F413279
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 337 | 178 | 330 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300050510|nmdc:mga06r32_94541_c1|nmdc:mga06r32_94541_c1_71_976 |
| Length | 301 |
| Sequence | LNVGGLLFYKEVAYQLHWLGPCSETIIKNTKENIFMRNKMLFAVFSVLVILAVAVSPVGAITDGTPDGNGHPYVGLMVAQTAAGAPLWRCSGTLLSPTLFLTAGHCTEAPAAHVEIWFDADVQSGIPANGYPLNGDVGGTPHTHPQYNPNAFFLFDLGVVVLDEPVVMDEYGSLPELNQLDALKPNRHTTFTAVGYGLQQSFPDAASWKDVALRVRMVAHPKLNQINTGFTGDFSLLLSNNTNTGGTCFGDSGGPNFVGDSNVVGGVTSYGLNGSCAGTGGVYRVDRADDLNWLATFGVTP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 3 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 4 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 126 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 130 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 131 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 132 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 133 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 134 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 135 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 136 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 137 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 138 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 139 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 145 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 146 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 147 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 148 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 149 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 151 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 152 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 153 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 154 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 155 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 156 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 157 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 158 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 163 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 165 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 166 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 167 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 171 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.03 |
| Metatranscriptomes | 2.08 |
| Isolates | 0.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.08 |
| Rhizosphere | 97.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_9553136 | 2162886012 | Bacteria | 1010 |
| 2 | JGI24738J21930_10017077 | 3300002075 | Bacteria | 1527 |
| 3 | JGI25406J46586_10009980 | 3300003203 | Bacteria | 4235 |
| 4 | Ga0006562J51391_1132900 | 3300003578 | Bacteria | 1622 |
| 5 | Ga0065707_10089189 | 3300005295 | Bacteria | 4442 |
| 6 | Ga0065707_10228287 | 3300005295 | Bacteria | 1198 |
| 7 | Ga0070683_100151790 | 3300005329 | Bacteria | 2196 |
| 8 | Ga0070683_100373252 | 3300005329 | Bacteria | 1359 |
| 9 | Ga0070690_100156709 | 3300005330 | Bacteria | 1557 |
| 10 | Ga0070690_100220651 | 3300005330 | Bacteria | 1328 |
| 11 | Ga0070670_100005923 | 3300005331 | Bacteria | 10336 |
| 12 | Ga0070677_10068163 | 3300005333 | Bacteria | 1488 |
| 13 | Ga0070677_10084574 | 3300005333 | Bacteria | 1366 |
| 14 | Ga0068869_100000028 | 3300005334 | Bacteria | 61654 |
| 15 | Ga0068869_100090510 | 3300005334 | Bacteria | 2300 |
| 16 | Ga0068869_100194873 | 3300005334 | Bacteria | 1595 |
| 17 | Ga0068869_100239973 | 3300005334 | Bacteria | 1444 |
| 18 | Ga0068869_100610080 | 3300005334 | Bacteria | 923 |
| 19 | Ga0070680_100430092 | 3300005336 | Bacteria | 1126 |
| 20 | Ga0070682_100191419 | 3300005337 | Bacteria | 1436 |
| 21 | Ga0070660_100201914 | 3300005339 | Bacteria | 1613 |
| 22 | Ga0070689_100078408 | 3300005340 | Unclassified | 2590 |
| 23 | Ga0070689_100304033 | 3300005340 | Unclassified | 1328 |
| 24 | Ga0070689_100438522 | 3300005340 | Bacteria | 1109 |
| 25 | Ga0070689_100521612 | 3300005340 | Unclassified | 1020 |
| 26 | Ga0070687_100109946 | 3300005343 | Bacteria | 1558 |
| 27 | Ga0070661_100391327 | 3300005344 | Bacteria | 1097 |
| 28 | Ga0070692_10017278 | 3300005345 | Bacteria | 3445 |
| 29 | Ga0070692_10032679 | 3300005345 | Bacteria | 2617 |
| 30 | Ga0070692_10083159 | 3300005345 | Bacteria | 1728 |
