F413286

General Info

Members Datasets Scaffolds Average Seq Length
337 191 674 360

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_10795_c1|nmdc:mga0a205_10795_c1_3772_5022
Length 399
Sequence MLTVSWDQVVIGAPAERPRRSGLRTRFLFLVFEPYPMAPGDVTGQNGAMPAGSGVGDALDGLLRPMLGTLERVGWVQRHLFPPAAERLAEVLAPQRKPLGDALEDFEAFAWTDDLRFIRDRLADCARQTLALVDAFATAAAGDQDPIGLYRALRRFAPLQEALYPLAPVLEPVSRWFLDPARRDDDALVVRLRAAALREGGPRVGVLHASNERDQRGGFSLYVPEDWDGHTAMPLVVALHGGHGMLVLSPTSRDRTWSIMGGGDVDAEPLAAMIESVAGGYAVDRARVLLTGMSDGATYALLLGLGADMPFTHLAPACGVLHPLLLIDGRFGRARGRPIYLVHGALDWMFPVQAARMAAEALRAAGASVVYREIEDLSHTYPRDENPAILDWLMNGTST

Samples

Sample ID Description Type Environment
1 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
2 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
131 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
132 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
144 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
145 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
146 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
187 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
188 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.04
Nodule 0
Rhizoplane 0
Rhizosphere 94.66
Stem 0
Stem Tuber 0
Unclassified 1.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0a205_10795_c1 3300050515 Bacteria 8402
2 JGI26129J50193_1000623 3300003349 Bacteria 2254
3 Ga0070658_10005272 3300005327 Bacteria 10499
4 Ga0070676_10000617 3300005328 Bacteria 17349
5 Ga0070683_100074886 3300005329 Bacteria 3162
6 Ga0070670_100005907 3300005331 Bacteria 10347
7 Ga0070680_100000922 3300005336 Bacteria 20816
8 Ga0070680_100002824 3300005336 Bacteria 12905
9 Ga0070680_100018244 3300005336 Bacteria 5542
10 Ga0070682_100000707 3300005337 Bacteria 20017
11 Ga0068868_100184218 3300005338 Bacteria 1734
12 Ga0070660_100000285 3300005339 Bacteria 33654
13 Ga0070689_100024546 3300005340 Bacteria 4523
14 Ga0070691_10001865 3300005341 Bacteria 9209
15 Ga0070691_10005639 3300005341 Bacteria 5705
16 Ga0070661_100001177 3300005344 Bacteria 18467
17 Ga0070661_100095284 3300005344 Bacteria 2207
18 Ga0070692_10000067 3300005345 Bacteria 20888
19 Ga0070669_100294560 3300005353 Bacteria 1304
20 Ga0070675_100041089 3300005354 Bacteria 3777
21 Ga0070675_100212798 3300005354 Bacteria 1681
22 Ga0070659_100003939 3300005366 Bacteria 10563
23 Ga0070713_100078708 3300005436 Bacteria 2807
24 Ga0070705_100000213 3300005440 Bacteria 34295
25 Ga0070705_100034124 3300005440 Bacteria 2842
26 Ga0070694_100000438 3300005444 Bacteria 22735
27 Ga0070694_100010160 3300005444 Bacteria 5793
28 Ga0070694_100012627 3300005444 Bacteria 5259
29 Ga0070708_100011197 3300005445 Bacteria 7295
30 Ga0070708_100022332 3300005445 Bacteria 5366
31 Ga0070708_100033787 3300005445 Bacteria 4444
32 Ga0070708_100080138 3300005445 Bacteria 2954
33 Ga0070708_100184586 3300005445 Bacteria 1950
34 Ga0070663_100015362 3300005455 Bacteria 4940
35 Ga0070678_100107197 3300005456 Bacteria 2179
36 Ga0070678_100212124 3300005456 Bacteria 1605
37 Ga0070662_100016023 3300005457 Bacteria 5029
38 Ga0070662_100058643 3300005457 Bacteria 2802
39 Ga0070662_100100315 3300005457 Bacteria 2190
40 Ga0070662_100233597 3300005457 Bacteria 1472
41 Ga0070681_10122625 3300005458 Bacteria 2532
42 Ga0068867_100003611 3300005459 Bacteria 10882
43 Ga0070706_100017969 3300005467 Bacteria 6523
44 Ga0070706_100039044 3300005467 Bacteria 4382
