Bacteria 3276
119 Ga0068871_100099603 3300006358 Bacteria 2433
120 Ga0068871_100105690 3300006358 Bacteria 2363
121 Ga0075428_100026293 3300006844 Bacteria 6444
122 Ga0075428_100058211 3300006844 Bacteria 4230
123 Ga0075428_100150470 3300006844 Bacteria 2528
124 Ga0075430_100005919 3300006846 Bacteria 10330
125 Ga0075431_100318136 3300006847 Bacteria 1570
126 Ga0075434_100186410 3300006871 Bacteria 2095
127 Ga0075429_100020808 3300006880 Bacteria 5694
128 Ga0075429_100056924 3300006880 Bacteria 3403
129 Ga0097620_100106658 3300006931 Bacteria 2861
130 Ga0097620_100108641 3300006931 Bacteria 2835
131 Ga0097620_100130704 3300006931 Bacteria 2582
132 Ga0097620_100170298 3300006931 Bacteria 2259
133 Ga0097620_100220203 3300006931 Bacteria 1985
134 Ga0097620_100334152 3300006931 Bacteria 1609
135 Ga0097620_100401455 3300006931 Bacteria 1467
136 Ga0105240_10286742 3300009093 Bacteria 1889
137 Ga0111539_10084922 3300009094 Bacteria 3721
138 Ga0105247_10002304 3300009101 Bacteria 13045
139 Ga0105247_10243948 3300009101 Bacteria 1225
140 Ga0114129_10227946 3300009147 Bacteria 2510
141 Ga0105241_10104739 3300009174 Bacteria 2255
142 Ga0105241_10167439 3300009174 Bacteria 1812
143 Ga0105242_10010889 3300009176 Bacteria 6985
144 Ga0105242_10176037 3300009176 Bacteria 1884
145 Ga0105242_10347007 3300009176 Bacteria 1370
146 Ga0105248_10038373 3300009177 Bacteria 5361
147 Ga0105249_10029748 3300009553 Bacteria 4934
148 Ga0105249_10031256 3300009553 Archaea 4815
149 Ga0105239_10023371 3300010375 Bacteria 6807
150 Ga0105246_10088269 3300011119 Bacteria 2227
151 Ga0105246_10130955 3300011119 Bacteria 1874
152 Ga0157373_10062545 3300013100 Bacteria 2636
153 Ga0157371_10019277 3300013102 Bacteria 5033
154 Ga0157371_10089774 3300013102 Bacteria 2177
155 Ga0157370_10100255 3300013104 Bacteria 2714
156 Ga0157370_10405759 3300013104 Bacteria 1254
157 Ga0157369_10068990 3300013105 Bacteria 3798
158 Ga0157369_10149561 3300013105 Bacteria 2468
159 Ga0157374_10001939 3300013296 Bacteria 17348
160 Ga0157374_10005131 3300013296 Bacteria 10982
161 Ga0163162_10000697 3300013306 Bacteria 31013
162 Ga0163162_10022373 3300013306 Bacteria 6230
163 Ga0163162_10071445 3300013306 Bacteria 3524
164 Ga0163162_10205832 3300013306 Bacteria 2097
165 Ga0163162_10272942 3300013306 Bacteria 1823
166 Ga0163162_10292487 3300013306 Bacteria 1760
167 Ga0157372_10042398 3300013307 Bacteria 5034
168 Ga0157372_10135335 3300013307 Bacteria 2837
169 Ga0157372_10233444 3300013307 Bacteria 2133
170 Ga0157375_10053231 3300013308 Bacteria 3981
171 Ga0157375_10070776 3300013308 Bacteria 3499
172 Ga0157375_10132132 3300013308 Bacteria 2616
173 Ga0157375_10246615 3300013308 Bacteria 1946
174 Ga0163163_10001501 3300014325 Bacteria 19759
175 Ga0163163_10213040 3300014325 Bacteria 1981
176 Ga0157380_10011122 3300014326 Bacteria 6492
177 Ga0157380_10343705 3300014326 Unclassified 1393
178 Ga0157377_10125891 3300014745 Bacteria 1559
179 Ga0157379_10048539 3300014968 Bacteria 3789
180 Ga0157379_10051787 3300014968 Bacteria 3666
181 Ga0157379_10544509 3300014968 Unclassified 1079
182 Ga0157376_10049875 3300014969 Bacteria 3469
183 Ga0157376_10072334 3300014969 Bacteria 2933
184 Ga0157376_10090042 3300014969 Bacteria 2654
185 Ga0157376_10109988 3300014969 Bacteria 2423
186 Ga0163161_10023165 3300017792 Bacteria 4378
187 Ga0163161_10026044 3300017792 Bacteria 4143
188 Ga0163161_10033988 3300017792 Bacteria 3646
189 Ga0163161_10187914 3300017792 Bacteria 1587
190 Ga0207682_10138631 3300025893 Bacteria 1090
191 Ga0207710_10002332 3300025900 Bacteria 8872
192 Ga0207680_10083117 3300025903 Bacteria 2017
193 Ga0207647_10000110 3300025904 Bacteria 62980
194 Ga0207645_10008131 3300025907 Bacteria 7351
195 Ga0207643_10165910 3300025908 Unclassified 1331
196 Ga0207695_10206963 3300025913 Bacteria 1874
197 Ga0207649_10005479 3300025920 Bacteria 6870
198 Ga0207681_10221070 3300025923 Bacteria 1465
199 Ga0207650_10015903 3300025925 Bacteria 5249
200 Ga0207650_10061218 3300025925 Bacteria 2810
201 Ga0207650_10194007 3300025925 Bacteria 1624
202 Ga0207659_10013615 3300025926 Bacteria 5216
203 Ga0207659_10062374 3300025926 Bacteria 2690