| 31 | Ga0070668_100011258 | 3300005347 | Bacteria | 6662 |
| 32 | Ga0070669_100031209 | 3300005353 | Bacteria | 3849 |
| 33 | Ga0070669_100083418 | 3300005353 | Bacteria | 2383 |
| 34 | Ga0070669_100402401 | 3300005353 | Unclassified | 1120 |
| 35 | Ga0070669_100577114 | 3300005353 | Bacteria | 940 |
| 36 | Ga0070671_100262810 | 3300005355 | Bacteria | 1467 |
| 37 | Ga0070673_100079103 | 3300005364 | Bacteria | 2661 |
| 38 | Ga0070688_100271960 | 3300005365 | Bacteria | 1214 |
| 39 | Ga0070659_100451430 | 3300005366 | Bacteria | 1090 |
| 40 | Ga0070667_100001790 | 3300005367 | Bacteria | 19123 |
| 41 | Ga0070703_10013762 | 3300005406 | Bacteria | 2300 |
| 42 | Ga0070703_10018916 | 3300005406 | Unclassified | 1995 |
| 43 | Ga0070701_10236766 | 3300005438 | Bacteria | 1096 |
| 44 | Ga0070700_100284965 | 3300005441 | Bacteria | 1199 |
| 45 | Ga0070694_100011227 | 3300005444 | Bacteria | 5546 |
| 46 | Ga0070694_100041097 | 3300005444 | Bacteria | 3083 |
| 47 | Ga0070694_100085037 | 3300005444 | Bacteria | 2208 |
| 48 | Ga0070694_100428417 | 3300005444 | Unclassified | 1040 |
| 49 | Ga0070708_100001354 | 3300005445 | Bacteria | 18706 |
| 50 | Ga0070663_100017434 | 3300005455 | Bacteria | 4687 |
| 51 | Ga0070663_100107007 | 3300005455 | Bacteria | 2096 |
| 52 | Ga0070678_100058393 | 3300005456 | Bacteria | 2831 |
| 53 | Ga0070662_100037326 | 3300005457 | Bacteria | 3445 |
| 54 | Ga0070681_10065550 | 3300005458 | Bacteria | 3600 |
| 55 | Ga0068867_100031053 | 3300005459 | Bacteria | 3855 |
| 56 | Ga0068867_100619042 | 3300005459 | Bacteria | 946 |
| 57 | Ga0070706_100179119 | 3300005467 | Bacteria | 1979 |
| 58 | Ga0070707_100024316 | 3300005468 | Bacteria | 5737 |
| 59 | Ga0070707_100179831 | 3300005468 | Unclassified | 2062 |
| 60 | Ga0070698_100030199 | 3300005471 | Bacteria | 5621 |
| 61 | Ga0070698_100523663 | 3300005471 | Bacteria | 1124 |
| 62 | Ga0070679_100081618 | 3300005530 | Bacteria | 3223 |
| 63 | Ga0070684_100023758 | 3300005535 | Bacteria | 5133 |
| 64 | Ga0070697_100195898 | 3300005536 | Bacteria | 1716 |
| 65 | Ga0070697_100256363 | 3300005536 | Bacteria | 1497 |
| 66 | Ga0070672_100061746 | 3300005543 | Bacteria | 2955 |
| 67 | Ga0070672_100251554 | 3300005543 | Bacteria | 1488 |
| 68 | Ga0070695_100022759 | 3300005545 | Bacteria | 3846 |
| 69 | Ga0070695_100043827 | 3300005545 | Bacteria | 2846 |
| 70 | Ga0070695_100220547 | 3300005545 | Bacteria | 1366 |
| 71 | Ga0070696_100031360 | 3300005546 | Bacteria | 3642 |
| 72 | Ga0070693_100277200 | 3300005547 | Bacteria | 1122 |
| 73 | Ga0070704_100045989 | 3300005549 | Bacteria | 3040 |
| 74 | Ga0070704_100133080 | 3300005549 | Bacteria | 1930 |
| 75 | Ga0070704_100358610 | 3300005549 | Unclassified | 1233 |
| 76 | Ga0068855_100112078 | 3300005563 | Bacteria | 3131 |
| 77 | Ga0068855_100315928 | 3300005563 | Bacteria | 1728 |
| 78 | Ga0068857_100005781 | 3300005577 | Bacteria | 10572 |
| 79 | Ga0068857_100062678 | 3300005577 | Bacteria | 3306 |
| 80 | Ga0068857_100576012 | 3300005577 | Unclassified | 1062 |
| 81 | Ga0068854_100393815 | 3300005578 | Bacteria | 1144 |
| 82 | Ga0068856_100648497 | 3300005614 | Bacteria | 1076 |
| 83 | Ga0068852_100016361 | 3300005616 | Bacteria | 5780 |
| 84 | Ga0068852_100533553 | 3300005616 | Bacteria | 1172 |
| 85 | Ga0068859_100000096 | 3300005617 | Bacteria | 81199 |
| 86 | Ga0068864_100000214 | 3300005618 | Bacteria | 52286 |
| 87 | Ga0068861_100001020 | 3300005719 | Bacteria | 17114 |
| 88 | Ga0068861_100120852 | 3300005719 | Bacteria | 2113 |
| 89 | Ga0068870_10040098 | 3300005840 | Bacteria | 2426 |
| 90 | Ga0068863_100002420 | 3300005841 | Bacteria | 18520 |
| 91 | Ga0068858_100003194 | 3300005842 | Bacteria | 16375 |
| 92 | Ga0068858_100268888 | 3300005842 | Bacteria | 1622 |
| 93 | Ga0068860_100000735 | 3300005843 | Bacteria | 37305 |
| 94 | Ga0068862_100003360 | 3300005844 | Bacteria | 13810 |
| 95 | Ga0068862_100087757 | 3300005844 | Bacteria | 2705 |
| 96 | Ga0081539_10000596 | 3300005985 | Bacteria | 73813 |
| 97 | Ga0081539_10066619 | 3300005985 | Unclassified | 1951 |
| 98 | Ga0097621_100048096 | 3300006237 | Bacteria | 3459 |
| 99 | Ga0068871_100447456 | 3300006358 | Bacteria | 1157 |
| 100 | Ga0075428_100003951 | 3300006844 | Bacteria | 16265 |
| 101 | Ga0075428_100063031 | 3300006844 | Bacteria | 4058 |
| 102 | Ga0075428_100096644 | 3300006844 | Unclassified | 3220 |