45 Ga0070706_100125788 3300005467 Bacteria 2390
46 Ga0070706_100126356 3300005467 Bacteria 2385
47 Ga0070706_100137853 3300005467 Bacteria 2277
48 Ga0070706_100212451 3300005467 Bacteria 1806
49 Ga0070707_100143670 3300005468 Bacteria 2322
50 Ga0070707_100162647 3300005468 Bacteria 2175
51 Ga0070707_100238436 3300005468 Bacteria 1770
52 Ga0070698_100001924 3300005471 Bacteria 23080
53 Ga0070698_100005900 3300005471 Bacteria 13362
54 Ga0070698_100016511 3300005471 Bacteria 7789
55 Ga0070699_100001250 3300005518 Bacteria 23419
56 Ga0070699_100005354 3300005518 Bacteria 11252
57 Ga0070699_100191367 3300005518 Bacteria 1818
58 Ga0070699_100235386 3300005518 Bacteria 1633
59 Ga0070699_100306252 3300005518 Bacteria 1426
60 Ga0070679_100000297 3300005530 Bacteria 42324
61 Ga0070684_100048787 3300005535 Bacteria 3674
62 Ga0070684_100159137 3300005535 Bacteria 2048
63 Ga0070697_100002217 3300005536 Bacteria 14910
64 Ga0070697_100002396 3300005536 Bacteria 14432
65 Ga0070697_100004235 3300005536 Bacteria 10993
66 Ga0070697_100016098 3300005536 Bacteria 5880
67 Ga0070697_100060719 3300005536 Bacteria 3082
68 Ga0070697_100067386 3300005536 Bacteria 2928
69 Ga0070697_100166099 3300005536 Bacteria 1866
70 Ga0068853_100015968 3300005539 Bacteria 6173
71 Ga0068853_100083796 3300005539 Bacteria 2793
72 Ga0070695_100000287 3300005545 Bacteria 25500
73 Ga0070695_100086403 3300005545 Bacteria 2084
74 Ga0070696_100000991 3300005546 Bacteria 18398
75 Ga0070693_100000123 3300005547 Bacteria 34654
76 Ga0070665_100060064 3300005548 Bacteria 3811
77 Ga0070704_100013561 3300005549 Bacteria 5061
78 Ga0070704_100103537 3300005549 Bacteria 2150
79 Ga0070704_100145849 3300005549 Bacteria 1855
80 Ga0068855_100026425 3300005563 Bacteria 6944
81 Ga0068855_100103122 3300005563 Bacteria 3282
82 Ga0070664_100044434 3300005564 Bacteria 3751
83 Ga0068857_100116826 3300005577 Bacteria 2400
84 Ga0068854_100003126 3300005578 Bacteria 10304
85 Ga0068856_100001178 3300005614 Bacteria 27516
86 Ga0068856_100090176 3300005614 Bacteria 3049
87 Ga0070702_100010061 3300005615 Bacteria 4648
88 Ga0068852_100058899 3300005616 Bacteria 3329
89 Ga0068859_100053942 3300005617 Bacteria 4043
90 Ga0068864_100003027 3300005618 Bacteria 13897
91 Ga0068861_100002748 3300005719 Bacteria 11532
92 Ga0068870_10001461 3300005840 Bacteria 9563
93 Ga0068858_100060873 3300005842 Bacteria 3490
94 Ga0068862_100077150 3300005844 Bacteria 2885
95 Ga0081455_10002478 3300005937 Bacteria 21945
96 Ga0081455_10003508 3300005937 Bacteria 18017
97 Ga0081538_10001131 3300005981 Bacteria 28183
98 Ga0081539_10003542 3300005985 Bacteria 18982
99 Ga0081539_10016760 3300005985 Bacteria 5202
100 Ga0075368_10035053 3300006042 Bacteria 1957
101 Ga0075362_10052626 3300006177 Bacteria 1825
102 Ga0075367_10099558 3300006178 Bacteria 1776
103 Ga0075369_10000790 3300006186 Bacteria 10355
104 Ga0075366_10013224 3300006195 Bacteria 4696
105 Ga0075366_10146519 3300006195 Bacteria 1429
106 Ga0075370_10072483 3300006353 Bacteria 1971
107 Ga0075428_100005100 3300006844 Bacteria 14597
108 Ga0075428_100007988 3300006844 Bacteria 11738
109 Ga0075428_100027938 3300006844 Bacteria 6243
110 Ga0075428_100030271 3300006844 Bacteria 5987
111 Ga0075428_100104955 3300006844 Bacteria 3082
112 Ga0075430_100000104 3300006846 Bacteria 50931
113 Ga0075430_100006501 3300006846 Bacteria 9855
114 Ga0075431_100000226 3300006847 Bacteria 42242