204 Ga0207659_10374623 3300025926 Bacteria 1186
205 Ga0207644_10107276 3300025931 Bacteria 2107
206 Ga0207690_10075164 3300025932 Bacteria 2342
207 Ga0207706_10018006 3300025933 Bacteria 6356
208 Ga0207706_10018649 3300025933 Bacteria 6244
209 Ga0207686_10000669 3300025934 Bacteria 21197
210 Ga0207686_10010460 3300025934 Bacteria 5053
211 Ga0207686_10122547 3300025934 Bacteria 1771
212 Ga0207686_10282789 3300025934 Bacteria 1225
213 Ga0207670_10094975 3300025936 Bacteria 2117
214 Ga0207670_10123745 3300025936 Bacteria 1884
215 Ga0207670_10212830 3300025936 Bacteria 1475
216 Ga0207704_10356629 3300025938 Unclassified 1140
217 Ga0207691_10055914 3300025940 Bacteria 3596
218 Ga0207691_10070339 3300025940 Bacteria 3160
219 Ga0207691_10198517 3300025940 Bacteria 1747
220 Ga0207689_10010127 3300025942 Bacteria 8127
221 Ga0207689_10050853 3300025942 Bacteria 3416
222 Ga0207689_10152973 3300025942 Bacteria 1902
223 Ga0207661_10005744 3300025944 Bacteria 8751
224 Ga0207661_10009193 3300025944 Bacteria 7083
225 Ga0207661_10195139 3300025944 Bacteria 1777
226 Ga0207661_10431473 3300025944 Unclassified 1198
227 Ga0207679_10000875 3300025945 Bacteria 19210
228 Ga0207679_10047722 3300025945 Bacteria 3113
229 Ga0207679_10052140 3300025945 Bacteria 2999
230 Ga0207679_10130103 3300025945 Bacteria 2018
231 Ga0207651_10064505 3300025960 Bacteria 2564
232 Ga0207651_10153096 3300025960 Bacteria 1798
233 Ga0207651_10192236 3300025960 Bacteria 1629
234 Ga0207651_10228777 3300025960 Bacteria 1508
235 Ga0207712_10006763 3300025961 Bacteria 7231
236 Ga0207712_10007093 3300025961 Bacteria 7066
237 Ga0207712_10016099 3300025961 Unclassified 4836
238 Ga0207712_10214563 3300025961 Bacteria 1535
239 Ga0207712_10417681 3300025961 Unclassified 1131
240 Ga0207658_10079518 3300025986 Bacteria 2508
241 Ga0207658_10431557 3300025986 Bacteria 1164
242 Ga0207677_10014521 3300026023 Bacteria 4601
243 Ga0207677_10022623 3300026023 Bacteria 3867
244 Ga0207639_10122485 3300026041 Bacteria 2139
245 Ga0207678_10125997 3300026067 Bacteria 2185
246 Ga0207641_10083045 3300026088 Bacteria 2785
247 Ga0207641_10097966 3300026088 Bacteria 2578
248 Ga0207648_10009109 3300026089 Bacteria 9541
249 Ga0207648_10025487 3300026089 Bacteria 5266
250 Ga0207648_10038010 3300026089 Unclassified 4237
251 Ga0207648_10041542 3300026089 Bacteria 4038
252 Ga0207676_10010130 3300026095 Bacteria 6709
253 Ga0207676_10047706 3300026095 Bacteria 3321
254 Ga0207676_10278614 3300026095 Bacteria 1517
255 Ga0207674_10064095 3300026116 Bacteria 3707
256 Ga0207674_10066418 3300026116 Bacteria 3633
257 Ga0207674_10068312 3300026116 Bacteria 3576
258 Ga0207675_100006900 3300026118 Bacteria 10753
259 Ga0207675_100023611 3300026118 Bacteria 5721
260 Ga0207675_100130947 3300026118 Bacteria 2379
261 Ga0207675_100296659 3300026118 Bacteria 1573
262 Ga0207675_100472492 3300026118 Bacteria 1245
263 Ga0207683_10037807 3300026121 Bacteria 4205
264 Ga0207698_10163706 3300026142 Bacteria 1949
265 Ga0207698_10175770 3300026142 Bacteria 1891
266 Ga0268266_10433259 3300028379 Unclassified 1248
267 Ga0268265_10214332 3300028380 Bacteria 1680
268 Ga0268264_10757716 3300028381 Unclassified 968
269 Ga0265327_10018669 3300031251 Bacteria 4290
270 Ga0307410_10195994 3300031852 Bacteria 1539
271 Ga0307410_10391338 3300031852 Unclassified 1121
272 Ga0307412_10170266 3300031911 Bacteria 1628
273 Ga0307414_10322208 3300032004 Bacteria 1316
274 Ga0439436_0033978 3300041404 Bacteria 1475
275 Ga0451802_0015780 3300041460 Bacteria 1136
276 Ga0439449_0005692 3300042007 Bacteria 4764
277 Ga0439449_0023733 3300042007 Bacteria 2294
278 Ga0439457_001393 3300042014 Bacteria 7283
279 Ga0451577_0000015 3300042876 Bacteria 538333
280 Ga0451577_0070965 3300042876 Bacteria 3106
281 Ga0466972_0000052 3300044658 Bacteria 113449
282 Ga0453683_0000061 3300044673 Bacteria 185470
283 Ga0453683_0002000 3300044673 Bacteria 16502
284 Ga0453683_0048313 3300044673 Unclassified 2669
285 Ga0453683_0137203 3300044673 Bacteria 1543
286 Ga0453683_0217458 3300044673 Bacteria 1214
287 Ga0453684_0000081 3300044712 Bacteria 402985