| 103 | Ga0075428_100112019 | 3300006844 | Bacteria | 2972 |
| 104 | Ga0075428_100448597 | 3300006844 | Bacteria | 1382 |
| 105 | Ga0075430_100006745 | 3300006846 | Bacteria | 9684 |
| 106 | Ga0075430_100016886 | 3300006846 | Bacteria | 6217 |
| 107 | Ga0075430_100046765 | 3300006846 | Bacteria | 3654 |
| 108 | Ga0075430_100097913 | 3300006846 | Bacteria | 2450 |
| 109 | Ga0075430_100109517 | 3300006846 | Bacteria | 2304 |
| 110 | Ga0075431_100011558 | 3300006847 | Bacteria | 8906 |
| 111 | Ga0075431_100030579 | 3300006847 | Bacteria | 5548 |
| 112 | Ga0075431_100187788 | 3300006847 | Unclassified | 2118 |
| 113 | Ga0075431_100194617 | 3300006847 | Bacteria | 2076 |
| 114 | Ga0075431_100195065 | 3300006847 | Bacteria | 2073 |
| 115 | Ga0075433_10000267 | 3300006852 | Bacteria | 30611 |
| 116 | Ga0075433_10124579 | 3300006852 | Bacteria | 2289 |
| 117 | Ga0075433_10124963 | 3300006852 | Bacteria | 2285 |
| 118 | Ga0075434_100398451 | 3300006871 | Bacteria | 1397 |
| 119 | Ga0075429_100002122 | 3300006880 | Bacteria | 16544 |
| 120 | Ga0075429_100010227 | 3300006880 | Bacteria | 8122 |
| 121 | Ga0075429_100016849 | 3300006880 | Bacteria | 6323 |
| 122 | Ga0075429_100037695 | 3300006880 | Bacteria | 4208 |
| 123 | Ga0075429_100111338 | 3300006880 | Bacteria | 2393 |
| 124 | Ga0075429_100160617 | 3300006880 | Bacteria | 1968 |
| 125 | Ga0075429_100163366 | 3300006880 | Bacteria | 1950 |
| 126 | Ga0075429_100222802 | 3300006880 | Bacteria | 1652 |
| 127 | Ga0068865_100123963 | 3300006881 | Bacteria | 1926 |
| 128 | Ga0068865_100173272 | 3300006881 | Bacteria | 1656 |
| 129 | Ga0097620_100000096 | 3300006931 | Bacteria | 81199 |
| 130 | Ga0105251_10097905 | 3300009011 | Bacteria | 1343 |
| 131 | Ga0111539_10000040 | 3300009094 | Bacteria | 136085 |
| 132 | Ga0111539_10035179 | 3300009094 | Bacteria | 6065 |
| 133 | Ga0111539_10085771 | 3300009094 | Bacteria | 3700 |
| 134 | Ga0111539_10210378 | 3300009094 | Bacteria | 2266 |
| 135 | Ga0105245_10069455 | 3300009098 | Bacteria | 3194 |
| 136 | Ga0105245_10071892 | 3300009098 | Bacteria | 3142 |
| 137 | Ga0105245_10251907 | 3300009098 | Bacteria | 1716 |
| 138 | Ga0105247_10029380 | 3300009101 | Bacteria | 3330 |
| 139 | Ga0114129_10001121 | 3300009147 | Bacteria | 35352 |
| 140 | Ga0114129_10011532 | 3300009147 | Bacteria | 12587 |
| 141 | Ga0114129_10023422 | 3300009147 | Bacteria | 8755 |
| 142 | Ga0114129_10053340 | 3300009147 | Bacteria | 5671 |
| 143 | Ga0114129_10081196 | 3300009147 | Unclassified | 4507 |
| 144 | Ga0114129_10244340 | 3300009147 | Bacteria | 2412 |
| 145 | Ga0114129_10343414 | 3300009147 | Bacteria | 1979 |
| 146 | Ga0114129_10355074 | 3300009147 | Bacteria | 1941 |
| 147 | Ga0114129_10436568 | 3300009147 | Bacteria | 1720 |
| 148 | Ga0114129_10641559 | 3300009147 | Bacteria | 1372 |
| 149 | Ga0114129_10965125 | 3300009147 | Bacteria | 1076 |
| 150 | Ga0105243_10157754 | 3300009148 | Unclassified | 1953 |
| 151 | Ga0105243_10327262 | 3300009148 | Bacteria | 1399 |
| 152 | Ga0105243_10395553 | 3300009148 | Bacteria | 1282 |
| 153 | Ga0105242_10566930 | 3300009176 | Bacteria | 1091 |
| 154 | Ga0105248_10012733 | 3300009177 | Bacteria | 9279 |
| 155 | Ga0105238_10543877 | 3300009551 | Bacteria | 1165 |
| 156 | Ga0105238_10746730 | 3300009551 | Viruses | 992 |
| 157 | Ga0105249_10062373 | 3300009553 | Bacteria | 3423 |
| 158 | Ga0105249_10343045 | 3300009553 | Bacteria | 1511 |
| 159 | Ga0105246_10050363 | 3300011119 | Unclassified | 2857 |
| 160 | Ga0105246_10067506 | 3300011119 | Bacteria | 2506 |
| 161 | Ga0105246_10131342 | 3300011119 | Bacteria | 1871 |
| 162 | Ga0157378_10024461 | 3300013297 | Bacteria | 5315 |
| 163 | Ga0157378_10407452 | 3300013297 | Bacteria | 1341 |
| 164 | Ga0163162_10137191 | 3300013306 | Bacteria | 2558 |
| 165 | Ga0157372_10679164 | 3300013307 | Bacteria | 1199 |
| 166 | Ga0157375_10027356 | 3300013308 | Bacteria | 5330 |
| 167 | Ga0157375_10602807 | 3300013308 | Bacteria | 1257 |
| 168 | Ga0163163_10002637 | 3300014325 | Bacteria | 15176 |
| 169 | Ga0163163_10041820 | 3300014325 | Plasmid | 4484 |
| 170 | Ga0157380_10156671 | 3300014326 | Bacteria | 1975 |
| 171 | Ga0207697_10050110 | 3300025315 | Bacteria | 1724 |
| 172 | Ga0207653_10000317 | 3300025885 | Bacteria | 26858 |
| 173 | Ga0207653_10023233 | 3300025885 | Bacteria | 1974 |
| 174 | Ga0207682_10071361 | 3300025893 | Bacteria | 1472 |