115 Ga0075431_100000785 3300006847 Bacteria 27685
116 Ga0075431_100006226 3300006847 Bacteria 11852
117 Ga0075431_100016538 3300006847 Bacteria 7487
118 Ga0075431_100020153 3300006847 Bacteria 6810
119 Ga0075431_100088453 3300006847 Bacteria 3196
120 Ga0075431_100134602 3300006847 Bacteria 2548
121 Ga0075433_10000689 3300006852 Bacteria 23036
122 Ga0075433_10007237 3300006852 Bacteria 8790
123 Ga0075433_10012676 3300006852 Bacteria 6821
124 Ga0075433_10107967 3300006852 Unclassified 2468
125 Ga0075434_100003181 3300006871 Bacteria 14644
126 Ga0075429_100004295 3300006880 Bacteria 12238
127 Ga0075429_100017434 3300006880 Bacteria 6209
128 Ga0075429_100175179 3300006880 Bacteria 1879
129 Ga0097620_100053940 3300006931 Bacteria 4043
130 Ga0075435_100023843 3300007076 Bacteria 4739
131 Ga0075435_100171781 3300007076 Unclassified 1829
132 Ga0099794_10012630 3300007265 Bacteria 3652
133 Ga0105240_10004099 3300009093 Bacteria 22375
134 Ga0111539_10001138 3300009094 Bacteria 35180
135 Ga0111539_10018179 3300009094 Bacteria 8707
136 Ga0114129_10000853 3300009147 Bacteria 39495
137 Ga0114129_10004058 3300009147 Bacteria 20668
138 Ga0114129_10010278 3300009147 Bacteria 13356
139 Ga0114129_10078656 3300009147 Bacteria 4587
140 Ga0114129_10103309 3300009147 Bacteria 3940
141 Ga0114129_10143896 3300009147 Bacteria 3266
142 Ga0105243_10328349 3300009148 Bacteria 1396
143 Ga0105241_10000684 3300009174 Bacteria 25577
144 Ga0105237_10137742 3300009545 Bacteria 2435
145 Ga0105237_10483223 3300009545 Bacteria 1245
146 Ga0157373_10000300 3300013100 Bacteria 40106
147 Ga0157371_10047497 3300013102 Bacteria 3052
148 Ga0157369_10109228 3300013105 Bacteria 2941
149 Ga0157369_10254904 3300013105 Bacteria 1831
150 Ga0157372_10000213 3300013307 Bacteria 64792
151 Ga0157372_10266335 3300013307 Bacteria 1990
152 Ga0163163_10371923 3300014325 Bacteria 1486
153 Ga0213872_10018534 3300021361 Bacteria 3210
154 Ga0207426_1015144 3300025302 Bacteria 2805
155 Ga0207653_10002134 3300025885 Bacteria 6302
156 Ga0207653_10022866 3300025885 Unclassified 1989
157 Ga0207645_10000206 3300025907 Bacteria 48176
158 Ga0207643_10000277 3300025908 Bacteria 35621
159 Ga0207684_10000746 3300025910 Bacteria 37987
160 Ga0207684_10000783 3300025910 Bacteria 36910
161 Ga0207684_10014988 3300025910 Bacteria 6673
162 Ga0207684_10021188 3300025910 Bacteria 5550
163 Ga0207684_10058205 3300025910 Bacteria 3279
164 Ga0207684_10247457 3300025910 Bacteria 1538
165 Ga0207684_10327654 3300025910 Bacteria 1320
166 Ga0207684_10335309 3300025910 Bacteria 1302
167 Ga0207654_10003426 3300025911 Bacteria 8018
168 Ga0207707_10005753 3300025912 Bacteria 10844
169 Ga0207707_10107934 3300025912 Bacteria 2434
170 Ga0207707_10255665 3300025912 Bacteria 1521
171 Ga0207657_10000200 3300025919 Bacteria 62248
172 Ga0207657_10106372 3300025919 Bacteria 2321
173 Ga0207649_10049642 3300025920 Bacteria 2592
174 Ga0207652_10000467 3300025921 Bacteria 41423
175 Ga0207646_10002863 3300025922 Bacteria 20033
176 Ga0207646_10022860 3300025922 Bacteria 5749
177 Ga0207681_10025822 3300025923 Bacteria 3783
178 Ga0207681_10281390 3300025923 Bacteria 1310
179 Ga0207700_10035885 3300025928 Bacteria 3575
180 Ga0207644_10239262 3300025931 Bacteria 1445
181 Ga0207690_10021047 3300025932 Bacteria 4040
182 Ga0207706_10064650 3300025933 Bacteria 3221
183 Ga0207706_10080715 3300025933 Bacteria 2859