288 Ga0453684_0098523 3300044712 Bacteria 3583
289 Ga0453684_0222386 3300044712 Bacteria 2186
290 Ga0453684_0682291 3300044712 Unclassified 1118
291 Ga0466957_0006561 3300044842 Bacteria 6575
292 Ga0451576_0000061 3300045051 Bacteria 284306
293 Ga0451576_0040271 3300045051 Bacteria 4947
294 Ga0451576_0044962 3300045051 Bacteria 4652
295 Ga0451576_0118113 3300045051 Bacteria 2761
296 Ga0451576_0264815 3300045051 Bacteria 1797
297 Ga0495629_0264155 3300046459 Bacteria 1183
298 Ga0495628_0079228 3300046516 Bacteria 2554
299 Ga0495630_0005981 3300046517 Bacteria 8602
300 Ga0495644_0103320 3300046523 Bacteria 1079
301 Ga0495587_0058578 3300046536 Bacteria 2263
302 Ga0495598_0038993 3300046537 Bacteria 1379
303 Ga0495634_0157205 3300046642 Bacteria 1435
304 Ga0495635_0140987 3300046663 Bacteria 1642
305 Ga0495647_0122763 3300046681 Bacteria 1094
306 Ga0495684_0145715 3300047471 Bacteria 1774
307 Ga0496110_0296903 3300048913 Bacteria 1472
308 Ga0501300_005904 3300049523 Bacteria 1802
309 Ga0501031_0086726 3300049568 Bacteria 2041
310 Ga0501034_0130948 3300049571 Bacteria 2491
311 Ga0501038_0032304 3300049574 Bacteria 4619
312 Ga0501039_0056614 3300049575 Bacteria 3037
313 Ga0501043_0043995 3300049579 Bacteria 3510
314 Ga0501046_0209446 3300049580 Bacteria 1448
315 Ga0501198_002762 3300049649 Bacteria 2377
316 Ga0501198_006619 3300049649 Bacteria 1653
317 Ga0501202_008889 3300049652 Bacteria 1838
318 Ga0501217_001387 3300049661 Bacteria 4519
319 Ga0501223_009480 3300049663 Bacteria 1972
320 Ga0501224_001450 3300049664 Bacteria 3139
321 Ga0501235_002241 3300049669 Unclassified 4158
322 Ga0501253_005085 3300049683 Bacteria 1701
323 Ga0501221_004531 3300049704 Bacteria 2302
324 Ga0501225_0003382 3300049705 Bacteria 4844
325 Ga0501225_0009857 3300049705 Bacteria 2713
326 Ga0501279_004801 3300049775 Bacteria 1775
327 Ga0501044_0004248 3300049823 Bacteria 16071
328 nmdc:mga0k408_56395_c1 3300050493 Bacteria 2280
329 nmdc:mga0k408_7017_c1 3300050493 Bacteria 6011
330 nmdc:mga0k408_85337_c1 3300050493 Bacteria 1853
331 nmdc:mga09592_136756_c1 3300050508 Bacteria 2111
332 nmdc:mga09592_993_c1 3300050508 Bacteria 22468
333 nmdc:mga06r32_120833_c1 3300050510 Bacteria 2584
334 Ga0500578_0000018 3300053086 Bacteria 172537
335 Ga0500583_0000024 3300053092 Bacteria 110944
336 Ga0500568_0000439 3300053139 Bacteria 31243
337 Ga0500622_0016055 3300053156 Bacteria 4005
338 Ga0500611_000026 3300053727 Bacteria 96342

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041404 Ga0439436_0033978 Ga0439436_0033978_242_1132 250
2 3300042007 Ga0439449_0023733 Ga0439449_0023733_1005_1895 250
3 3300053139 Ga0500568_0000439 Ga0500568_0000439_2887_3783 250
4 3300006844 Ga0075428_100150470 Ga0075428_1001504702 252
5 3300042014 Ga0439457_001393 Ga0439457_001393_6330_7235 255
6 3300013306 Ga0163162_10272942 Ga0163162_102729422 259
7 3300001979 JGI24740J21852_10019126 JGI24740J21852_100191262 261
8 3300005718 Ga0068866_10055268 Ga0068866_100552682 261
9 3300009174 Ga0105241_10104739 Ga0105241_101047392 261
10 3300009176 Ga0105242_10176037 Ga0105242_101760371 261
11 3300010375 Ga0105239_10023371 Ga0105239_100233716 261
12 3300025934 Ga0207686_10122547 Ga0207686_101225472 261
13 3300026095 Ga0207676_10047706 Ga0207676_100477062 261
14 3300017792 Ga0163161_10187914 Ga0163161_101879142 264
15 3300025961 Ga0207712_10016099 Ga0207712_100160992 267
16 3300032004 Ga0307414_10322208 Ga0307414_103222081 267
17 3300044712 Ga0453684_0098523 Ga0453684_0098523_2409_3251 267
18 3300045051 Ga0451576_0264815 Ga0451576_0264815_211_1053 267
19 3300014745 Ga0157377_10125891 Ga0157377_101258911 268
20 3300005343 Ga0070687_100068021 Ga0070687_1000680212 269
21 3300005353 Ga0070669_100111717 Ga0070669_1001117172 269
22 3300025923 Ga0207681_10221070 Ga0207681_102210702 269
23 3300026118 Ga0207675_100006900 Ga0207675_1000069002 269
24 3300005290 Ga0065712_10031870 Ga0065712_100318701 270
25 3300005340 Ga0070689_100091413 Ga0070689_1000914132 270
26 3300005354 Ga0070675_100080659 Ga0070675_1000806592 270
27 3300005466 Ga0070685_10011713 Ga0070685_100117132 270
28 3300005471 Ga0070698_100003738 Ga0070698_10000373811 270
