F413279

General Info

Members Datasets Scaffolds Average Seq Length
337 178 330 269

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_94541_c1|nmdc:mga06r32_94541_c1_71_976
Length 301
Sequence LNVGGLLFYKEVAYQLHWLGPCSETIIKNTKENIFMRNKMLFAVFSVLVILAVAVSPVGAITDGTPDGNGHPYVGLMVAQTAAGAPLWRCSGTLLSPTLFLTAGHCTEAPAAHVEIWFDADVQSGIPANGYPLNGDVGGTPHTHPQYNPNAFFLFDLGVVVLDEPVVMDEYGSLPELNQLDALKPNRHTTFTAVGYGLQQSFPDAASWKDVALRVRMVAHPKLNQINTGFTGDFSLLLSNNTNTGGTCFGDSGGPNFVGDSNVVGGVTSYGLNGSCAGTGGVYRVDRADDLNWLATFGVTP

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2643221711 Terrabacter sp. Root85 Isolate Unclassified
3 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
4 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
131 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
139 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
153 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.03
Metatranscriptomes 2.08
Isolates 0.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.08
Rhizosphere 97.03
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_9553136 2162886012 Bacteria 1010
2 JGI24738J21930_10017077 3300002075 Bacteria 1527
3 JGI25406J46586_10009980 3300003203 Bacteria 4235
4 Ga0006562J51391_1132900 3300003578 Bacteria 1622
5 Ga0065707_10089189 3300005295 Bacteria 4442
6 Ga0065707_10228287 3300005295 Bacteria 1198
7 Ga0070683_100151790 3300005329 Bacteria 2196
8 Ga0070683_100373252 3300005329 Bacteria 1359
9 Ga0070690_100156709 3300005330 Bacteria 1557
10 Ga0070690_100220651 3300005330 Bacteria 1328
11 Ga0070670_100005923 3300005331 Bacteria 10336
12 Ga0070677_10068163 3300005333 Bacteria 1488
13 Ga0070677_10084574 3300005333 Bacteria 1366
14 Ga0068869_100000028 3300005334 Bacteria 61654
15 Ga0068869_100090510 3300005334 Bacteria 2300
16 Ga0068869_100194873 3300005334 Bacteria 1595
17 Ga0068869_100239973 3300005334 Bacteria 1444
18 Ga0068869_100610080 3300005334 Bacteria 923
19 Ga0070680_100430092 3300005336 Bacteria 1126
20 Ga0070682_100191419 3300005337 Bacteria 1436
21 Ga0070660_100201914 3300005339 Bacteria 1613
22 Ga0070689_100078408 3300005340 Unclassified 2590
23 Ga0070689_100304033 3300005340 Unclassified 1328
24 Ga0070689_100438522 3300005340 Bacteria 1109
25 Ga0070689_100521612 3300005340 Unclassified 1020
26 Ga0070687_100109946 3300005343 Bacteria 1558
27 Ga0070661_100391327 3300005344 Bacteria 1097
28 Ga0070692_10017278 3300005345 Bacteria 3445
29 Ga0070692_10032679 3300005345 Bacteria 2617
30 Ga0070692_10083159 3300005345 Bacteria 1728
31 Ga0070668_100011258 3300005347 Bacteria 6662
32 Ga0070669_100031209 3300005353 Bacteria 3849
33 Ga0070669_100083418 3300005353 Bacteria 2383
34 Ga0070669_100402401 3300005353 Unclassified 1120
35 Ga0070669_100577114 3300005353 Bacteria 940
36 Ga0070671_100262810 3300005355 Bacteria 1467
37 Ga0070673_100079103 3300005364 Bacteria 2661
38 Ga0070688_100271960 3300005365 Bacteria 1214
39 Ga0070659_100451430 3300005366 Bacteria 1090
40 Ga0070667_100001790 3300005367 Bacteria 19123
41 Ga0070703_10013762 3300005406 Bacteria 2300
42 Ga0070703_10018916 3300005406 Unclassified 1995
43 Ga0070701_10236766 3300005438 Bacteria 1096
44 Ga0070700_100284965 3300005441 Bacteria 1199
45 Ga0070694_100011227 3300005444 Bacteria 5546
46 Ga0070694_100041097 3300005444 Bacteria 3083
47 Ga0070694_100085037 3300005444 Bacteria 2208
48 Ga0070694_100428417 3300005444 Unclassified 1040
49 Ga0070708_100001354 3300005445 Bacteria 18706
50 Ga0070663_100017434 3300005455 Bacteria 4687
51 Ga0070663_100107007 3300005455 Bacteria 2096
52 Ga0070678_100058393 3300005456 Bacteria 2831
53 Ga0070662_100037326 3300005457 Bacteria 3445
54 Ga0070681_10065550 3300005458 Bacteria 3600
55 Ga0068867_100031053 3300005459 Bacteria 3855
56 Ga0068867_100619042 3300005459 Bacteria 946
57 Ga0070706_100179119 3300005467 Bacteria 1979
58 Ga0070707_100024316 3300005468 Bacteria 5737
59 Ga0070707_100179831 3300005468 Unclassified 2062
60 Ga0070698_100030199 3300005471 Bacteria 5621
61 Ga0070698_100523663 3300005471 Bacteria 1124
62 Ga0070679_100081618 3300005530 Bacteria 3223
63 Ga0070684_100023758 3300005535 Bacteria 5133
64 Ga0070697_100195898 3300005536 Bacteria 1716
65 Ga0070697_100256363 3300005536 Bacteria 1497
66 Ga0070672_100061746 3300005543 Bacteria 2955
67 Ga0070672_100251554 3300005543 Bacteria 1488
68 Ga0070695_100022759 3300005545 Bacteria 3846
69 Ga0070695_100043827 3300005545 Bacteria 2846
70 Ga0070695_100220547 3300005545 Bacteria 1366
71 Ga0070696_100031360 3300005546 Bacteria 3642
72 Ga0070693_100277200 3300005547 Bacteria 1122
73 Ga0070704_100045989 3300005549 Bacteria 3040
74 Ga0070704_100133080 3300005549 Bacteria 1930
75 Ga0070704_100358610 3300005549 Unclassified 1233
76 Ga0068855_100112078 3300005563 Bacteria 3131
77 Ga0068855_100315928 3300005563 Bacteria 1728
78 Ga0068857_100005781 3300005577 Bacteria 10572
79 Ga0068857_100062678 3300005577 Bacteria 3306
80 Ga0068857_100576012 3300005577 Unclassified 1062