| 175 | Ga0207710_10012999 | 3300025900 | Bacteria | 3506 |
| 176 | Ga0207643_10060271 | 3300025908 | Bacteria | 2166 |
| 177 | Ga0207684_10057784 | 3300025910 | Bacteria | 3291 |
| 178 | Ga0207707_10034603 | 3300025912 | Bacteria | 4420 |
| 179 | Ga0207662_10107354 | 3300025918 | Bacteria | 1737 |
| 180 | Ga0207662_10406112 | 3300025918 | Bacteria | 924 |
| 181 | Ga0207652_10276924 | 3300025921 | Bacteria | 1513 |
| 182 | Ga0207652_10668509 | 3300025921 | Bacteria | 928 |
| 183 | Ga0207681_10032922 | 3300025923 | Unclassified | 3397 |
| 184 | Ga0207681_10033379 | 3300025923 | Bacteria | 3374 |
| 185 | Ga0207681_10578997 | 3300025923 | Unclassified | 926 |
| 186 | Ga0207650_10007429 | 3300025925 | Bacteria | 7467 |
| 187 | Ga0207687_10023470 | 3300025927 | Bacteria | 4112 |
| 188 | Ga0207687_10164630 | 3300025927 | Bacteria | 1705 |
| 189 | Ga0207706_10036516 | 3300025933 | Bacteria | 4365 |
| 190 | Ga0207706_10607951 | 3300025933 | Bacteria | 939 |
| 191 | Ga0207709_10014048 | 3300025935 | Bacteria | 4421 |
| 192 | Ga0207709_10047347 | 3300025935 | Unclassified | 2613 |
| 193 | Ga0207670_10159804 | 3300025936 | Unclassified | 1681 |
| 194 | Ga0207670_10524995 | 3300025936 | Bacteria | 964 |
| 195 | Ga0207670_10565950 | 3300025936 | Bacteria | 930 |
| 196 | Ga0207704_10126683 | 3300025938 | Bacteria | 1760 |
| 197 | Ga0207704_10494613 | 3300025938 | Bacteria | 984 |
| 198 | Ga0207691_10078122 | 3300025940 | Bacteria | 2980 |
| 199 | Ga0207691_10287115 | 3300025940 | Bacteria | 1415 |
| 200 | Ga0207711_10014327 | 3300025941 | Bacteria | 6585 |
| 201 | Ga0207689_10000334 | 3300025942 | Bacteria | 43862 |
| 202 | Ga0207689_10195792 | 3300025942 | Bacteria | 1668 |
| 203 | Ga0207689_10217511 | 3300025942 | Bacteria | 1579 |
| 204 | Ga0207661_10515313 | 3300025944 | Bacteria | 1093 |
| 205 | Ga0207679_10485615 | 3300025945 | Bacteria | 1100 |
| 206 | Ga0207667_10237693 | 3300025949 | Bacteria | 1865 |
| 207 | Ga0207651_10039092 | 3300025960 | Bacteria | 3125 |
| 208 | Ga0207712_10203841 | 3300025961 | Bacteria | 1570 |
| 209 | Ga0207668_10002532 | 3300025972 | Bacteria | 10674 |
| 210 | Ga0207640_10325540 | 3300025981 | Bacteria | 1225 |
| 211 | Ga0207658_10008515 | 3300025986 | Bacteria | 6978 |
| 212 | Ga0207703_10000206 | 3300026035 | Bacteria | 68955 |
| 213 | Ga0207708_10154178 | 3300026075 | Bacteria | 1811 |
| 214 | Ga0207648_10002856 | 3300026089 | Bacteria | 18283 |
| 215 | Ga0207676_10002625 | 3300026095 | Bacteria | 12814 |
| 216 | Ga0207674_10006160 | 3300026116 | Bacteria | 14165 |
| 217 | Ga0207674_10010099 | 3300026116 | Bacteria | 10735 |
| 218 | Ga0207674_10359007 | 3300026116 | Bacteria | 1408 |
| 219 | Ga0207674_10591921 | 3300026116 | Unclassified | 1071 |
| 220 | Ga0207675_100002403 | 3300026118 | Bacteria | 18543 |
| 221 | Ga0207675_100541999 | 3300026118 | Bacteria | 1162 |
| 222 | Ga0207683_10005942 | 3300026121 | Bacteria | 10463 |
| 223 | Ga0207683_10465479 | 3300026121 | Bacteria | 1166 |
| 224 | Ga0207698_10284288 | 3300026142 | Bacteria | 1532 |
| 225 | Ga0207698_10507452 | 3300026142 | Bacteria | 1175 |
| 226 | Ga0207428_10001798 | 3300027907 | Bacteria | 21966 |
| 227 | Ga0207428_10002045 | 3300027907 | Bacteria | 20377 |
| 228 | Ga0207428_10003662 | 3300027907 | Bacteria | 14809 |
| 229 | Ga0207428_10099677 | 3300027907 | Bacteria | 2246 |
| 230 | Ga0268266_10346191 | 3300028379 | Bacteria | 1396 |
| 231 | Ga0268265_10046143 | 3300028380 | Bacteria | 3255 |
| 232 | Ga0268264_10001364 | 3300028381 | Bacteria | 22890 |
| 233 | Ga0307408_100130610 | 3300031548 | Bacteria | 1959 |
| 234 | Ga0316576_10043867 | 3300031727 | Unclassified | 3229 |
| 235 | Ga0316578_10036540 | 3300031728 | Bacteria | 2827 |
| 236 | Ga0316578_10129324 | 3300031728 | Bacteria | 1519 |
| 237 | Ga0307410_10055347 | 3300031852 | Unclassified | 2693 |
| 238 | Ga0307406_10012114 | 3300031901 | Bacteria | 4908 |
| 239 | Ga0307407_10038915 | 3300031903 | Unclassified | 2640 |
| 240 | Ga0307409_100000783 | 3300031995 | Bacteria | 14426 |
| 241 | Ga0307416_100033495 | 3300032002 | Bacteria | 3895 |
| 242 | Ga0307415_100000032 | 3300032126 | Bacteria | 59889 |
| 243 | Ga0307415_100104430 | 3300032126 | Unclassified | 2087 |
| 244 | Ga0316583_10069587 | 3300032133 | Bacteria | 1231 |
| 245 | Ga0316593_10033854 | 3300032168 | Bacteria | 1674 |