29 3300005617 Ga0068859_100334146 Ga0068859_1003341462 270
30 3300006237 Ga0097621_100008235 Ga0097621_1000082353 270
31 3300006358 Ga0068871_100053370 Ga0068871_1000533702 270
32 3300006931 Ga0097620_100334152 Ga0097620_1003341522 270
33 3300014969 Ga0157376_10109988 Ga0157376_101099881 270
34 3300025926 Ga0207659_10062374 Ga0207659_100623742 270
35 3300025934 Ga0207686_10000669 Ga0207686_1000066911 270
36 3300025936 Ga0207670_10212830 Ga0207670_102128302 270
37 3300025940 Ga0207691_10070339 Ga0207691_100703394 270
38 3300026142 Ga0207698_10175770 Ga0207698_101757702 270
39 3300053727 Ga0500611_000026 Ga0500611_000026_93128_94021 270
40 3300005331 Ga0070670_100056360 Ga0070670_1000563602 271
41 3300006358 Ga0068871_100105690 Ga0068871_1001056902 271
42 3300025925 Ga0207650_10061218 Ga0207650_100612182 271
43 3300041460 Ga0451802_0015780 Ga0451802_0015780_140_1045 271
44 3300005290 Ga0065712_10097813 Ga0065712_100978132 272
45 3300005338 Ga0068868_100320206 Ga0068868_1003202062 272
46 3300005539 Ga0068853_100143051 Ga0068853_1001430513 272
47 3300005616 Ga0068852_100055929 Ga0068852_1000559293 272
48 3300013104 Ga0157370_10100255 Ga0157370_101002553 272
49 3300025931 Ga0207644_10107276 Ga0207644_101072761 272
50 3300025940 Ga0207691_10055914 Ga0207691_100559142 272
51 3300025960 Ga0207651_10153096 Ga0207651_101530962 272
52 3300003322 rootL2_10241949 rootL2_102419492 273
53 3300006844 Ga0075428_100026293 Ga0075428_1000262933 273
54 3300006844 Ga0075428_100058211 Ga0075428_1000582112 273
55 3300006847 Ga0075431_100318136 Ga0075431_1003181362 273
56 3300006880 Ga0075429_100020808 Ga0075429_1000208082 273
57 3300025904 Ga0207647_10000110 Ga0207647_1000011043 273
58 3300044658 Ga0466972_0000052 Ga0466972_0000052_74176_75081 273
59 3300044842 Ga0466957_0006561 Ga0466957_0006561_4805_5728 273
60 3300053092 Ga0500583_0000024 Ga0500583_0000024_17002_17907 273
61 3300005617 Ga0068859_100170295 Ga0068859_1001702952 274
62 3300006931 Ga0097620_100170298 Ga0097620_1001702982 274
63 3300044673 Ga0453683_0217458 Ga0453683_0217458_94_999 274
64 3300005355 Ga0070671_100448973 Ga0070671_1004489731 275
65 3300005366 Ga0070659_100088106 Ga0070659_1000881062 275
66 3300005616 Ga0068852_100083134 Ga0068852_1000831341 275
67 3300013105 Ga0157369_10149561 Ga0157369_101495612 275
68 3300026142 Ga0207698_10163706 Ga0207698_101637062 275
69 3300013102 Ga0157371_10019277 Ga0157371_100192772 276
70 3300053156 Ga0500622_0016055 Ga0500622_0016055_1104_2009 276
71 3300005295 Ga0065707_10102351 Ga0065707_101023512 277
72 3300042876 Ga0451577_0070965 Ga0451577_0070965_1985_2857 277
73 3300044673 Ga0453683_0002000 Ga0453683_0002000_2193_3077 277
74 3300045051 Ga0451576_0040271 Ga0451576_0040271_3777_4661 277
75 3300045051 Ga0451576_0118113 Ga0451576_0118113_751_1623 277
76 3300005331 Ga0070670_100167407 Ga0070670_1001674072 278
77 3300013102 Ga0157371_10089774 Ga0157371_100897742 278
78 3300013105 Ga0157369_10068990 Ga0157369_100689901 278
79 3300013307 Ga0157372_10135335 Ga0157372_101353352 278
80 3300025925 Ga0207650_10194007 Ga0207650_101940072 278
81 3300053086 Ga0500578_0000018 Ga0500578_0000018_123443_124348 278
82 3300013307 Ga0157372_10233444 Ga0157372_102334441 279
83 3300003322 rootL2_10139687 rootL2_101396872 280
84 3300005333 Ga0070677_10149305 Ga0070677_101493051 280
85 3300031251 Ga0265327_10018669 Ga0265327_100186693 281
86 3300044712 Ga0453684_0222386 Ga0453684_0222386_1286_2170 281
87 3300005290 Ga0065712_10000254 Ga0065712_100002543 282
88 3300005290 Ga0065712_10024186 Ga0065712_100241862 282
89 3300005329 Ga0070683_100006450 Ga0070683_10000645010 282
90 3300005330 Ga0070690_100204163 Ga0070690_1002041631 282
91 3300005334 Ga0068869_100034097 Ga0068869_1000340972 282
92 3300005338 Ga0068868_100024254 Ga0068868_1000242544 282
93 3300005340 Ga0070689_100097945 Ga0070689_1000979451 282
94 3300005340 Ga0070689_100155773 Ga0070689_1001557732 282
95 3300005344 Ga0070661_100004113 Ga0070661_1000041133 282
96 3300005364 Ga0070673_100064903 Ga0070673_1000649032 282
97 3300005365 Ga0070688_100051932 Ga0070688_1000519322 282
98 3300005366 Ga0070659_100566257 Ga0070659_1005662571 282