81 Ga0068854_100393815 3300005578 Bacteria 1144
82 Ga0068856_100648497 3300005614 Bacteria 1076
83 Ga0068852_100016361 3300005616 Bacteria 5780
84 Ga0068852_100533553 3300005616 Bacteria 1172
85 Ga0068859_100000096 3300005617 Bacteria 81199
86 Ga0068864_100000214 3300005618 Bacteria 52286
87 Ga0068861_100001020 3300005719 Bacteria 17114
88 Ga0068861_100120852 3300005719 Bacteria 2113
89 Ga0068870_10040098 3300005840 Bacteria 2426
90 Ga0068863_100002420 3300005841 Bacteria 18520
91 Ga0068858_100003194 3300005842 Bacteria 16375
92 Ga0068858_100268888 3300005842 Bacteria 1622
93 Ga0068860_100000735 3300005843 Bacteria 37305
94 Ga0068862_100003360 3300005844 Bacteria 13810
95 Ga0068862_100087757 3300005844 Bacteria 2705
96 Ga0081539_10000596 3300005985 Bacteria 73813
97 Ga0081539_10066619 3300005985 Unclassified 1951
98 Ga0097621_100048096 3300006237 Bacteria 3459
99 Ga0068871_100447456 3300006358 Bacteria 1157
100 Ga0075428_100003951 3300006844 Bacteria 16265
101 Ga0075428_100063031 3300006844 Bacteria 4058
102 Ga0075428_100096644 3300006844 Unclassified 3220
103 Ga0075428_100112019 3300006844 Bacteria 2972
104 Ga0075428_100448597 3300006844 Bacteria 1382
105 Ga0075430_100006745 3300006846 Bacteria 9684
106 Ga0075430_100016886 3300006846 Bacteria 6217
107 Ga0075430_100046765 3300006846 Bacteria 3654
108 Ga0075430_100097913 3300006846 Bacteria 2450
109 Ga0075430_100109517 3300006846 Bacteria 2304
110 Ga0075431_100011558 3300006847 Bacteria 8906
111 Ga0075431_100030579 3300006847 Bacteria 5548
112 Ga0075431_100187788 3300006847 Unclassified 2118
113 Ga0075431_100194617 3300006847 Bacteria 2076
114 Ga0075431_100195065 3300006847 Bacteria 2073
115 Ga0075433_10000267 3300006852 Bacteria 30611
116 Ga0075433_10124579 3300006852 Bacteria 2289
117 Ga0075433_10124963 3300006852 Bacteria 2285
118 Ga0075434_100398451 3300006871 Bacteria 1397
119 Ga0075429_100002122 3300006880 Bacteria 16544
120 Ga0075429_100010227 3300006880 Bacteria 8122
121 Ga0075429_100016849 3300006880 Bacteria 6323
122 Ga0075429_100037695 3300006880 Bacteria 4208
123 Ga0075429_100111338 3300006880 Bacteria 2393
124 Ga0075429_100160617 3300006880 Bacteria 1968
125 Ga0075429_100163366 3300006880 Bacteria 1950
126 Ga0075429_100222802 3300006880 Bacteria 1652
127 Ga0068865_100123963 3300006881 Bacteria 1926
128 Ga0068865_100173272 3300006881 Bacteria 1656
129 Ga0097620_100000096 3300006931 Bacteria 81199
130 Ga0105251_10097905 3300009011 Bacteria 1343
131 Ga0111539_10000040 3300009094 Bacteria 136085
132 Ga0111539_10035179 3300009094 Bacteria 6065
133 Ga0111539_10085771 3300009094 Bacteria 3700
134 Ga0111539_10210378 3300009094 Bacteria 2266
135 Ga0105245_10069455 3300009098 Bacteria 3194
136 Ga0105245_10071892 3300009098 Bacteria 3142
137 Ga0105245_10251907 3300009098 Bacteria 1716
138 Ga0105247_10029380 3300009101 Bacteria 3330
139 Ga0114129_10001121 3300009147 Bacteria 35352
140 Ga0114129_10011532 3300009147 Bacteria 12587
141 Ga0114129_10023422 3300009147 Bacteria 8755
142 Ga0114129_10053340 3300009147 Bacteria 5671
143 Ga0114129_10081196 3300009147 Unclassified 4507
144 Ga0114129_10244340 3300009147 Bacteria 2412
145 Ga0114129_10343414 3300009147 Bacteria 1979
146 Ga0114129_10355074 3300009147 Bacteria 1941
147 Ga0114129_10436568 3300009147 Bacteria 1720
148 Ga0114129_10641559 3300009147 Bacteria 1372
149 Ga0114129_10965125 3300009147 Bacteria 1076
150 Ga0105243_10157754 3300009148 Unclassified 1953
151 Ga0105243_10327262 3300009148 Bacteria 1399
152 Ga0105243_10395553 3300009148 Bacteria 1282
153 Ga0105242_10566930 3300009176 Bacteria 1091
154 Ga0105248_10012733 3300009177 Bacteria 9279
155 Ga0105238_10543877 3300009551 Bacteria 1165
156 Ga0105238_10746730 3300009551 Viruses 992
157 Ga0105249_10062373 3300009553 Bacteria 3423
158 Ga0105249_10343045 3300009553 Bacteria 1511
159 Ga0105246_10050363 3300011119 Unclassified 2857
160 Ga0105246_10067506 3300011119 Bacteria 2506
161 Ga0105246_10131342 3300011119 Bacteria 1871
162 Ga0157378_10024461 3300013297 Bacteria 5315
163 Ga0157378_10407452 3300013297 Bacteria 1341
164 Ga0163162_10137191 3300013306 Bacteria 2558
165 Ga0157372_10679164 3300013307 Bacteria 1199
166 Ga0157375_10027356 3300013308 Bacteria 5330
167 Ga0157375_10602807 3300013308 Bacteria 1257
168 Ga0163163_10002637 3300014325 Bacteria 15176
169 Ga0163163_10041820 3300014325 Plasmid 4484
170 Ga0157380_10156671 3300014326 Bacteria 1975
171 Ga0207697_10050110 3300025315 Bacteria 1724
172 Ga0207653_10000317 3300025885 Bacteria 26858
173 Ga0207653_10023233 3300025885 Bacteria 1974
174 Ga0207682_10071361 3300025893 Bacteria 1472
175 Ga0207710_10012999 3300025900 Bacteria 3506
176 Ga0207643_10060271 3300025908 Bacteria 2166
177 Ga0207684_10057784 3300025910 Bacteria 3291
178 Ga0207707_10034603 3300025912 Bacteria 4420
179 Ga0207662_10107354 3300025918 Bacteria 1737
180 Ga0207662_10406112 3300025918 Bacteria 924
181 Ga0207652_10276924 3300025921 Bacteria 1513
182 Ga0207652_10668509 3300025921 Bacteria 928