| 246 | Ga0316592_1028714 | 3300033524 | Bacteria | 1205 |
| 247 | Ga0316586_1018279 | 3300033527 | Bacteria | 1136 |
| 248 | Ga0316588_1033631 | 3300033528 | Bacteria | 1209 |
| 249 | Ga0316588_1073247 | 3300033528 | Unclassified | 843 |
| 250 | Ga0316596_1038222 | 3300033541 | Bacteria | 1257 |
| 251 | Ga0373953_0042152 | 3300035117 | Unclassified | 1818 |
| 252 | Ga0373956_0123303 | 3300035119 | Unclassified | 1211 |
| 253 | Ga0316574_0070572 | 3300035398 | Bacteria | 2206 |
| 254 | Ga0316574_0094671 | 3300035398 | Bacteria | 1908 |
| 255 | Ga0316574_0366311 | 3300035398 | Bacteria | 910 |
| 256 | Ga0373927_0129510 | 3300035695 | Unclassified | 1648 |
| 257 | Ga0316584_0003943 | 3300036712 | Bacteria | 9751 |
| 258 | Ga0316584_0053330 | 3300036712 | Unclassified | 3026 |
| 259 | Ga0316584_0182924 | 3300036712 | Bacteria | 1551 |
| 260 | Ga0373925_0063459 | 3300037068 | Bacteria | 2779 |
| 261 | Ga0395900_0291064 | 3300037418 | Bacteria | 1622 |
| 262 | Ga0395898_0038070 | 3300037466 | Bacteria | 4769 |
| 263 | Ga0400485_07613 | 3300038735 | Bacteria | 4342 |
| 264 | Ga0439441_032260 | 3300042001 | Bacteria | 1020 |
| 265 | Ga0451577_0005285 | 3300042876 | Bacteria | 13272 |
| 266 | Ga0451577_0715434 | 3300042876 | Unclassified | 906 |
| 267 | Ga0453683_0003060 | 3300044673 | Bacteria | 12524 |
| 268 | Ga0453683_0046325 | 3300044673 | Unclassified | 2726 |
| 269 | Ga0453683_0054601 | 3300044673 | Bacteria | 2500 |
| 270 | Ga0453683_0247861 | 3300044673 | Bacteria | 1135 |
| 271 | Ga0453683_0259141 | 3300044673 | Unclassified | 1109 |
| 272 | Ga0453684_0194350 | 3300044712 | Bacteria | 2371 |
| 273 | Ga0453684_0734966 | 3300044712 | Unclassified | 1069 |
| 274 | Ga0451576_0029480 | 3300045051 | Bacteria | 5871 |
| 275 | Ga0451576_0390408 | 3300045051 | Unclassified | 1459 |
| 276 | Ga0495665_0078715 | 3300046531 | Unclassified | 1734 |
| 277 | Ga0495656_0026868 | 3300046615 | Bacteria | 2295 |
| 278 | Ga0495647_0056331 | 3300046681 | Bacteria | 1541 |
| 279 | Ga0496101_0497912 | 3300048904 | Bacteria | 963 |
| 280 | Ga0496107_0270425 | 3300048910 | Bacteria | 1265 |
| 281 | Ga0496109_0009899 | 3300048912 | Bacteria | 8139 |
| 282 | Ga0496110_0454249 | 3300048913 | Bacteria | 1168 |
| 283 | Ga0496112_0032328 | 3300048915 | Bacteria | 5080 |
| 284 | Ga0496112_0179252 | 3300048915 | Bacteria | 2083 |
| 285 | Ga0496113_0005098 | 3300048916 | Bacteria | 8161 |
| 286 | Ga0501040_0352691 | 3300049576 | Bacteria | 1054 |
| 287 | Ga0501071_0049073 | 3300049587 | Bacteria | 3038 |
| 288 | Ga0501071_0777431 | 3300049587 | Bacteria | 738 |
| 289 | Ga0501075_0100395 | 3300049591 | Bacteria | 2198 |
| 290 | Ga0501230_019960 | 3300049667 | Bacteria | 1161 |
| 291 | Ga0501080_0551837 | 3300049742 | Unclassified | 1026 |
| 292 | nmdc:mga05p37_123208_c1 | 3300050507 | Unclassified | 3184 |
| 293 | nmdc:mga05p37_252463_c1 | 3300050507 | Bacteria | 2115 |
| 294 | nmdc:mga05p37_36335_c1 | 3300050507 | Bacteria | 6044 |
| 295 | nmdc:mga05p37_37448_c1 | 3300050507 | Bacteria | 5946 |
| 296 | nmdc:mga05p37_56372_c1 | 3300050507 | Unclassified | 4838 |
| 297 | nmdc:mga05p37_785_c1 | 3300050507 | Bacteria | 35316 |
| 298 | nmdc:mga09592_121851_c1 | 3300050508 | Bacteria | 2240 |
| 299 | nmdc:mga09592_123424_c1 | 3300050508 | Bacteria | 2225 |
| 300 | nmdc:mga09592_16849_c1 | 3300050508 | Bacteria | 5981 |
| 301 | nmdc:mga09592_21571_c1 | 3300050508 | Bacteria | 5308 |
| 302 | nmdc:mga09592_41003_c1 | 3300050508 | Bacteria | 3892 |
| 303 | nmdc:mga09592_42906_c1 | 3300050508 | Bacteria | 3805 |
| 304 | nmdc:mga09592_44241_c1 | 3300050508 | Bacteria | 3748 |
| 305 | nmdc:mga0qj67_15160_c1 | 3300050509 | Bacteria | 5832 |
| 306 | nmdc:mga0qj67_365217_c1 | 3300050509 | Bacteria | 1166 |
| 307 | nmdc:mga0qj67_6844_c1 | 3300050509 | Bacteria | 8381 |
| 308 | nmdc:mga0qj67_6965_c1 | 3300050509 | Bacteria | 8324 |
| 309 | nmdc:mga0qj67_7445_c1 | 3300050509 | Bacteria | 8085 |
| 310 | nmdc:mga06r32_138338_c1 | 3300050510 | Bacteria | 2410 |
| 311 | nmdc:mga06r32_170887_c1 | 3300050510 | Bacteria | 2158 |
| 312 | nmdc:mga06r32_260388_c1 | 3300050510 | Bacteria | 1722 |
| 313 | nmdc:mga06r32_291496_c1 | 3300050510 | Bacteria | 1619 |
| 314 | nmdc:mga06r32_3651_c1 | 3300050510 | Bacteria | 13750 |
| 315 | nmdc:mga06r32_3948_c2 | 3300050510 | Bacteria | 8202 |
| 316 | nmdc:mga06r32_539745_c1 | 3300050510 | Unclassified | 1141 |