99 3300005455 Ga0070663_100563212 Ga0070663_1005632121 282
100 3300005457 Ga0070662_100099352 Ga0070662_1000993521 282
101 3300005471 Ga0070698_100002339 Ga0070698_10000233912 282
102 3300005543 Ga0070672_100205982 Ga0070672_1002059821 282
103 3300005544 Ga0070686_100169814 Ga0070686_1001698142 282
104 3300005548 Ga0070665_100158454 Ga0070665_1001584542 282
105 3300005549 Ga0070704_100313435 Ga0070704_1003134352 282
106 3300005564 Ga0070664_100073581 Ga0070664_1000735812 282
107 3300005577 Ga0068857_100123505 Ga0068857_1001235052 282
108 3300005617 Ga0068859_100108640 Ga0068859_1001086403 282
109 3300005617 Ga0068859_100220214 Ga0068859_1002202142 282
110 3300005618 Ga0068864_100002302 Ga0068864_1000023028 282
111 3300005719 Ga0068861_100263063 Ga0068861_1002630632 282
112 3300005840 Ga0068870_10084451 Ga0068870_100844512 282
113 3300005842 Ga0068858_100147309 Ga0068858_1001473092 282
114 3300005844 Ga0068862_100373290 Ga0068862_1003732901 282
115 3300006237 Ga0097621_100206085 Ga0097621_1002060851 282
116 3300006931 Ga0097620_100108641 Ga0097620_1001086411 282
117 3300006931 Ga0097620_100220203 Ga0097620_1002202032 282
118 3300009147 Ga0114129_10227946 Ga0114129_102279462 282
119 3300009176 Ga0105242_10347007 Ga0105242_103470072 282
120 3300009553 Ga0105249_10031256 Ga0105249_100312563 282
121 3300011119 Ga0105246_10088269 Ga0105246_100882692 282
122 3300013104 Ga0157370_10405759 Ga0157370_104057591 282
123 3300013296 Ga0157374_10001939 Ga0157374_100019394 282
124 3300013306 Ga0163162_10071445 Ga0163162_100714452 282
125 3300013306 Ga0163162_10205832 Ga0163162_102058322 282
126 3300013306 Ga0163162_10292487 Ga0163162_102924871 282
127 3300013308 Ga0157375_10070776 Ga0157375_100707761 282
128 3300014325 Ga0163163_10001501 Ga0163163_100015019 282
129 3300014325 Ga0163163_10213040 Ga0163163_102130401 282
130 3300014326 Ga0157380_10343705 Ga0157380_103437052 282
131 3300014968 Ga0157379_10048539 Ga0157379_100485391 282
132 3300014968 Ga0157379_10544509 Ga0157379_105445092 282
133 3300014969 Ga0157376_10072334 Ga0157376_100723342 282
134 3300025893 Ga0207682_10138631 Ga0207682_101386311 282
135 3300025920 Ga0207649_10005479 Ga0207649_100054797 282
136 3300025933 Ga0207706_10018006 Ga0207706_100180064 282
137 3300025934 Ga0207686_10282789 Ga0207686_102827892 282
138 3300025936 Ga0207670_10094975 Ga0207670_100949752 282
139 3300025936 Ga0207670_10123745 Ga0207670_101237452 282
140 3300025938 Ga0207704_10356629 Ga0207704_103566291 282
141 3300025940 Ga0207691_10198517 Ga0207691_101985172 282
142 3300025942 Ga0207689_10050853 Ga0207689_100508532 282
143 3300025942 Ga0207689_10152973 Ga0207689_101529732 282
144 3300025944 Ga0207661_10009193 Ga0207661_100091931 282
145 3300025945 Ga0207679_10000875 Ga0207679_100008758 282
146 3300025960 Ga0207651_10064505 Ga0207651_100645052 282
147 3300025960 Ga0207651_10192236 Ga0207651_101922361 282
148 3300025961 Ga0207712_10007093 Ga0207712_100070932 282
149 3300025961 Ga0207712_10214563 Ga0207712_102145632 282
150 3300025986 Ga0207658_10079518 Ga0207658_100795181 282
151 3300026023 Ga0207677_10022623 Ga0207677_100226231 282
152 3300026067 Ga0207678_10125997 Ga0207678_101259972 282
153 3300026089 Ga0207648_10038010 Ga0207648_100380103 282
154 3300026095 Ga0207676_10010130 Ga0207676_100101304 282
155 3300026095 Ga0207676_10278614 Ga0207676_102786142 282
156 3300026116 Ga0207674_10068312 Ga0207674_100683122 282
157 3300026118 Ga0207675_100023611 Ga0207675_1000236115 282
158 3300042876 Ga0451577_0000015 Ga0451577_0000015_252368_253279 282
159 3300044673 Ga0453683_0000061 Ga0453683_0000061_131168_132085 282
160 3300044673 Ga0453683_0048313 Ga0453683_0048313_255_1166 282
161 3300044673 Ga0453683_0137203 Ga0453683_0137203_85_1056 282
162 3300044712 Ga0453684_0000081 Ga0453684_0000081_69862_70773 282
163 3300045051 Ga0451576_0000061 Ga0451576_0000061_252368_253279 282
164 3300045051 Ga0451576_0044962 Ga0451576_0044962_33_950 282
165 3300046537 Ga0495598_0038993 Ga0495598_0038993_71_955 282
166 3300003316 rootH1_10090290 rootH1_100902902 283
167 3300005459 Ga0068867_100037815 Ga0068867_1000378152 283