183 Ga0207681_10032922 3300025923 Unclassified 3397
184 Ga0207681_10033379 3300025923 Bacteria 3374
185 Ga0207681_10578997 3300025923 Unclassified 926
186 Ga0207650_10007429 3300025925 Bacteria 7467
187 Ga0207687_10023470 3300025927 Bacteria 4112
188 Ga0207687_10164630 3300025927 Bacteria 1705
189 Ga0207706_10036516 3300025933 Bacteria 4365
190 Ga0207706_10607951 3300025933 Bacteria 939
191 Ga0207709_10014048 3300025935 Bacteria 4421
192 Ga0207709_10047347 3300025935 Unclassified 2613
193 Ga0207670_10159804 3300025936 Unclassified 1681
194 Ga0207670_10524995 3300025936 Bacteria 964
195 Ga0207670_10565950 3300025936 Bacteria 930
196 Ga0207704_10126683 3300025938 Bacteria 1760
197 Ga0207704_10494613 3300025938 Bacteria 984
198 Ga0207691_10078122 3300025940 Bacteria 2980
199 Ga0207691_10287115 3300025940 Bacteria 1415
200 Ga0207711_10014327 3300025941 Bacteria 6585
201 Ga0207689_10000334 3300025942 Bacteria 43862
202 Ga0207689_10195792 3300025942 Bacteria 1668
203 Ga0207689_10217511 3300025942 Bacteria 1579
204 Ga0207661_10515313 3300025944 Bacteria 1093
205 Ga0207679_10485615 3300025945 Bacteria 1100
206 Ga0207667_10237693 3300025949 Bacteria 1865
207 Ga0207651_10039092 3300025960 Bacteria 3125
208 Ga0207712_10203841 3300025961 Bacteria 1570
209 Ga0207668_10002532 3300025972 Bacteria 10674
210 Ga0207640_10325540 3300025981 Bacteria 1225
211 Ga0207658_10008515 3300025986 Bacteria 6978
212 Ga0207703_10000206 3300026035 Bacteria 68955
213 Ga0207708_10154178 3300026075 Bacteria 1811
214 Ga0207648_10002856 3300026089 Bacteria 18283
215 Ga0207676_10002625 3300026095 Bacteria 12814
216 Ga0207674_10006160 3300026116 Bacteria 14165
217 Ga0207674_10010099 3300026116 Bacteria 10735
218 Ga0207674_10359007 3300026116 Bacteria 1408
219 Ga0207674_10591921 3300026116 Unclassified 1071
220 Ga0207675_100002403 3300026118 Bacteria 18543
221 Ga0207675_100541999 3300026118 Bacteria 1162
222 Ga0207683_10005942 3300026121 Bacteria 10463
223 Ga0207683_10465479 3300026121 Bacteria 1166
224 Ga0207698_10284288 3300026142 Bacteria 1532
225 Ga0207698_10507452 3300026142 Bacteria 1175
226 Ga0207428_10001798 3300027907 Bacteria 21966
227 Ga0207428_10002045 3300027907 Bacteria 20377
228 Ga0207428_10003662 3300027907 Bacteria 14809
229 Ga0207428_10099677 3300027907 Bacteria 2246
230 Ga0268266_10346191 3300028379 Bacteria 1396
231 Ga0268265_10046143 3300028380 Bacteria 3255
232 Ga0268264_10001364 3300028381 Bacteria 22890
233 Ga0307408_100130610 3300031548 Bacteria 1959
234 Ga0316576_10043867 3300031727 Unclassified 3229
235 Ga0316578_10036540 3300031728 Bacteria 2827
236 Ga0316578_10129324 3300031728 Bacteria 1519
237 Ga0307410_10055347 3300031852 Unclassified 2693
238 Ga0307406_10012114 3300031901 Bacteria 4908
239 Ga0307407_10038915 3300031903 Unclassified 2640
240 Ga0307409_100000783 3300031995 Bacteria 14426
241 Ga0307416_100033495 3300032002 Bacteria 3895
242 Ga0307415_100000032 3300032126 Bacteria 59889
243 Ga0307415_100104430 3300032126 Unclassified 2087
244 Ga0316583_10069587 3300032133 Bacteria 1231
245 Ga0316593_10033854 3300032168 Bacteria 1674
246 Ga0316592_1028714 3300033524 Bacteria 1205
247 Ga0316586_1018279 3300033527 Bacteria 1136
248 Ga0316588_1033631 3300033528 Bacteria 1209
249 Ga0316588_1073247 3300033528 Unclassified 843
250 Ga0316596_1038222 3300033541 Bacteria 1257
251 Ga0373953_0042152 3300035117 Unclassified 1818
252 Ga0373956_0123303 3300035119 Unclassified 1211
253 Ga0316574_0070572 3300035398 Bacteria 2206
254 Ga0316574_0094671 3300035398 Bacteria 1908
255 Ga0316574_0366311 3300035398 Bacteria 910
256 Ga0373927_0129510 3300035695 Unclassified 1648
257 Ga0316584_0003943 3300036712 Bacteria 9751
258 Ga0316584_0053330 3300036712 Unclassified 3026
259 Ga0316584_0182924 3300036712 Bacteria 1551
260 Ga0373925_0063459 3300037068 Bacteria 2779
261 Ga0395900_0291064 3300037418 Bacteria 1622
262 Ga0395898_0038070 3300037466 Bacteria 4769
263 Ga0400485_07613 3300038735 Bacteria 4342
264 Ga0439441_032260 3300042001 Bacteria 1020
265 Ga0451577_0005285 3300042876 Bacteria 13272
266 Ga0451577_0715434 3300042876 Unclassified 906
267 Ga0453683_0003060 3300044673 Bacteria 12524
268 Ga0453683_0046325 3300044673 Unclassified 2726
269 Ga0453683_0054601 3300044673 Bacteria 2500
270 Ga0453683_0247861 3300044673 Bacteria 1135
271 Ga0453683_0259141 3300044673 Unclassified 1109
272 Ga0453684_0194350 3300044712 Bacteria 2371
273 Ga0453684_0734966 3300044712 Unclassified 1069
274 Ga0451576_0029480 3300045051 Bacteria 5871
275 Ga0451576_0390408 3300045051 Unclassified 1459
276 Ga0495665_0078715 3300046531 Unclassified 1734
277 Ga0495656_0026868 3300046615 Bacteria 2295
278 Ga0495647_0056331 3300046681 Bacteria 1541
279 Ga0496101_0497912 3300048904 Bacteria 963
280 Ga0496107_0270425 3300048910 Bacteria 1265
281 Ga0496109_0009899 3300048912 Bacteria 8139
282 Ga0496110_0454249 3300048913 Bacteria 1168
283 Ga0496112_0032328 3300048915 Bacteria 5080
284 Ga0496112_0179252 3300048915 Bacteria 2083