| 317 | nmdc:mga06r32_91997_c1 | 3300050510 | Unclassified | 2965 |
| 318 | nmdc:mga06r32_94541_c1 | 3300050510 | Unclassified | 2924 |
| 319 | nmdc:mga08y16_114443_c1 | 3300050511 | Bacteria | 2808 |
| 320 | nmdc:mga08y16_14090_c1 | 3300050511 | Bacteria | 8417 |
| 321 | nmdc:mga08y16_2004_c1 | 3300050511 | Bacteria | 20828 |
| 322 | nmdc:mga08y16_27192_c1 | 3300050511 | Bacteria | 6027 |
| 323 | nmdc:mga08y16_724616_c1 | 3300050511 | Bacteria | 992 |
| 324 | nmdc:mga08y16_83_c1 | 3300050511 | Bacteria | 80182 |
| 325 | nmdc:mga0n895_28491_c1 | 3300050512 | Bacteria | 5312 |
| 326 | nmdc:mga0n895_30340_c1 | 3300050512 | Bacteria | 5166 |
| 327 | nmdc:mga0n895_54850_c1 | 3300050512 | Bacteria | 3921 |
| 328 | nmdc:mga0a205_43614_c1 | 3300050515 | Bacteria | 4324 |
| 329 | nmdc:mga0a205_49332_c1 | 3300050515 | Bacteria | 4063 |
| 330 | nmdc:mga0a205_848_c1 | 3300050515 | Bacteria | 25049 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049587 | Ga0501071_0777431 | Ga0501071_0777431_19_699 | 226 |
| 2 | 3300026116 | Ga0207674_10359007 | Ga0207674_103590072 | 235 |
| 3 | 3300006847 | Ga0075431_100030579 | Ga0075431_1000305794 | 243 |
| 4 | 3300025923 | Ga0207681_10578997 | Ga0207681_105789971 | 243 |
| 5 | 3300050510 | nmdc:mga06r32_3651_c1 | nmdc:mga06r32_3651_c1_2689_3534 | 243 |
| 6 | 3300005329 | Ga0070683_100373252 | Ga0070683_1003732522 | 244 |
| 7 | 3300005458 | Ga0070681_10065550 | Ga0070681_100655503 | 244 |
| 8 | 3300005530 | Ga0070679_100081618 | Ga0070679_1000816183 | 244 |
| 9 | 3300005577 | Ga0068857_100005781 | Ga0068857_1000057816 | 244 |
| 10 | 3300009551 | Ga0105238_10746730 | Ga0105238_107467301 | 244 |
| 11 | 3300014325 | Ga0163163_10041820 | Ga0163163_100418205 | 244 |
| 12 | 3300025912 | Ga0207707_10034603 | Ga0207707_100346036 | 244 |
| 13 | 3300025921 | Ga0207652_10668509 | Ga0207652_106685091 | 244 |
| 14 | 3300026116 | Ga0207674_10010099 | Ga0207674_100100998 | 244 |
| 15 | 3300009553 | Ga0105249_10343045 | Ga0105249_103430451 | 247 |
| 16 | 3300005333 | Ga0070677_10068163 | Ga0070677_100681631 | 248 |
| 17 | 3300005340 | Ga0070689_100078408 | Ga0070689_1000784082 | 248 |
| 18 | 3300005353 | Ga0070669_100402401 | Ga0070669_1004024011 | 248 |
| 19 | 3300005456 | Ga0070678_100058393 | Ga0070678_1000583931 | 248 |
| 20 | 3300025893 | Ga0207682_10071361 | Ga0207682_100713611 | 248 |
| 21 | 3300025923 | Ga0207681_10032922 | Ga0207681_100329221 | 248 |
| 22 | 3300025936 | Ga0207670_10159804 | Ga0207670_101598042 | 248 |
| 23 | 3300026121 | Ga0207683_10005942 | Ga0207683_100059421 | 248 |
| 24 | 3300028379 | Ga0268266_10346191 | Ga0268266_103461912 | 248 |
| 25 | 3300006846 | Ga0075430_100016886 | Ga0075430_1000168864 | 250 |
| 26 | 3300009094 | Ga0111539_10210378 | Ga0111539_102103782 | 250 |
| 27 | 3300009147 | Ga0114129_10355074 | Ga0114129_103550742 | 250 |
| 28 | 3300027907 | Ga0207428_10002045 | Ga0207428_1000204511 | 250 |
| 29 | 3300050508 | nmdc:mga09592_41003_c1 | nmdc:mga09592_41003_c1_355_1203 | 250 |
| 30 | 3300050509 | nmdc:mga0qj67_365217_c1 | nmdc:mga0qj67_365217_c1_186_986 | 250 |
| 31 | 3300050509 | nmdc:mga0qj67_6844_c1 | nmdc:mga0qj67_6844_c1_1291_2139 | 250 |
| 32 | 3300050510 | nmdc:mga06r32_291496_c1 | nmdc:mga06r32_291496_c1_355_1203 | 250 |
| 33 | 3300050511 | nmdc:mga08y16_27192_c1 | nmdc:mga08y16_27192_c1_597_1445 | 250 |
| 34 | 3300005441 | Ga0070700_100284965 | Ga0070700_1002849651 | 251 |
| 35 | 3300005844 | Ga0068862_100087757 | Ga0068862_1000877573 | 251 |
| 36 | 3300006847 | Ga0075431_100187788 | Ga0075431_1001877882 | 251 |
| 37 | 3300025961 | Ga0207712_10203841 | Ga0207712_102038412 | 251 |
| 38 | 3300026075 | Ga0207708_10154178 | Ga0207708_101541781 | 251 |
| 39 | 3300036712 | Ga0316584_0003943 | Ga0316584_0003943_794_1624 | 251 |
| 40 | 3300049591 | Ga0501075_0100395 | Ga0501075_0100395_601_1452 | 251 |
| 41 | 3300050507 | nmdc:mga05p37_123208_c1 | nmdc:mga05p37_123208_c1_1285_2082 | 251 |
| 42 | 3300050510 | nmdc:mga06r32_260388_c1 | nmdc:mga06r32_260388_c1_303_1100 | 251 |
| 43 | 3300048915 | Ga0496112_0032328 | Ga0496112_0032328_510_1361 | 252 |
| 44 | 3300005340 | Ga0070689_100438522 | Ga0070689_1004385222 | 253 |
| 45 | 3300025936 | Ga0207670_10524995 | Ga0207670_105249951 | 253 |
| 46 | 3300009147 | Ga0114129_10081196 | Ga0114129_100811963 | 255 |
| 47 | 3300044673 | Ga0453683_0054601 | Ga0453683_0054601_1719_2489 | 255 |