184 Ga0207706_10132494 3300025933 Bacteria 2192
185 Ga0207670_10015751 3300025936 Bacteria 4526
186 Ga0207665_10012837 3300025939 Bacteria 5509
187 Ga0207689_10000020 3300025942 Bacteria 110705
188 Ga0207661_10079025 3300025944 Bacteria 2711
189 Ga0207679_10000511 3300025945 Bacteria 26402
190 Ga0207679_10044529 3300025945 Bacteria 3202
191 Ga0207667_10019706 3300025949 Bacteria 7520
192 Ga0207651_10377123 3300025960 Bacteria 1201
193 Ga0207640_10000917 3300025981 Bacteria 16525
194 Ga0207640_10067284 3300025981 Bacteria 2396
195 Ga0207677_10159192 3300026023 Bacteria 1752
196 Ga0207703_10090667 3300026035 Bacteria 2569
197 Ga0207639_10084784 3300026041 Bacteria 2518
198 Ga0207678_10009546 3300026067 Bacteria 8533
199 Ga0207708_10029117 3300026075 Bacteria 4183
200 Ga0207702_10004654 3300026078 Bacteria 12122
201 Ga0207702_10135174 3300026078 Bacteria 2224
202 Ga0207648_10002190 3300026089 Bacteria 21206
203 Ga0207674_10000665 3300026116 Bacteria 44712
204 Ga0207674_10025218 3300026116 Bacteria 6344
205 Ga0207675_100008265 3300026118 Bacteria 9803
206 Ga0207675_100551309 3300026118 Bacteria 1152
207 Ga0207683_10097238 3300026121 Bacteria 2625
208 Ga0207683_10137889 3300026121 Bacteria 2196
209 Ga0207698_10033908 3300026142 Bacteria 3715
210 Ga0209983_1000845 3300027665 Bacteria 6721
211 Ga0209971_1000138 3300027682 Bacteria 21874
212 Ga0209966_1000063 3300027695 Bacteria 47732
213 Ga0209998_10000350 3300027717 Bacteria 13585
214 Ga0207428_10000036 3300027907 Bacteria 223539
215 Ga0207428_10000503 3300027907 Bacteria 46699
216 Ga0268266_10066439 3300028379 Bacteria 3119
217 Ga0268266_10227931 3300028379 Bacteria 1715
218 Ga0268266_10244083 3300028379 Bacteria 1659
219 Ga0268265_10001282 3300028380 Bacteria 21647
220 Ga0268265_10130631 3300028380 Bacteria 2086
221 Ga0265340_10011172 3300031247 Bacteria 4783
222 Ga0307407_10062304 3300031903 Bacteria 2184
223 Ga0307409_100386073 3300031995 Bacteria 1333
224 Ga0307416_100010473 3300032002 Bacteria 6126
225 Ga0307411_10040698 3300032005 Bacteria 2950
226 Ga0373950_0009606 3300034818 Bacteria 1549
227 Ga0373940_0014134 3300035088 Bacteria 1943
228 Ga0373960_0007214 3300035121 Bacteria 2628
229 Ga0373931_0007669 3300035691 Bacteria 5092
230 Ga0373931_0056063 3300035691 Bacteria 2110
231 Ga0373935_0046184 3300035692 Bacteria 2750
232 Ga0373927_0040998 3300035695 Bacteria 3003
233 Ga0373937_0148382 3300036401 Bacteria 2196
234 Ga0395899_0011493 3300037312 Bacteria 6777
235 Ga0395899_0044283 3300037312 Bacteria 3317
236 Ga0395900_0002674 3300037418 Bacteria 19473
237 Ga0395900_0003055 3300037418 Bacteria 18227
238 Ga0395900_0051912 3300037418 Bacteria 4222
239 Ga0395898_0008960 3300037466 Bacteria 10536
240 Ga0395898_0012497 3300037466 Bacteria 8778
241 Ga0395901_0001645 3300038443 Bacteria 23122
242 Ga0395901_0004261 3300038443 Bacteria 14428
243 Ga0395901_0009095 3300038443 Bacteria 10058
244 Ga0436360_1062101 3300039438 Bacteria 9687
245 Ga0436361_0482288 3300039447 Bacteria 6210
246 Ga0439465_0060776 3300041413 Bacteria 1252
247 Ga0439441_022273 3300042001 Bacteria 1176
248 Ga0439448_0056212 3300042005 Bacteria 1295
249 Ga0439460_0000534 3300042461 Bacteria 8298
250 Ga0451577_0004015 3300042876 Bacteria 15822
251 Ga0451577_0013500 3300042876 Bacteria 7642
252 Ga0451577_0179440 3300042876 Bacteria 1909
253 Ga0453684_0018943 3300044712 Bacteria 10520
254 Ga0466957_0196468 3300044842 Bacteria 1323