285 Ga0496113_0005098 3300048916 Bacteria 8161
286 Ga0501040_0352691 3300049576 Bacteria 1054
287 Ga0501071_0049073 3300049587 Bacteria 3038
288 Ga0501071_0777431 3300049587 Bacteria 738
289 Ga0501075_0100395 3300049591 Bacteria 2198
290 Ga0501230_019960 3300049667 Bacteria 1161
291 Ga0501080_0551837 3300049742 Unclassified 1026
292 nmdc:mga05p37_123208_c1 3300050507 Unclassified 3184
293 nmdc:mga05p37_252463_c1 3300050507 Bacteria 2115
294 nmdc:mga05p37_36335_c1 3300050507 Bacteria 6044
295 nmdc:mga05p37_37448_c1 3300050507 Bacteria 5946
296 nmdc:mga05p37_56372_c1 3300050507 Unclassified 4838
297 nmdc:mga05p37_785_c1 3300050507 Bacteria 35316
298 nmdc:mga09592_121851_c1 3300050508 Bacteria 2240
299 nmdc:mga09592_123424_c1 3300050508 Bacteria 2225
300 nmdc:mga09592_16849_c1 3300050508 Bacteria 5981
301 nmdc:mga09592_21571_c1 3300050508 Bacteria 5308
302 nmdc:mga09592_41003_c1 3300050508 Bacteria 3892
303 nmdc:mga09592_42906_c1 3300050508 Bacteria 3805
304 nmdc:mga09592_44241_c1 3300050508 Bacteria 3748
305 nmdc:mga0qj67_15160_c1 3300050509 Bacteria 5832
306 nmdc:mga0qj67_365217_c1 3300050509 Bacteria 1166
307 nmdc:mga0qj67_6844_c1 3300050509 Bacteria 8381
308 nmdc:mga0qj67_6965_c1 3300050509 Bacteria 8324
309 nmdc:mga0qj67_7445_c1 3300050509 Bacteria 8085
310 nmdc:mga06r32_138338_c1 3300050510 Bacteria 2410
311 nmdc:mga06r32_170887_c1 3300050510 Bacteria 2158
312 nmdc:mga06r32_260388_c1 3300050510 Bacteria 1722
313 nmdc:mga06r32_291496_c1 3300050510 Bacteria 1619
314 nmdc:mga06r32_3651_c1 3300050510 Bacteria 13750
315 nmdc:mga06r32_3948_c2 3300050510 Bacteria 8202
316 nmdc:mga06r32_539745_c1 3300050510 Unclassified 1141
317 nmdc:mga06r32_91997_c1 3300050510 Unclassified 2965
318 nmdc:mga06r32_94541_c1 3300050510 Unclassified 2924
319 nmdc:mga08y16_114443_c1 3300050511 Bacteria 2808
320 nmdc:mga08y16_14090_c1 3300050511 Bacteria 8417
321 nmdc:mga08y16_2004_c1 3300050511 Bacteria 20828
322 nmdc:mga08y16_27192_c1 3300050511 Bacteria 6027
323 nmdc:mga08y16_724616_c1 3300050511 Bacteria 992
324 nmdc:mga08y16_83_c1 3300050511 Bacteria 80182
325 nmdc:mga0n895_28491_c1 3300050512 Bacteria 5312
326 nmdc:mga0n895_30340_c1 3300050512 Bacteria 5166
327 nmdc:mga0n895_54850_c1 3300050512 Bacteria 3921
328 nmdc:mga0a205_43614_c1 3300050515 Bacteria 4324
329 nmdc:mga0a205_49332_c1 3300050515 Bacteria 4063
330 nmdc:mga0a205_848_c1 3300050515 Bacteria 25049

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049587 Ga0501071_0777431 Ga0501071_0777431_19_699 226
2 3300026116 Ga0207674_10359007 Ga0207674_103590072 235
3 3300006847 Ga0075431_100030579 Ga0075431_1000305794 243
4 3300025923 Ga0207681_10578997 Ga0207681_105789971 243
5 3300050510 nmdc:mga06r32_3651_c1 nmdc:mga06r32_3651_c1_2689_3534 243
6 3300005329 Ga0070683_100373252 Ga0070683_1003732522 244
7 3300005458 Ga0070681_10065550 Ga0070681_100655503 244
8 3300005530 Ga0070679_100081618 Ga0070679_1000816183 244
9 3300005577 Ga0068857_100005781 Ga0068857_1000057816 244
10 3300009551 Ga0105238_10746730 Ga0105238_107467301 244
11 3300014325 Ga0163163_10041820 Ga0163163_100418205 244
12 3300025912 Ga0207707_10034603 Ga0207707_100346036 244
13 3300025921 Ga0207652_10668509 Ga0207652_106685091 244
14 3300026116 Ga0207674_10010099 Ga0207674_100100998 244
15 3300009553 Ga0105249_10343045 Ga0105249_103430451 247
16 3300005333 Ga0070677_10068163 Ga0070677_100681631 248
17 3300005340 Ga0070689_100078408 Ga0070689_1000784082 248
18 3300005353 Ga0070669_100402401 Ga0070669_1004024011 248
19 3300005456 Ga0070678_100058393 Ga0070678_1000583931 248
20 3300025893 Ga0207682_10071361 Ga0207682_100713611 248
21 3300025923 Ga0207681_10032922 Ga0207681_100329221 248
22 3300025936 Ga0207670_10159804 Ga0207670_101598042 248
23 3300026121 Ga0207683_10005942 Ga0207683_100059421 248
24 3300028379 Ga0268266_10346191 Ga0268266_103461912 248
25 3300006846 Ga0075430_100016886 Ga0075430_1000168864 250
26 3300009094 Ga0111539_10210378 Ga0111539_102103782 250
27 3300009147 Ga0114129_10355074 Ga0114129_103550742 250
28 3300027907 Ga0207428_10002045 Ga0207428_1000204511 250
29 3300050508 nmdc:mga09592_41003_c1 nmdc:mga09592_41003_c1_355_1203 250
30 3300050509 nmdc:mga0qj67_365217_c1 nmdc:mga0qj67_365217_c1_186_986 250
31 3300050509 nmdc:mga0qj67_6844_c1 nmdc:mga0qj67_6844_c1_1291_2139 250
32 3300050510 nmdc:mga06r32_291496_c1 nmdc:mga06r32_291496_c1_355_1203 250
33 3300050511 nmdc:mga08y16_27192_c1 nmdc:mga08y16_27192_c1_597_1445 250
34 3300005441 Ga0070700_100284965 Ga0070700_1002849651 251
35 3300005844 Ga0068862_100087757 Ga0068862_1000877573 251
36 3300006847 Ga0075431_100187788 Ga0075431_1001877882 251
37 3300025961 Ga0207712_10203841 Ga0207712_102038412 251
38 3300026075 Ga0207708_10154178 Ga0207708_101541781 251
39 3300036712 Ga0316584_0003943 Ga0316584_0003943_794_1624 251
40 3300049591 Ga0501075_0100395 Ga0501075_0100395_601_1452 251
41 3300050507 nmdc:mga05p37_123208_c1 nmdc:mga05p37_123208_c1_1285_2082 251