| 48 | 3300046531 | Ga0495665_0078715 | Ga0495665_0078715_165_974 | 255 |
| 49 | 3300035398 | Ga0316574_0070572 | Ga0316574_0070572_36_839 | 256 |
| 50 | 3300050511 | nmdc:mga08y16_724616_c1 | nmdc:mga08y16_724616_c1_107_883 | 256 |
| 51 | 3300006880 | Ga0075429_100016849 | Ga0075429_1000168493 | 257 |
| 52 | 3300006880 | Ga0075429_100222802 | Ga0075429_1002228022 | 257 |
| 53 | 3300027907 | Ga0207428_10003662 | Ga0207428_1000366213 | 257 |
| 54 | 3300044673 | Ga0453683_0259141 | Ga0453683_0259141_205_1017 | 257 |
| 55 | 3300050508 | nmdc:mga09592_121851_c1 | nmdc:mga09592_121851_c1_139_918 | 257 |
| 56 | 3300050511 | nmdc:mga08y16_2004_c1 | nmdc:mga08y16_2004_c1_6135_6914 | 257 |
| 57 | 3300033527 | Ga0316586_1018279 | Ga0316586_10182791 | 258 |
| 58 | 3300050512 | nmdc:mga0n895_30340_c1 | nmdc:mga0n895_30340_c1_791_1612 | 258 |
| 59 | 3300050515 | nmdc:mga0a205_848_c1 | nmdc:mga0a205_848_c1_12258_13079 | 258 |
| 60 | iso_pu_bacteria | 2818991458 | 2819668042 | 258 |
| 61 | 3300006358 | Ga0068871_100447456 | Ga0068871_1004474561 | 259 |
| 62 | 3300031727 | Ga0316576_10043867 | Ga0316576_100438673 | 259 |
| 63 | 3300031728 | Ga0316578_10129324 | Ga0316578_101293241 | 259 |
| 64 | 3300033524 | Ga0316592_1028714 | Ga0316592_10287141 | 259 |
| 65 | 3300033528 | Ga0316588_1033631 | Ga0316588_10336311 | 259 |
| 66 | 3300033541 | Ga0316596_1038222 | Ga0316596_10382221 | 259 |
| 67 | 3300036712 | Ga0316584_0053330 | Ga0316584_0053330_969_1790 | 259 |
| 68 | 3300044673 | Ga0453683_0003060 | Ga0453683_0003060_51_857 | 259 |
| 69 | 3300044673 | Ga0453683_0046325 | Ga0453683_0046325_640_1446 | 259 |
| 70 | 3300045051 | Ga0451576_0029480 | Ga0451576_0029480_2613_3419 | 259 |
| 71 | 3300045051 | Ga0451576_0390408 | Ga0451576_0390408_617_1423 | 259 |
| 72 | 3300025918 | Ga0207662_10406112 | Ga0207662_104061121 | 260 |
| 73 | 3300026116 | Ga0207674_10006160 | Ga0207674_1000616014 | 260 |
| 74 | iso_pu_bacteria | 2643221711 | 2644609836 | 260 |
| 75 | 3300006844 | Ga0075428_100063031 | Ga0075428_1000630313 | 261 |
| 76 | 3300006846 | Ga0075430_100006745 | Ga0075430_1000067458 | 261 |
| 77 | 3300006880 | Ga0075429_100037695 | Ga0075429_1000376954 | 261 |
| 78 | 3300009147 | Ga0114129_10436568 | Ga0114129_104365682 | 261 |
| 79 | 3300014326 | Ga0157380_10156671 | Ga0157380_101566712 | 261 |
| 80 | 3300042001 | Ga0439441_032260 | Ga0439441_032260_142_972 | 261 |
| 81 | 3300050507 | nmdc:mga05p37_252463_c1 | nmdc:mga05p37_252463_c1_1261_2049 | 261 |
| 82 | 3300050508 | nmdc:mga09592_44241_c1 | nmdc:mga09592_44241_c1_1716_2504 | 261 |
| 83 | 3300050509 | nmdc:mga0qj67_7445_c1 | nmdc:mga0qj67_7445_c1_620_1408 | 261 |
| 84 | 3300050510 | nmdc:mga06r32_170887_c1 | nmdc:mga06r32_170887_c1_719_1507 | 261 |
| 85 | iso_pu_bacteria | 2833709550 | 2833712706 | 261 |
| 86 | 3300005340 | Ga0070689_100304033 | Ga0070689_1003040331 | 262 |
| 87 | 3300005444 | Ga0070694_100011227 | Ga0070694_1000112272 | 262 |
| 88 | 3300005468 | Ga0070707_100024316 | Ga0070707_1000243162 | 262 |
| 89 | 3300005546 | Ga0070696_100031360 | Ga0070696_1000313602 | 262 |
| 90 | 3300005549 | Ga0070704_100358610 | Ga0070704_1003586102 | 262 |
| 91 | 3300006237 | Ga0097621_100048096 | Ga0097621_1000480962 | 262 |
| 92 | 3300006844 | Ga0075428_100003951 | Ga0075428_10000395112 | 262 |
| 93 | 3300006846 | Ga0075430_100046765 | Ga0075430_1000467654 | 262 |
| 94 | 3300006846 | Ga0075430_100097913 | Ga0075430_1000979132 | 262 |
| 95 | 3300006847 | Ga0075431_100011558 | Ga0075431_1000115588 | 262 |
| 96 | 3300006847 | Ga0075431_100194617 | Ga0075431_1001946172 | 262 |
| 97 | 3300006847 | Ga0075431_100195065 | Ga0075431_1001950652 | 262 |
| 98 | 3300006852 | Ga0075433_10124963 | Ga0075433_101249632 | 262 |
| 99 | 3300006880 | Ga0075429_100010227 | Ga0075429_1000102272 | 262 |
| 100 | 3300006880 | Ga0075429_100160617 | Ga0075429_1001606171 | 262 |
| 101 | 3300009094 | Ga0111539_10000040 | Ga0111539_1000004062 | 262 |
| 102 | 3300009094 | Ga0111539_10035179 | Ga0111539_100351794 | 262 |
| 103 | 3300009094 | Ga0111539_10085771 | Ga0111539_100857714 | 262 |
| 104 | 3300009147 | Ga0114129_10011532 | Ga0114129_100115322 | 262 |
| 105 | 3300009147 | Ga0114129_10244340 | Ga0114129_102443403 | 262 |
| 106 | 3300009147 | Ga0114129_10641559 | Ga0114129_106415591 | 262 |
| 107 | 3300027907 | Ga0207428_10001798 | Ga0207428_100017987 | 262 |