255 Ga0451576_0014693 3300045051 Bacteria 8705
256 Ga0451576_0018088 3300045051 Bacteria 7733
257 Ga0451576_0024197 3300045051 Bacteria 6561
258 Ga0451576_0063713 3300045051 Bacteria 3841
259 Ga0451576_0102875 3300045051 Bacteria 2971
260 Ga0451576_0139548 3300045051 Bacteria 2528
261 Ga0466967_0171863 3300045976 Bacteria 2039
262 Ga0496126_0027000 3300048929 Bacteria 5495
263 Ga0501033_0045834 3300049570 Bacteria 3253
264 Ga0501033_0137510 3300049570 Bacteria 1768
265 Ga0501034_0001292 3300049571 Bacteria 33866
266 Ga0501034_0103880 3300049571 Bacteria 2835
267 Ga0501036_0245893 3300049572 Bacteria 1500
268 Ga0501036_0322038 3300049572 Bacteria 1292
269 Ga0501039_0006883 3300049575 Bacteria 8649
270 Ga0501040_0002701 3300049576 Bacteria 11438
271 Ga0501040_0052940 3300049576 Bacteria 2779
272 Ga0501040_0082348 3300049576 Bacteria 2231
273 Ga0501042_0043735 3300049578 Bacteria 3189
274 Ga0501043_0016709 3300049579 Bacteria 5751
275 Ga0501046_0000381 3300049580 Bacteria 44344
276 Ga0501046_0113595 3300049580 Bacteria 2067
277 Ga0501046_0254816 3300049580 Unclassified 1291
278 Ga0501047_0125110 3300049581 Bacteria 2452
279 Ga0501048_0054965 3300049582 Bacteria 2828
280 Ga0501068_0023586 3300049584 Bacteria 3607
281 Ga0501072_0112564 3300049588 Bacteria 2167
282 Ga0501072_0118961 3300049588 Bacteria 2105
283 Ga0501072_0190118 3300049588 Unclassified 1637
284 Ga0501072_0219629 3300049588 Unclassified 1515
285 Ga0501074_0007719 3300049590 Bacteria 7793
286 Ga0501076_0018506 3300049592 Bacteria 5313
287 Ga0501076_0251311 3300049592 Bacteria 1447
288 Ga0501079_0009665 3300049741 Bacteria 7314
289 Ga0501079_0045908 3300049741 Bacteria 3372
290 Ga0501079_0152742 3300049741 Bacteria 1800
291 Ga0501081_0003351 3300049743 Bacteria 10195
292 Ga0501081_0004532 3300049743 Bacteria 8922
293 Ga0501081_0096518 3300049743 Bacteria 2085
294 Ga0501081_0216787 3300049743 Bacteria 1391
295 Ga0501081_0246482 3300049743 Bacteria 1303
296 Ga0501083_0003247 3300049744 Bacteria 11345
297 Ga0501044_0087841 3300049823 Bacteria 3139
298 Ga0501045_0002669 3300049824 Bacteria 12166
299 nmdc:mga03683_14848_c1 3300050489 Bacteria 2892
300 nmdc:mga00v17_242598_c1 3300050491 Bacteria 1168
301 nmdc:mga0yw44_100295_c1 3300050492 Bacteria 1843
302 nmdc:mga0k408_6310_c1 3300050493 Bacteria 6326
303 nmdc:mga06z11_48554_c1 3300050494 Bacteria 2161
304 nmdc:mga07m45_2569_c1 3300050496 Bacteria 8549
305 nmdc:mga05p37_129281_c1 3300050507 Bacteria 3100
306 nmdc:mga05p37_172555_c1 3300050507 Bacteria 2637
307 nmdc:mga05p37_187778_c1 3300050507 Bacteria 2512
308 nmdc:mga05p37_25204_c1 3300050507 Bacteria 7232
309 nmdc:mga05p37_54465_c1 3300050507 Bacteria 4922
310 nmdc:mga05p37_854_c1 3300050507 Bacteria 34328
311 nmdc:mga09592_24740_c1 3300050508 Bacteria 4965
312 nmdc:mga09592_92733_c1 3300050508 Bacteria 2582
313 nmdc:mga0qj67_3408_c1 3300050509 Bacteria 11469
314 nmdc:mga0qj67_788_c1 3300050509 Bacteria 21551
315 nmdc:mga06r32_142_c1 3300050510 Bacteria 53686
316 nmdc:mga06r32_1764_c1 3300050510 Bacteria 19417
317 nmdc:mga06r32_563_c1 3300050510 Bacteria 32272
318 nmdc:mga06r32_82842_c1 3300050510 Bacteria 3126
319 nmdc:mga08y16_1556_c1 3300050511 Bacteria 23117
320 nmdc:mga08y16_1667_c1 3300050511 Bacteria 22504
321 nmdc:mga08y16_447608_c1 3300050511 Bacteria 1317
322 nmdc:mga0n895_29841_c1 3300050512 Bacteria 5205
323 nmdc:mga0rr50_188363_c1 3300050513 Bacteria 1690