42 3300050510 nmdc:mga06r32_260388_c1 nmdc:mga06r32_260388_c1_303_1100 251
43 3300048915 Ga0496112_0032328 Ga0496112_0032328_510_1361 252
44 3300005340 Ga0070689_100438522 Ga0070689_1004385222 253
45 3300025936 Ga0207670_10524995 Ga0207670_105249951 253
46 3300009147 Ga0114129_10081196 Ga0114129_100811963 255
47 3300044673 Ga0453683_0054601 Ga0453683_0054601_1719_2489 255
48 3300046531 Ga0495665_0078715 Ga0495665_0078715_165_974 255
49 3300035398 Ga0316574_0070572 Ga0316574_0070572_36_839 256
50 3300050511 nmdc:mga08y16_724616_c1 nmdc:mga08y16_724616_c1_107_883 256
51 3300006880 Ga0075429_100016849 Ga0075429_1000168493 257
52 3300006880 Ga0075429_100222802 Ga0075429_1002228022 257
53 3300027907 Ga0207428_10003662 Ga0207428_1000366213 257
54 3300044673 Ga0453683_0259141 Ga0453683_0259141_205_1017 257
55 3300050508 nmdc:mga09592_121851_c1 nmdc:mga09592_121851_c1_139_918 257
56 3300050511 nmdc:mga08y16_2004_c1 nmdc:mga08y16_2004_c1_6135_6914 257
57 3300033527 Ga0316586_1018279 Ga0316586_10182791 258
58 3300050512 nmdc:mga0n895_30340_c1 nmdc:mga0n895_30340_c1_791_1612 258
59 3300050515 nmdc:mga0a205_848_c1 nmdc:mga0a205_848_c1_12258_13079 258
60 iso_pu_bacteria 2818991458 2819668042 258
61 3300006358 Ga0068871_100447456 Ga0068871_1004474561 259
62 3300031727 Ga0316576_10043867 Ga0316576_100438673 259
63 3300031728 Ga0316578_10129324 Ga0316578_101293241 259
64 3300033524 Ga0316592_1028714 Ga0316592_10287141 259
65 3300033528 Ga0316588_1033631 Ga0316588_10336311 259
66 3300033541 Ga0316596_1038222 Ga0316596_10382221 259
67 3300036712 Ga0316584_0053330 Ga0316584_0053330_969_1790 259
68 3300044673 Ga0453683_0003060 Ga0453683_0003060_51_857 259
69 3300044673 Ga0453683_0046325 Ga0453683_0046325_640_1446 259
70 3300045051 Ga0451576_0029480 Ga0451576_0029480_2613_3419 259
71 3300045051 Ga0451576_0390408 Ga0451576_0390408_617_1423 259
72 3300025918 Ga0207662_10406112 Ga0207662_104061121 260
73 3300026116 Ga0207674_10006160 Ga0207674_1000616014 260
74 iso_pu_bacteria 2643221711 2644609836 260
75 3300006844 Ga0075428_100063031 Ga0075428_1000630313 261
76 3300006846 Ga0075430_100006745 Ga0075430_1000067458 261
77 3300006880 Ga0075429_100037695 Ga0075429_1000376954 261
78 3300009147 Ga0114129_10436568 Ga0114129_104365682 261
79 3300014326 Ga0157380_10156671 Ga0157380_101566712 261
80 3300042001 Ga0439441_032260 Ga0439441_032260_142_972 261
81 3300050507 nmdc:mga05p37_252463_c1 nmdc:mga05p37_252463_c1_1261_2049 261
82 3300050508 nmdc:mga09592_44241_c1 nmdc:mga09592_44241_c1_1716_2504 261
83 3300050509 nmdc:mga0qj67_7445_c1 nmdc:mga0qj67_7445_c1_620_1408 261
84 3300050510 nmdc:mga06r32_170887_c1 nmdc:mga06r32_170887_c1_719_1507 261
85 iso_pu_bacteria 2833709550 2833712706 261
86 3300005340 Ga0070689_100304033 Ga0070689_1003040331 262
87 3300005444 Ga0070694_100011227 Ga0070694_1000112272 262
88 3300005468 Ga0070707_100024316 Ga0070707_1000243162 262
89 3300005546 Ga0070696_100031360 Ga0070696_1000313602 262
90 3300005549 Ga0070704_100358610 Ga0070704_1003586102 262
91 3300006237 Ga0097621_100048096 Ga0097621_1000480962 262
92 3300006844 Ga0075428_100003951 Ga0075428_10000395112 262
93 3300006846 Ga0075430_100046765 Ga0075430_1000467654 262
94 3300006846 Ga0075430_100097913 Ga0075430_1000979132 262
95 3300006847 Ga0075431_100011558 Ga0075431_1000115588 262
96 3300006847 Ga0075431_100194617 Ga0075431_1001946172 262
97 3300006847 Ga0075431_100195065 Ga0075431_1001950652 262
98 3300006852 Ga0075433_10124963 Ga0075433_101249632 262
99 3300006880 Ga0075429_100010227 Ga0075429_1000102272 262
100 3300006880 Ga0075429_100160617 Ga0075429_1001606171 262
101 3300009094 Ga0111539_10000040 Ga0111539_1000004062 262
102 3300009094 Ga0111539_10035179 Ga0111539_100351794 262
103 3300009094 Ga0111539_10085771 Ga0111539_100857714 262
104 3300009147 Ga0114129_10011532 Ga0114129_100115322 262
105 3300009147 Ga0114129_10244340 Ga0114129_102443403 262
106 3300009147 Ga0114129_10641559 Ga0114129_106415591 262
107 3300027907 Ga0207428_10001798 Ga0207428_100017987 262
108 3300027907 Ga0207428_10099677 Ga0207428_100996774 262
109 3300033528 Ga0316588_1073247 Ga0316588_10732471 262
110 3300046615 Ga0495656_0026868 Ga0495656_0026868_491_1330 262
111 3300046681 Ga0495647_0056331 Ga0495647_0056331_357_1190 262
112 3300048913 Ga0496110_0454249 Ga0496110_0454249_139_927 262
113 3300050507 nmdc:mga05p37_36335_c1 nmdc:mga05p37_36335_c1_122_961 262
114 3300050509 nmdc:mga0qj67_15160_c1 nmdc:mga0qj67_15160_c1_2003_2839 262
115 3300050509 nmdc:mga0qj67_6965_c1 nmdc:mga0qj67_6965_c1_7153_7944 262
116 3300050510 nmdc:mga06r32_138338_c1 nmdc:mga06r32_138338_c1_1027_1863 262
117 3300050510 nmdc:mga06r32_3948_c2 nmdc:mga06r32_3948_c2_321_1112 262
118 3300050510 nmdc:mga06r32_91997_c1 nmdc:mga06r32_91997_c1_741_1577 262
119 3300050511 nmdc:mga08y16_114443_c1 nmdc:mga08y16_114443_c1_1000_1839 262
120 3300050511 nmdc:mga08y16_83_c1 nmdc:mga08y16_83_c1_36583_37419 262
121 3300003203 JGI25406J46586_10009980 JGI25406J46586_100099801 263