168 3300005617 Ga0068859_100401413 Ga0068859_1004014132 283
169 3300005843 Ga0068860_100401163 Ga0068860_1004011632 283
170 3300006931 Ga0097620_100401455 Ga0097620_1004014552 283
171 3300011119 Ga0105246_10130955 Ga0105246_101309552 283
172 3300026089 Ga0207648_10009109 Ga0207648_100091099 283
173 3300049568 Ga0501031_0086726 Ga0501031_0086726_719_1609 283
174 3300049571 Ga0501034_0130948 Ga0501034_0130948_1317_2207 283
175 3300049574 Ga0501038_0032304 Ga0501038_0032304_2241_3131 283
176 3300049575 Ga0501039_0056614 Ga0501039_0056614_968_1858 283
177 3300049579 Ga0501043_0043995 Ga0501043_0043995_2449_3339 283
178 3300049580 Ga0501046_0209446 Ga0501046_0209446_398_1288 283
179 3300049823 Ga0501044_0004248 Ga0501044_0004248_10828_11718 283
180 3300006195 Ga0075366_10009786 Ga0075366_100097865 284
181 3300013306 Ga0163162_10000697 Ga0163162_1000069715 284
182 3300013307 Ga0157372_10042398 Ga0157372_100423982 284
183 3300013308 Ga0157375_10132132 Ga0157375_101321323 284
184 3300017792 Ga0163161_10023165 Ga0163161_100231654 284
185 3300050493 nmdc:mga0k408_7017_c1 nmdc:mga0k408_7017_c1_4544_5434 284
186 3300005471 Ga0070698_100019818 Ga0070698_1000198182 285
187 3300005617 Ga0068859_100130692 Ga0068859_1001306923 285
188 3300005618 Ga0068864_100039410 Ga0068864_1000394103 285
189 3300005841 Ga0068863_100112249 Ga0068863_1001122493 285
190 3300005844 Ga0068862_100223312 Ga0068862_1002233122 285
191 3300006846 Ga0075430_100005919 Ga0075430_1000059192 285
192 3300006880 Ga0075429_100056924 Ga0075429_1000569242 285
193 3300006931 Ga0097620_100130704 Ga0097620_1001307043 285
194 3300009094 Ga0111539_10084922 Ga0111539_100849224 285
195 3300009101 Ga0105247_10002304 Ga0105247_100023043 285
196 3300009553 Ga0105249_10029748 Ga0105249_100297482 285
197 3300025900 Ga0207710_10002332 Ga0207710_100023321 285
198 3300025961 Ga0207712_10006763 Ga0207712_100067635 285
199 3300026088 Ga0207641_10097966 Ga0207641_100979662 285
200 3300026116 Ga0207674_10066418 Ga0207674_100664182 285
201 3300026118 Ga0207675_100472492 Ga0207675_1004724922 285
202 3300031852 Ga0307410_10391338 Ga0307410_103913382 285
203 3300046523 Ga0495644_0103320 Ga0495644_0103320_61_954 285
204 3300049649 Ga0501198_006619 Ga0501198_006619_215_1117 285
205 3300049669 Ga0501235_002241 Ga0501235_002241_2688_3590 285
206 3300049705 Ga0501225_0003382 Ga0501225_0003382_1683_2585 285
207 3300050493 nmdc:mga0k408_56395_c1 nmdc:mga0k408_56395_c1_1125_2018 285
208 3300050508 nmdc:mga09592_136756_c1 nmdc:mga09592_136756_c1_534_1427 285
209 3300050508 nmdc:mga09592_993_c1 nmdc:mga09592_993_c1_11020_11913 285
210 3300050510 nmdc:mga06r32_120833_c1 nmdc:mga06r32_120833_c1_918_1811 285
211 3300006871 Ga0075434_100186410 Ga0075434_1001864102 286
212 3300028380 Ga0268265_10214332 Ga0268265_102143322 286
213 3300031852 Ga0307410_10195994 Ga0307410_101959942 286
214 3300031911 Ga0307412_10170266 Ga0307412_101702662 286
215 3300049523 Ga0501300_005904 Ga0501300_005904_46_942 286
216 3300049649 Ga0501198_002762 Ga0501198_002762_644_1540 286
217 3300049652 Ga0501202_008889 Ga0501202_008889_69_965 286
218 3300049661 Ga0501217_001387 Ga0501217_001387_1149_2045 286
219 3300049663 Ga0501223_009480 Ga0501223_009480_374_1270 286
220 3300049664 Ga0501224_001450 Ga0501224_001450_503_1399 286
221 3300049683 Ga0501253_005085 Ga0501253_005085_712_1608 286
222 3300049704 Ga0501221_004531 Ga0501221_004531_696_1592 286
223 3300049705 Ga0501225_0009857 Ga0501225_0009857_876_1772 286
224 3300049775 Ga0501279_004801 Ga0501279_004801_630_1526 286
225 3300013100 Ga0157373_10062545 Ga0157373_100625452 287
226 3300005366 Ga0070659_100271330 Ga0070659_1002713301 288
227 3300005577 Ga0068857_100149633 Ga0068857_1001496331 288
228 3300005985 Ga0081539_10026436 Ga0081539_100264362 288
229 3300025932 Ga0207690_10075164 Ga0207690_100751642 288
230 3300026118 Ga0207675_100130947 Ga0207675_1001309471 288
231 3300042007 Ga0439449_0005692 Ga0439449_0005692_2732_3661 288
232 3300044712 Ga0453684_0682291 Ga0453684_0682291_192_1094 288
233 3300005328 Ga0070676_10092488 Ga0070676_100924881 289