324 nmdc:mga0rr50_2899_c1 3300050513 Bacteria 9781
325 nmdc:mga0rr50_63146_c1 3300050513 Bacteria 2796
326 nmdc:mga08x19_9900_c1 3300050514 Bacteria 5712
327 nmdc:mga0a205_15690_c1 3300050515 Bacteria 7079
328 nmdc:mga0a205_3559_c2 3300050515 Bacteria 13263
329 nmdc:mga0a205_57140_c1 3300050515 Bacteria 3768
330 nmdc:mga0a205_7941_c1 3300050515 Bacteria 9636
331 nmdc:mga0sz30_3065_c1 3300050516 Bacteria 5986
332 Ga0500641_0006628 3300053096 Bacteria 4111
333 Ga0500616_0001188 3300053153 Bacteria 26456
334 Ga0501084_0000763 3300054114 Bacteria 24548
335 Ga0501084_0059611 3300054114 Bacteria 3195
336 Ga0501082_0004255 3300060353 Bacteria 12504
337 Ga0530510_0199325 3300061734 Bacteria 1486
338 nmdc:mga0a205_10795_c1
339 JGI26129J50193_1000623
340 Ga0070658_10005272
341 Ga0070676_10000617
342 Ga0070683_100074886
343 Ga0070670_100005907
344 Ga0070680_100000922
345 Ga0070680_100002824
346 Ga0070680_100018244
347 Ga0070682_100000707
348 Ga0068868_100184218
349 Ga0070660_100000285
350 Ga0070689_100024546
351 Ga0070691_10001865
352 Ga0070691_10005639
353 Ga0070661_100001177
354 Ga0070661_100095284
355 Ga0070692_10000067
356 Ga0070669_100294560
357 Ga0070675_100041089
358 Ga0070675_100212798
359 Ga0070659_100003939
360 Ga0070713_100078708
361 Ga0070705_100000213
362 Ga0070705_100034124
363 Ga0070694_100000438
364 Ga0070694_100010160
365 Ga0070694_100012627
366 Ga0070708_100011197
367 Ga0070708_100022332
368 Ga0070708_100033787
369 Ga0070708_100080138
370 Ga0070708_100184586
371 Ga0070663_100015362
372 Ga0070678_100107197
373 Ga0070678_100212124
374 Ga0070662_100016023
375 Ga0070662_100058643
376 Ga0070662_100100315
377 Ga0070662_100233597
378 Ga0070681_10122625
379 Ga0068867_100003611
380 Ga0070706_100017969
381 Ga0070706_100039044
382 Ga0070706_100125788
383 Ga0070706_100126356
384 Ga0070706_100137853
385 Ga0070706_100212451
386 Ga0070707_100143670
387 Ga0070707_100162647
388 Ga0070707_100238436
389 Ga0070698_100001924
390 Ga0070698_100005900
391 Ga0070698_100016511
392 Ga0070699_100001250
393 Ga0070699_100005354
394 Ga0070699_100191367
395 Ga0070699_100235386
396 Ga0070699_100306252
397 Ga0070679_100000297
398 Ga0070684_100048787
399 Ga0070684_100159137
400 Ga0070697_100002217
401 Ga0070697_100002396
402 Ga0070697_100004235
403 Ga0070697_100016098
404 Ga0070697_100060719
405 Ga0070697_100067386
406 Ga0070697_100166099
407 Ga0068853_100015968
408 Ga0068853_100083796
409 Ga0070695_100000287
410 Ga0070695_100086403
411 Ga0070696_100000991
412 Ga0070693_100000123
413 Ga0070665_100060064
414 Ga0070704_100013561
415 Ga0070704_100103537
416 Ga0070704_100145849
417 Ga0068855_100026425
418 Ga0068855_100103122
419 Ga0070664_100044434
420 Ga0068857_100116826
421 Ga0068854_100003126
422 Ga0068856_100001178
423 Ga0068856_100090176
424 Ga0070702_100010061
425 Ga0068852_100058899
426 Ga0068859_100053942
427 Ga0068864_100003027
428 Ga0068861_100002748
429 Ga0068870_10001461
430 Ga0068858_100060873
431 Ga0068862_100077150
432 Ga0081455_10002478
433 Ga0081455_10003508
434 Ga0081538_10001131
435 Ga0081539_10003542
436 Ga0081539_10016760
437 Ga0075368_10035053
438 Ga0075362_10052626
439 Ga0075367_10099558
440 Ga0075369_10000790
441 Ga0075366_10013224
442 Ga0075366_10146519
443 Ga0075370_10072483
444 Ga0075428_100005100
445 Ga0075428_100007988
446 Ga0075428_100027938
447 Ga0075428_100030271
448 Ga0075428_100104955
449 Ga0075430_100000104
450 Ga0075430_100006501
451 Ga0075431_100000226