122 3300005334 Ga0068869_100194873 Ga0068869_1001948732 263
123 3300005353 Ga0070669_100031209 Ga0070669_1000312093 263
124 3300005985 Ga0081539_10000596 Ga0081539_1000059653 263
125 3300006852 Ga0075433_10000267 Ga0075433_100002673 263
126 3300025923 Ga0207681_10033379 Ga0207681_100333793 263
127 3300025942 Ga0207689_10195792 Ga0207689_101957922 263
128 3300031548 Ga0307408_100130610 Ga0307408_1001306102 263
129 3300031901 Ga0307406_10012114 Ga0307406_100121143 263
130 3300031903 Ga0307407_10038915 Ga0307407_100389151 263
131 3300031995 Ga0307409_100000783 Ga0307409_1000007835 263
132 3300032002 Ga0307416_100033495 Ga0307416_1000334952 263
133 3300032126 Ga0307415_100000032 Ga0307415_10000003249 263
134 3300035398 Ga0316574_0366311 Ga0316574_0366311_53_877 263
135 3300037418 Ga0395900_0291064 Ga0395900_0291064_193_984 263
136 3300037466 Ga0395898_0038070 Ga0395898_0038070_348_1139 263
137 3300048915 Ga0496112_0179252 Ga0496112_0179252_433_1224 263
138 3300048916 Ga0496113_0005098 Ga0496113_0005098_675_1466 263
139 3300050512 nmdc:mga0n895_28491_c1 nmdc:mga0n895_28491_c1_919_1746 263
140 3300050515 nmdc:mga0a205_43614_c1 nmdc:mga0a205_43614_c1_3231_4058 263
141 3300003578 Ga0006562J51391_1132900 Ga0006562J51391_11329002 264
142 3300005330 Ga0070690_100156709 Ga0070690_1001567092 264
143 3300005331 Ga0070670_100005923 Ga0070670_1000059238 264
144 3300005334 Ga0068869_100000028 Ga0068869_10000002827 264
145 3300005340 Ga0070689_100521612 Ga0070689_1005216121 264
146 3300005347 Ga0070668_100011258 Ga0070668_1000112585 264
147 3300005353 Ga0070669_100083418 Ga0070669_1000834182 264
148 3300005355 Ga0070671_100262810 Ga0070671_1002628102 264
149 3300005364 Ga0070673_100079103 Ga0070673_1000791032 264
150 3300005365 Ga0070688_100271960 Ga0070688_1002719602 264
151 3300005367 Ga0070667_100001790 Ga0070667_10000179014 264
152 3300005455 Ga0070663_100107007 Ga0070663_1001070073 264
153 3300005457 Ga0070662_100037326 Ga0070662_1000373264 264
154 3300005459 Ga0068867_100031053 Ga0068867_1000310532 264
155 3300005543 Ga0070672_100061746 Ga0070672_1000617463 264
156 3300005545 Ga0070695_100220547 Ga0070695_1002205472 264
157 3300005563 Ga0068855_100112078 Ga0068855_1001120784 264
158 3300005577 Ga0068857_100062678 Ga0068857_1000626783 264
159 3300005616 Ga0068852_100533553 Ga0068852_1005335532 264
160 3300005617 Ga0068859_100000096 Ga0068859_10000009637 264
161 3300005618 Ga0068864_100000214 Ga0068864_10000021429 264
162 3300005719 Ga0068861_100001020 Ga0068861_10000102012 264
163 3300005841 Ga0068863_100002420 Ga0068863_1000024207 264
164 3300005842 Ga0068858_100003194 Ga0068858_10000319414 264
165 3300005843 Ga0068860_100000735 Ga0068860_10000073515 264
166 3300005844 Ga0068862_100003360 Ga0068862_1000033607 264
167 3300006881 Ga0068865_100123963 Ga0068865_1001239633 264
168 3300006931 Ga0097620_100000096 Ga0097620_10000009637 264
169 3300009011 Ga0105251_10097905 Ga0105251_100979052 264
170 3300009098 Ga0105245_10251907 Ga0105245_102519073 264
171 3300009101 Ga0105247_10029380 Ga0105247_100293803 264
172 3300009148 Ga0105243_10395553 Ga0105243_103955531 264
173 3300009177 Ga0105248_10012733 Ga0105248_100127334 264
174 3300009553 Ga0105249_10062373 Ga0105249_100623734 264
175 3300011119 Ga0105246_10050363 Ga0105246_100503632 264
176 3300011119 Ga0105246_10067506 Ga0105246_100675063 264
177 3300013297 Ga0157378_10024461 Ga0157378_100244614 264
178 3300013297 Ga0157378_10407452 Ga0157378_104074522 264
179 3300013306 Ga0163162_10137191 Ga0163162_101371913 264
180 3300013308 Ga0157375_10027356 Ga0157375_100273563 264
181 3300013308 Ga0157375_10602807 Ga0157375_106028072 264
182 3300014325 Ga0163163_10002637 Ga0163163_100026377 264
183 3300025315 Ga0207697_10050110 Ga0207697_100501103 264
184 3300025900 Ga0207710_10012999 Ga0207710_100129993 264
185 3300025925 Ga0207650_10007429 Ga0207650_100074298 264
186 3300025927 Ga0207687_10164630 Ga0207687_101646303 264
187 3300025933 Ga0207706_10036516 Ga0207706_100365163 264
188 3300025936 Ga0207670_10565950 Ga0207670_105659501 264
189 3300025938 Ga0207704_10126683 Ga0207704_101266831 264
190 3300025940 Ga0207691_10078122 Ga0207691_100781222 264
191 3300025941 Ga0207711_10014327 Ga0207711_100143272 264
192 3300025942 Ga0207689_10000334 Ga0207689_1000033429 264
193 3300025960 Ga0207651_10039092 Ga0207651_100390921 264
194 3300025972 Ga0207668_10002532 Ga0207668_100025325 264
195 3300025986 Ga0207658_10008515 Ga0207658_100085153 264
196 3300026035 Ga0207703_10000206 Ga0207703_1000020646 264
197 3300026089 Ga0207648_10002856 Ga0207648_100028564 264
198 3300026095 Ga0207676_10002625 Ga0207676_1000262510 264
199 3300026118 Ga0207675_100002403 Ga0207675_1000024035 264
200 3300026142 Ga0207698_10284288 Ga0207698_102842882 264
201 3300028380 Ga0268265_10046143 Ga0268265_100461434 264
202 3300028381 Ga0268264_10001364 Ga0268264_1000136423 264
203 3300032133 Ga0316583_10069587 Ga0316583_100695872 264