234 3300005329 Ga0070683_100096302 Ga0070683_1000963022 289
235 3300005329 Ga0070683_100237582 Ga0070683_1002375821 289
236 3300005330 Ga0070690_100092062 Ga0070690_1000920622 289
237 3300005334 Ga0068869_100097630 Ga0068869_1000976303 289
238 3300005334 Ga0068869_100108300 Ga0068869_1001083002 289
239 3300005335 Ga0070666_10026676 Ga0070666_100266762 289
240 3300005338 Ga0068868_100094955 Ga0068868_1000949551 289
241 3300005338 Ga0068868_100327427 Ga0068868_1003274272 289
242 3300005344 Ga0070661_100019501 Ga0070661_1000195012 289
243 3300005344 Ga0070661_100165351 Ga0070661_1001653512 289
244 3300005344 Ga0070661_100188692 Ga0070661_1001886922 289
245 3300005355 Ga0070671_100249541 Ga0070671_1002495411 289
246 3300005364 Ga0070673_100038366 Ga0070673_1000383662 289
247 3300005364 Ga0070673_100200437 Ga0070673_1002004373 289
248 3300005365 Ga0070688_100009880 Ga0070688_1000098804 289
249 3300005367 Ga0070667_100283285 Ga0070667_1002832851 289
250 3300005456 Ga0070678_100169739 Ga0070678_1001697392 289
251 3300005457 Ga0070662_100008990 Ga0070662_1000089904 289
252 3300005457 Ga0070662_100056544 Ga0070662_1000565442 289
253 3300005466 Ga0070685_10094265 Ga0070685_100942652 289
254 3300005535 Ga0070684_100287731 Ga0070684_1002877312 289
255 3300005539 Ga0068853_100055024 Ga0068853_1000550241 289
256 3300005548 Ga0070665_100494817 Ga0070665_1004948171 289
257 3300005548 Ga0070665_100540048 Ga0070665_1005400482 289
258 3300005563 Ga0068855_100241986 Ga0068855_1002419862 289
259 3300005564 Ga0070664_100028830 Ga0070664_1000288302 289
260 3300005564 Ga0070664_100080279 Ga0070664_1000802793 289
261 3300005564 Ga0070664_100127697 Ga0070664_1001276972 289
262 3300005564 Ga0070664_100254014 Ga0070664_1002540141 289
263 3300005564 Ga0070664_100640679 Ga0070664_1006406791 289
264 3300005578 Ga0068854_100027744 Ga0068854_1000277442 289
265 3300005578 Ga0068854_100060276 Ga0068854_1000602762 289
266 3300005616 Ga0068852_100243486 Ga0068852_1002434862 289
267 3300005617 Ga0068859_100106657 Ga0068859_1001066572 289
268 3300005840 Ga0068870_10224723 Ga0068870_102247231 289
269 3300005841 Ga0068863_100066459 Ga0068863_1000664592 289
270 3300005842 Ga0068858_100040619 Ga0068858_1000406193 289
271 3300005843 Ga0068860_100391164 Ga0068860_1003911642 289
272 3300006358 Ga0068871_100099603 Ga0068871_1000996031 289
273 3300006931 Ga0097620_100106658 Ga0097620_1001066581 289
274 3300009093 Ga0105240_10286742 Ga0105240_102867422 289
275 3300009101 Ga0105247_10243948 Ga0105247_102439481 289
276 3300009174 Ga0105241_10167439 Ga0105241_101674391 289
277 3300009176 Ga0105242_10010889 Ga0105242_100108893 289
278 3300009177 Ga0105248_10038373 Ga0105248_100383735 289
279 3300013296 Ga0157374_10005131 Ga0157374_100051315 289
280 3300013306 Ga0163162_10022373 Ga0163162_100223737 289
281 3300013308 Ga0157375_10053231 Ga0157375_100532313 289
282 3300013308 Ga0157375_10246615 Ga0157375_102466152 289
283 3300014968 Ga0157379_10051787 Ga0157379_100517872 289
284 3300014969 Ga0157376_10049875 Ga0157376_100498752 289
285 3300014969 Ga0157376_10090042 Ga0157376_100900422 289
286 3300017792 Ga0163161_10026044 Ga0163161_100260442 289
287 3300017792 Ga0163161_10033988 Ga0163161_100339882 289
288 3300025903 Ga0207680_10083117 Ga0207680_100831172 289
289 3300025907 Ga0207645_10008131 Ga0207645_100081317 289
290 3300025908 Ga0207643_10165910 Ga0207643_101659101 289
291 3300025913 Ga0207695_10206963 Ga0207695_102069631 289
292 3300025926 Ga0207659_10374623 Ga0207659_103746232 289
293 3300025933 Ga0207706_10018649 Ga0207706_100186494 289
294 3300025934 Ga0207686_10010460 Ga0207686_100104601 289
295 3300025942 Ga0207689_10010127 Ga0207689_100101271 289
296 3300025944 Ga0207661_10195139 Ga0207661_101951392 289
297 3300025944 Ga0207661_10431473 Ga0207661_104314732 289
298 3300025945 Ga0207679_10052140 Ga0207679_100521404 289
299 3300025945 Ga0207679_10130103 Ga0207679_101301032 289
300 3300025960 Ga0207651_10228777 Ga0207651_102287771 289
301 3300025961 Ga0207712_10417681 Ga0207712_104176812 289
302 3300026023 Ga0207677_10014521 Ga0207677_100145213 289
303 3300026041 Ga0207639_10122485 Ga0207639_101224852 289