452 Ga0075431_100000785
453 Ga0075431_100006226
454 Ga0075431_100016538
455 Ga0075431_100020153
456 Ga0075431_100088453
457 Ga0075431_100134602
458 Ga0075433_10000689
459 Ga0075433_10007237
460 Ga0075433_10012676
461 Ga0075433_10107967
462 Ga0075434_100003181
463 Ga0075429_100004295
464 Ga0075429_100017434
465 Ga0075429_100175179
466 Ga0097620_100053940
467 Ga0075435_100023843
468 Ga0075435_100171781
469 Ga0099794_10012630
470 Ga0105240_10004099
471 Ga0111539_10001138
472 Ga0111539_10018179
473 Ga0114129_10000853
474 Ga0114129_10004058
475 Ga0114129_10010278
476 Ga0114129_10078656
477 Ga0114129_10103309
478 Ga0114129_10143896
479 Ga0105243_10328349
480 Ga0105241_10000684
481 Ga0105237_10137742
482 Ga0105237_10483223
483 Ga0157373_10000300
484 Ga0157371_10047497
485 Ga0157369_10109228
486 Ga0157369_10254904
487 Ga0157372_10000213
488 Ga0157372_10266335
489 Ga0163163_10371923
490 Ga0213872_10018534
491 Ga0207426_1015144
492 Ga0207653_10002134
493 Ga0207653_10022866
494 Ga0207645_10000206
495 Ga0207643_10000277
496 Ga0207684_10000746
497 Ga0207684_10000783
498 Ga0207684_10014988
499 Ga0207684_10021188
500 Ga0207684_10058205
501 Ga0207684_10247457
502 Ga0207684_10327654
503 Ga0207684_10335309
504 Ga0207654_10003426
505 Ga0207707_10005753
506 Ga0207707_10107934
507 Ga0207707_10255665
508 Ga0207657_10000200
509 Ga0207657_10106372
510 Ga0207649_10049642
511 Ga0207652_10000467
512 Ga0207646_10002863
513 Ga0207646_10022860
514 Ga0207681_10025822
515 Ga0207681_10281390
516 Ga0207700_10035885
517 Ga0207644_10239262
518 Ga0207690_10021047
519 Ga0207706_10064650
520 Ga0207706_10080715
521 Ga0207706_10132494
522 Ga0207670_10015751
523 Ga0207665_10012837
524 Ga0207689_10000020
525 Ga0207661_10079025
526 Ga0207679_10000511
527 Ga0207679_10044529
528 Ga0207667_10019706
529 Ga0207651_10377123
530 Ga0207640_10000917
531 Ga0207640_10067284
532 Ga0207677_10159192
533 Ga0207703_10090667
534 Ga0207639_10084784
535 Ga0207678_10009546
536 Ga0207708_10029117
537 Ga0207702_10004654
538 Ga0207702_10135174
539 Ga0207648_10002190
540 Ga0207674_10000665
541 Ga0207674_10025218
542 Ga0207675_100008265
543 Ga0207675_100551309
544 Ga0207683_10097238
545 Ga0207683_10137889
546 Ga0207698_10033908
547 Ga0209983_1000845
548 Ga0209971_1000138
549 Ga0209966_1000063
550 Ga0209998_10000350
551 Ga0207428_10000036
552 Ga0207428_10000503
553 Ga0268266_10066439
554 Ga0268266_10227931
555 Ga0268266_10244083
556 Ga0268265_10001282
557 Ga0268265_10130631
558 Ga0265340_10011172
559 Ga0307407_10062304
560 Ga0307409_100386073
561 Ga0307416_100010473
562 Ga0307411_10040698
563 Ga0373950_0009606
564 Ga0373940_0014134
565 Ga0373960_0007214
566 Ga0373931_0007669
567 Ga0373931_0056063
568 Ga0373935_0046184
569 Ga0373927_0040998
570 Ga0373937_0148382
571 Ga0395899_0011493
572 Ga0395899_0044283
573 Ga0395900_0002674
574 Ga0395900_0003055
575 Ga0395900_0051912
576 Ga0395898_0008960
577 Ga0395898_0012497
578 Ga0395901_0001645
579 Ga0395901_0004261
580 Ga0395901_0009095
581 Ga0436360_1062101
582 Ga0436361_0482288
583 Ga0439465_0060776
584 Ga0439441_022273
585 Ga0439448_0056212
586 Ga0439460_0000534
587 Ga0451577_0004015
588 Ga0451577_0013500
589 Ga0451577_0179440
590 Ga0453684_0018943
591 Ga0466957_0196468
592 Ga0451576_0014693
593 Ga0451576_0018088
594 Ga0451576_0024197
595 Ga0451576_0063713
596 Ga0451576_0102875
597 Ga0451576_0139548
598 Ga0466967_0171863
599 Ga0496126_0027000