204 3300042876 Ga0451577_0005285 Ga0451577_0005285_11283_12095 264
205 3300042876 Ga0451577_0715434 Ga0451577_0715434_90_893 264
206 3300044712 Ga0453684_0194350 Ga0453684_0194350_943_1755 264
207 3300044712 Ga0453684_0734966 Ga0453684_0734966_225_1028 264
208 3300048910 Ga0496107_0270425 Ga0496107_0270425_48_881 264
209 3300048912 Ga0496109_0009899 Ga0496109_0009899_259_1092 264
210 3300002075 JGI24738J21930_10017077 JGI24738J21930_100170771 265
211 3300005329 Ga0070683_100151790 Ga0070683_1001517903 265
212 3300005330 Ga0070690_100220651 Ga0070690_1002206512 265
213 3300005334 Ga0068869_100239973 Ga0068869_1002399731 265
214 3300005334 Ga0068869_100610080 Ga0068869_1006100801 265
215 3300005336 Ga0070680_100430092 Ga0070680_1004300921 265
216 3300005337 Ga0070682_100191419 Ga0070682_1001914191 265
217 3300005339 Ga0070660_100201914 Ga0070660_1002019142 265
218 3300005344 Ga0070661_100391327 Ga0070661_1003913271 265
219 3300005345 Ga0070692_10083159 Ga0070692_100831591 265
220 3300005366 Ga0070659_100451430 Ga0070659_1004514301 265
221 3300005455 Ga0070663_100017434 Ga0070663_1000174345 265
222 3300005459 Ga0068867_100619042 Ga0068867_1006190421 265
223 3300005471 Ga0070698_100523663 Ga0070698_1005236632 265
224 3300005535 Ga0070684_100023758 Ga0070684_1000237583 265
225 3300005543 Ga0070672_100251554 Ga0070672_1002515543 265
226 3300005547 Ga0070693_100277200 Ga0070693_1002772001 265
227 3300005563 Ga0068855_100315928 Ga0068855_1003159283 265
228 3300005578 Ga0068854_100393815 Ga0068854_1003938152 265
229 3300005614 Ga0068856_100648497 Ga0068856_1006484972 265
230 3300005616 Ga0068852_100016361 Ga0068852_1000163614 265
231 3300005719 Ga0068861_100120852 Ga0068861_1001208524 265
232 3300005840 Ga0068870_10040098 Ga0068870_100400983 265
233 3300005842 Ga0068858_100268888 Ga0068858_1002688881 265
234 3300006881 Ga0068865_100173272 Ga0068865_1001732723 265
235 3300009098 Ga0105245_10069455 Ga0105245_100694554 265
236 3300009098 Ga0105245_10071892 Ga0105245_100718921 265
237 3300009148 Ga0105243_10327262 Ga0105243_103272623 265
238 3300009176 Ga0105242_10566930 Ga0105242_105669301 265
239 3300009551 Ga0105238_10543877 Ga0105238_105438772 265
240 3300011119 Ga0105246_10131342 Ga0105246_101313424 265
241 3300013307 Ga0157372_10679164 Ga0157372_106791642 265
242 3300025908 Ga0207643_10060271 Ga0207643_100602712 265
243 3300025921 Ga0207652_10276924 Ga0207652_102769242 265
244 3300025927 Ga0207687_10023470 Ga0207687_100234704 265
245 3300025933 Ga0207706_10607951 Ga0207706_106079511 265
246 3300025935 Ga0207709_10014048 Ga0207709_100140482 265
247 3300025938 Ga0207704_10494613 Ga0207704_104946131 265
248 3300025940 Ga0207691_10287115 Ga0207691_102871152 265
249 3300025944 Ga0207661_10515313 Ga0207661_105153132 265
250 3300025945 Ga0207679_10485615 Ga0207679_104856151 265
251 3300025949 Ga0207667_10237693 Ga0207667_102376931 265
252 3300025981 Ga0207640_10325540 Ga0207640_103255402 265
253 3300026116 Ga0207674_10591921 Ga0207674_105919212 265
254 3300026118 Ga0207675_100541999 Ga0207675_1005419992 265
255 3300026121 Ga0207683_10465479 Ga0207683_104654792 265
256 3300026142 Ga0207698_10507452 Ga0207698_105074522 265
257 3300035695 Ga0373927_0129510 Ga0373927_0129510_619_1419 265
258 3300037068 Ga0373925_0063459 Ga0373925_0063459_685_1485 265
259 3300048904 Ga0496101_0497912 Ga0496101_0497912_56_853 265
260 3300050510 nmdc:mga06r32_94541_c1 nmdc:mga06r32_94541_c1_71_976 265
261 3300050511 nmdc:mga08y16_14090_c1 nmdc:mga08y16_14090_c1_7587_8384 265
262 3300005295 Ga0065707_10089189 Ga0065707_100891894 266
263 3300005295 Ga0065707_10228287 Ga0065707_102282872 266
264 3300005345 Ga0070692_10032679 Ga0070692_100326792 266
265 3300005353 Ga0070669_100577114 Ga0070669_1005771141 266
266 3300005406 Ga0070703_10018916 Ga0070703_100189161 266
267 3300005438 Ga0070701_10236766 Ga0070701_102367662 266
268 3300005444 Ga0070694_100428417 Ga0070694_1004284171 266
269 3300005445 Ga0070708_100001354 Ga0070708_10000135410 266
270 3300005467 Ga0070706_100179119 Ga0070706_1001791192 266
271 3300005468 Ga0070707_100179831 Ga0070707_1001798312 266
272 3300005471 Ga0070698_100030199 Ga0070698_1000301994 266
273 3300005536 Ga0070697_100195898 Ga0070697_1001958981 266
274 3300005536 Ga0070697_100256363 Ga0070697_1002563632 266
275 3300005545 Ga0070695_100043827 Ga0070695_1000438273 266
276 3300005549 Ga0070704_100045989 Ga0070704_1000459892 266
277 3300006844 Ga0075428_100112019 Ga0075428_1001120192 266
278 3300006844 Ga0075428_100112019 Ga0075428_1001120193 266
279 3300006844 Ga0075428_100448597 Ga0075428_1004485972 266
280 3300006846 Ga0075430_100109517 Ga0075430_1001095172 266
281 3300006871 Ga0075434_100398451 Ga0075434_1003984512 266
282 3300006880 Ga0075429_100163366 Ga0075429_1001633662 266
283 3300009147 Ga0114129_10023422 Ga0114129_100234228 266
284 3300009147 Ga0114129_10053340 Ga0114129_100533402 266
285 3300009147 Ga0114129_10053340 Ga0114129_100533403 266
286 3300009148 Ga0105243_10157754 Ga0105243_101577541 266