304 3300026088 Ga0207641_10083045 Ga0207641_100830452 289
305 3300026089 Ga0207648_10025487 Ga0207648_100254873 289
306 3300026089 Ga0207648_10041542 Ga0207648_100415422 289
307 3300026116 Ga0207674_10064095 Ga0207674_100640952 289
308 3300026118 Ga0207675_100296659 Ga0207675_1002966591 289
309 3300026121 Ga0207683_10037807 Ga0207683_100378072 289
310 3300028379 Ga0268266_10433259 Ga0268266_104332591 289
311 3300028381 Ga0268264_10757716 Ga0268264_107577161 289
312 3300046459 Ga0495629_0264155 Ga0495629_0264155_93_1001 289
313 3300046516 Ga0495628_0079228 Ga0495628_0079228_19_927 289
314 3300046517 Ga0495630_0005981 Ga0495630_0005981_4616_5524 289
315 3300046536 Ga0495587_0058578 Ga0495587_0058578_305_1213 289
316 3300046642 Ga0495634_0157205 Ga0495634_0157205_54_962 289
317 3300046663 Ga0495635_0140987 Ga0495635_0140987_377_1285 289
318 3300046681 Ga0495647_0122763 Ga0495647_0122763_83_991 289
319 3300047471 Ga0495684_0145715 Ga0495684_0145715_627_1535 289
320 3300048913 Ga0496110_0296903 Ga0496110_0296903_325_1254 289
321 3300005329 Ga0070683_100005709 Ga0070683_1000057095 290
322 3300005331 Ga0070670_100246973 Ga0070670_1002469732 290
323 3300005535 Ga0070684_100143480 Ga0070684_1001434802 290
324 3300005564 Ga0070664_100010697 Ga0070664_1000106974 290
325 3300025944 Ga0207661_10005744 Ga0207661_100057444 290
326 3300025945 Ga0207679_10047722 Ga0207679_100477223 290
327 3300025986 Ga0207658_10431557 Ga0207658_104315571 290
328 3300050493 nmdc:mga0k408_85337_c1 nmdc:mga0k408_85337_c1_823_1731 290
329 2162886011 MRS1b_contig_1163789 MRS1b_0013.00003380 291
330 3300005290 Ga0065712_10071904 Ga0065712_100719042 291
331 3300005331 Ga0070670_100047900 Ga0070670_1000479003 291
332 3300005354 Ga0070675_100023731 Ga0070675_1000237313 291
333 3300005466 Ga0070685_10149838 Ga0070685_101498381 291
334 3300005543 Ga0070672_100106405 Ga0070672_1001064052 291
335 3300005840 Ga0068870_10169026 Ga0068870_101690262 291
336 3300014326 Ga0157380_10011122 Ga0157380_100111224 291
337 3300025925 Ga0207650_10015903 Ga0207650_100159034 291
338 3300025926 Ga0207659_10013615 Ga0207659_100136154 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03706

LPG_synthase_TM

Lysylphosphatidylglycerol synthase TM region

54

225

0.96

PF03706

LPG_synthase_TM

Lysylphosphatidylglycerol synthase TM region

219

318

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7duw-assembly1.cif.gz_B cryo-em structure of the multiple peptide resistance factor (mprf) loaded with two lysyl-phosphatidylglycerol molecules 0.7161 35 282
6lvf-assembly1.cif.gz_A cryo-em structure of the multiple peptide resistance factor (mprf) loaded with one lysyl-phosphatidylglycerol molecule 0.7008 35 275
7f47-assembly1.cif.gz_A cryo-em structure of rhizobium etli mprf 0.6967 37 271
7duw-assembly1.cif.gz_B cryo-em structure of the multiple peptide resistance factor (mprf) loaded with two lysyl-phosphatidylglycerol molecules 0.6248 35 282
6lvf-assembly1.cif.gz_A cryo-em structure of the multiple peptide resistance factor (mprf) loaded with one lysyl-phosphatidylglycerol molecule 0.5933 35 275
ID Description Score Start End Superfamily
af_I1MXS1_409_498_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.4653 78 127 1.10.10.10
af_Q94AA1_34_188_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3789 78 287 1.20.1250.20
af_Q94AA1_34_188_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3734 78 287 1.20.1250.20
af_A0A0P0YBY4_33_209_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3297 81 288 1.20.1250.20
af_Q5SPF7_11_166_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3162 81 283 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A4Q3RJR6-F1-model_v4 Flippase-like domain-containing protein 0.9709 35 287 GO:0005886
AF-A0A3B9JRP2-F1-model_v4 deleted 0.9357 46 287
AF-A0A3B9JRP2-F1-model_v4 deleted 0.9246 46 287
AF-A0A4Q3RJR6-F1-model_v4 Flippase-like domain-containing protein 0.9207 35 287 GO:0005886
AF-A0A5C7URJ4-F1-model_v4 Flippase-like domain-containing protein 0.8926 15 276 GO:0005886

Feature Viewer

pLDDT pTM Quality
78.86 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map