600 Ga0501033_0045834
601 Ga0501033_0137510
602 Ga0501034_0001292
603 Ga0501034_0103880
604 Ga0501036_0245893
605 Ga0501036_0322038
606 Ga0501039_0006883
607 Ga0501040_0002701
608 Ga0501040_0052940
609 Ga0501040_0082348
610 Ga0501042_0043735
611 Ga0501043_0016709
612 Ga0501046_0000381
613 Ga0501046_0113595
614 Ga0501046_0254816
615 Ga0501047_0125110
616 Ga0501048_0054965
617 Ga0501068_0023586
618 Ga0501072_0112564
619 Ga0501072_0118961
620 Ga0501072_0190118
621 Ga0501072_0219629
622 Ga0501074_0007719
623 Ga0501076_0018506
624 Ga0501076_0251311
625 Ga0501079_0009665
626 Ga0501079_0045908
627 Ga0501079_0152742
628 Ga0501081_0003351
629 Ga0501081_0004532
630 Ga0501081_0096518
631 Ga0501081_0216787
632 Ga0501081_0246482
633 Ga0501083_0003247
634 Ga0501044_0087841
635 Ga0501045_0002669
636 nmdc:mga03683_14848_c1
637 nmdc:mga00v17_242598_c1
638 nmdc:mga0yw44_100295_c1
639 nmdc:mga0k408_6310_c1
640 nmdc:mga06z11_48554_c1
641 nmdc:mga07m45_2569_c1
642 nmdc:mga05p37_129281_c1
643 nmdc:mga05p37_172555_c1
644 nmdc:mga05p37_187778_c1
645 nmdc:mga05p37_25204_c1
646 nmdc:mga05p37_54465_c1
647 nmdc:mga05p37_854_c1
648 nmdc:mga09592_24740_c1
649 nmdc:mga09592_92733_c1
650 nmdc:mga0qj67_3408_c1
651 nmdc:mga0qj67_788_c1
652 nmdc:mga06r32_142_c1
653 nmdc:mga06r32_1764_c1
654 nmdc:mga06r32_563_c1
655 nmdc:mga06r32_82842_c1
656 nmdc:mga08y16_1556_c1
657 nmdc:mga08y16_1667_c1
658 nmdc:mga08y16_447608_c1
659 nmdc:mga0n895_29841_c1
660 nmdc:mga0rr50_188363_c1
661 nmdc:mga0rr50_2899_c1
662 nmdc:mga0rr50_63146_c1
663 nmdc:mga08x19_9900_c1
664 nmdc:mga0a205_15690_c1
665 nmdc:mga0a205_3559_c2
666 nmdc:mga0a205_57140_c1
667 nmdc:mga0a205_7941_c1
668 nmdc:mga0sz30_3065_c1
669 Ga0500641_0006628
670 Ga0500616_0001188
671 Ga0501084_0000763
672 Ga0501084_0059611
673 Ga0501082_0004255
674 Ga0530510_0199325

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02230

Abhydrolase_2

Phospholipase/Carboxylesterase

267

395

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wyd-assembly1.cif.gz_B c-terminal esterase domain of lc-est1 0.7751 170 349
3wyd-assembly1.cif.gz_B c-terminal esterase domain of lc-est1 0.73 170 349
6mly-assembly1.cif.gz_A bifunctional gh43-ce bacteroides eggerthii, bacegg_01304 0.7289 169 347
8daj-assembly1.cif.gz_A structure and biochemistry of a promiscuous thermophilic polyhydroxybutyrate depolymerase from lihuaxuella thermophilia 0.7257 157 348
7wg5-assembly1.cif.gz_h cyclic electron transport supercomplex ndh-psi from arabidopsis 0.7249 14 113
ID Description Score Start End Superfamily
af_B4F8H5_110_374_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8276 292 348 3.40.50.1820
af_Q5ABA5_40_323_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7958 292 347 3.40.50.1820
af_Q9SGH4_82_220_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.7957 14 113 1.20.120.290
3wydB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7751 170 349 3.40.50.1820
af_K7K1W5_103_244_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.7747 14 113 1.20.120.290
ID Description Score Start End GO Terms
AF-A0A3N5HUQ0-F1-model_v4 Phospholipase 0.9832 7 138
AF-A0A2V6PJ30-F1-model_v4 Phospholipase 0.9697 8 264
AF-A0A2V6S0S9-F1-model_v4 Uncharacterized protein 0.9694 1 134
AF-A0A2V6V7C1-F1-model_v4 Phospholipase 0.967 1 350
AF-A0A2V7F2F8-F1-model_v4 Phospholipase/carboxylesterase/thioesterase domain-containing protein 0.9654 8 349 GO:0005886
GO:0016787

Map