287 3300025885 Ga0207653_10000317 Ga0207653_1000031730 266
288 3300025910 Ga0207684_10057784 Ga0207684_100577842 266
289 3300025935 Ga0207709_10047347 Ga0207709_100473472 266
290 3300031728 Ga0316578_10036540 Ga0316578_100365402 266
291 3300044673 Ga0453683_0247861 Ga0453683_0247861_15_824 266
292 3300049587 Ga0501071_0049073 Ga0501071_0049073_1953_2753 266
293 3300049742 Ga0501080_0551837 Ga0501080_0551837_75_875 266
294 3300050507 nmdc:mga05p37_37448_c1 nmdc:mga05p37_37448_c1_2105_2950 266
295 3300050507 nmdc:mga05p37_37448_c1 nmdc:mga05p37_37448_c1_992_1795 266
296 3300050507 nmdc:mga05p37_56372_c1 nmdc:mga05p37_56372_c1_246_1049 266
297 3300050508 nmdc:mga09592_123424_c1 nmdc:mga09592_123424_c1_368_1222 266
298 3300050508 nmdc:mga09592_42906_c1 nmdc:mga09592_42906_c1_1771_2574 266
299 3300050508 nmdc:mga09592_42906_c1 nmdc:mga09592_42906_c1_2884_3729 266
300 3300050510 nmdc:mga06r32_539745_c1 nmdc:mga06r32_539745_c1_190_1044 266
301 3300050512 nmdc:mga0n895_54850_c1 nmdc:mga0n895_54850_c1_1776_2591 266
302 3300005334 Ga0068869_100090510 Ga0068869_1000905102 267
303 3300025942 Ga0207689_10217511 Ga0207689_102175112 267
304 3300035117 Ga0373953_0042152 Ga0373953_0042152_446_1279 267
305 3300035119 Ga0373956_0123303 Ga0373956_0123303_142_975 267
306 3300005333 Ga0070677_10084574 Ga0070677_100845741 268
307 3300005577 Ga0068857_100576012 Ga0068857_1005760121 268
308 3300005985 Ga0081539_10066619 Ga0081539_100666192 268
309 3300006844 Ga0075428_100096644 Ga0075428_1000966442 268
310 3300006880 Ga0075429_100002122 Ga0075429_10000212211 268
311 3300006880 Ga0075429_100111338 Ga0075429_1001113381 268
312 3300009147 Ga0114129_10001121 Ga0114129_1000112131 268
313 3300031852 Ga0307410_10055347 Ga0307410_100553472 268
314 3300032126 Ga0307415_100104430 Ga0307415_1001044301 268
315 3300032168 Ga0316593_10033854 Ga0316593_100338543 268
316 3300035398 Ga0316574_0094671 Ga0316574_0094671_901_1716 268
317 3300036712 Ga0316584_0182924 Ga0316584_0182924_219_1034 268
318 3300038735 Ga0400485_07613 Ga0400485_07613_735_1559 268
319 3300049667 Ga0501230_019960 Ga0501230_019960_119_925 268
320 3300050507 nmdc:mga05p37_785_c1 nmdc:mga05p37_785_c1_6200_7006 268
321 3300050508 nmdc:mga09592_16849_c1 nmdc:mga09592_16849_c1_863_1669 268
322 3300050508 nmdc:mga09592_21571_c1 nmdc:mga09592_21571_c1_3021_3827 268
323 3300005444 Ga0070694_100085037 Ga0070694_1000850372 269
324 3300009147 Ga0114129_10343414 Ga0114129_103434142 269
325 3300009147 Ga0114129_10965125 Ga0114129_109651251 269
326 3300049576 Ga0501040_0352691 Ga0501040_0352691_190_1005 269
327 2162886012 MBSR1b_contig_9553136 MBSR1b_0272.00006110 271
328 3300005343 Ga0070687_100109946 Ga0070687_1001099461 271
329 3300005345 Ga0070692_10017278 Ga0070692_100172783 271
330 3300005406 Ga0070703_10013762 Ga0070703_100137622 271
331 3300005444 Ga0070694_100041097 Ga0070694_1000410972 271
332 3300005545 Ga0070695_100022759 Ga0070695_1000227592 271
333 3300005549 Ga0070704_100133080 Ga0070704_1001330802 271
334 3300006852 Ga0075433_10124579 Ga0075433_101245792 271
335 3300025885 Ga0207653_10023233 Ga0207653_100232332 271
336 3300025918 Ga0207662_10107354 Ga0207662_101073542 271
337 3300050515 nmdc:mga0a205_49332_c1 nmdc:mga0a205_49332_c1_527_1342 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00089

Trypsin

Trypsin

63

291

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4afz-assembly2.cif.gz_B human chymase - fynomer complex 0.7674 28 269
1fuj-assembly1.cif.gz_D pr3 (myeloblastin) 0.766 25 266
1fi8-assembly1.cif.gz_A rat granzyme b [n66q] complexed to ecotin [81-84 iepd] 0.766 36 267
1fi8-assembly1.cif.gz_B rat granzyme b [n66q] complexed to ecotin [81-84 iepd] 0.7644 36 267
4niv-assembly1.cif.gz_A crystal structure of trypsiligase (k60e/n143h/y151h/d189k trypsin) trigonal form 0.7607 29 269
ID Description Score Start End Superfamily
af_P17207_42_140_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.79 26 136 2.40.10.10
af_P17207_42_140_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.7829 26 136 2.40.10.10
af_Q9VRS6_31_271_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.7768 25 268 2.40.10.10
af_P32822_32_130_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.7755 36 141 2.40.10.10
af_G3V8K8_195_280_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.7736 36 134 2.40.10.10
ID Description Score Start End GO Terms
AF-A0A7S1YI27-F1-model_v4 Peptidase S1 domain-containing protein 0.9036 33 80 GO:0004252
GO:0006508
AF-A0A7J9Y0U8-F1-model_v4 Trypsin-like serine protease 0.8879 19 270 GO:0004252
GO:0006508
AF-A0A511R174-F1-model_v4 Peptidase S1 domain-containing protein 0.8765 79 266 GO:0004252
GO:0006508
AF-A0A2V7L301-F1-model_v4 Serine protease 0.8677 25 266 GO:0004252
GO:0006508
AF-A0A6J4VVH0-F1-model_v4 Peptidase S1 domain-containing protein 0.8634 19 267 GO:0004252
GO:0006508

Feature Viewer

pLDDT pTM Quality
81.59 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map