| 108 | 3300027907 | Ga0207428_10099677 | Ga0207428_100996774 | 262 |
| 109 | 3300033528 | Ga0316588_1073247 | Ga0316588_10732471 | 262 |
| 110 | 3300046615 | Ga0495656_0026868 | Ga0495656_0026868_491_1330 | 262 |
| 111 | 3300046681 | Ga0495647_0056331 | Ga0495647_0056331_357_1190 | 262 |
| 112 | 3300048913 | Ga0496110_0454249 | Ga0496110_0454249_139_927 | 262 |
| 113 | 3300050507 | nmdc:mga05p37_36335_c1 | nmdc:mga05p37_36335_c1_122_961 | 262 |
| 114 | 3300050509 | nmdc:mga0qj67_15160_c1 | nmdc:mga0qj67_15160_c1_2003_2839 | 262 |
| 115 | 3300050509 | nmdc:mga0qj67_6965_c1 | nmdc:mga0qj67_6965_c1_7153_7944 | 262 |
| 116 | 3300050510 | nmdc:mga06r32_138338_c1 | nmdc:mga06r32_138338_c1_1027_1863 | 262 |
| 117 | 3300050510 | nmdc:mga06r32_3948_c2 | nmdc:mga06r32_3948_c2_321_1112 | 262 |
| 118 | 3300050510 | nmdc:mga06r32_91997_c1 | nmdc:mga06r32_91997_c1_741_1577 | 262 |
| 119 | 3300050511 | nmdc:mga08y16_114443_c1 | nmdc:mga08y16_114443_c1_1000_1839 | 262 |
| 120 | 3300050511 | nmdc:mga08y16_83_c1 | nmdc:mga08y16_83_c1_36583_37419 | 262 |
| 121 | 3300003203 | JGI25406J46586_10009980 | JGI25406J46586_100099801 | 263 |
| 122 | 3300005334 | Ga0068869_100194873 | Ga0068869_1001948732 | 263 |
| 123 | 3300005353 | Ga0070669_100031209 | Ga0070669_1000312093 | 263 |
| 124 | 3300005985 | Ga0081539_10000596 | Ga0081539_1000059653 | 263 |
| 125 | 3300006852 | Ga0075433_10000267 | Ga0075433_100002673 | 263 |
| 126 | 3300025923 | Ga0207681_10033379 | Ga0207681_100333793 | 263 |
| 127 | 3300025942 | Ga0207689_10195792 | Ga0207689_101957922 | 263 |
| 128 | 3300031548 | Ga0307408_100130610 | Ga0307408_1001306102 | 263 |
| 129 | 3300031901 | Ga0307406_10012114 | Ga0307406_100121143 | 263 |
| 130 | 3300031903 | Ga0307407_10038915 | Ga0307407_100389151 | 263 |
| 131 | 3300031995 | Ga0307409_100000783 | Ga0307409_1000007835 | 263 |
| 132 | 3300032002 | Ga0307416_100033495 | Ga0307416_1000334952 | 263 |
| 133 | 3300032126 | Ga0307415_100000032 | Ga0307415_10000003249 | 263 |
| 134 | 3300035398 | Ga0316574_0366311 | Ga0316574_0366311_53_877 | 263 |
| 135 | 3300037418 | Ga0395900_0291064 | Ga0395900_0291064_193_984 | 263 |
| 136 | 3300037466 | Ga0395898_0038070 | Ga0395898_0038070_348_1139 | 263 |
| 137 | 3300048915 | Ga0496112_0179252 | Ga0496112_0179252_433_1224 | 263 |
| 138 | 3300048916 | Ga0496113_0005098 | Ga0496113_0005098_675_1466 | 263 |
| 139 | 3300050512 | nmdc:mga0n895_28491_c1 | nmdc:mga0n895_28491_c1_919_1746 | 263 |
| 140 | 3300050515 | nmdc:mga0a205_43614_c1 | nmdc:mga0a205_43614_c1_3231_4058 | 263 |
| 141 | 3300003578 | Ga0006562J51391_1132900 | Ga0006562J51391_11329002 | 264 |
| 142 | 3300005330 | Ga0070690_100156709 | Ga0070690_1001567092 | 264 |
| 143 | 3300005331 | Ga0070670_100005923 | Ga0070670_1000059238 | 264 |
| 144 | 3300005334 | Ga0068869_100000028 | Ga0068869_10000002827 | 264 |
| 145 | 3300005340 | Ga0070689_100521612 | Ga0070689_1005216121 | 264 |
| 146 | 3300005347 | Ga0070668_100011258 | Ga0070668_1000112585 | 264 |
| 147 | 3300005353 | Ga0070669_100083418 | Ga0070669_1000834182 | 264 |
| 148 | 3300005355 | Ga0070671_100262810 | Ga0070671_1002628102 | 264 |
| 149 | 3300005364 | Ga0070673_100079103 | Ga0070673_1000791032 | 264 |
| 150 | 3300005365 | Ga0070688_100271960 | Ga0070688_1002719602 | 264 |
| 151 | 3300005367 | Ga0070667_100001790 | Ga0070667_10000179014 | 264 |
| 152 | 3300005455 | Ga0070663_100107007 | Ga0070663_1001070073 | 264 |
| 153 | 3300005457 | Ga0070662_100037326 | Ga0070662_1000373264 | 264 |
| 154 | 3300005459 | Ga0068867_100031053 | Ga0068867_1000310532 | 264 |
| 155 | 3300005543 | Ga0070672_100061746 | Ga0070672_1000617463 | 264 |
| 156 | 3300005545 | Ga0070695_100220547 | Ga0070695_1002205472 | 264 |
| 157 | 3300005563 | Ga0068855_100112078 | Ga0068855_1001120784 | 264 |
| 158 | 3300005577 | Ga0068857_100062678 | Ga0068857_1000626783 | 264 |
| 159 | 3300005616 | Ga0068852_100533553 | Ga0068852_1005335532 | 264 |
| 160 | 3300005617 | Ga0068859_100000096 | Ga0068859_10000009637 | 264 |
| 161 | 3300005618 | Ga0068864_100000214 | Ga0068864_10000021429 | 264 |
| 162 | 3300005719 | Ga0068861_100001020 | Ga0068861_10000102012 | 264 |
| 163 | 3300005841 | Ga0068863_100002420 | Ga0068863_1000024207 | 264 |
| 164 | 3300005842 | Ga0068858_100003194 | Ga0068858_10000319414 | 264 |
| 165 | 3300005843 | Ga0068860_100000735 | Ga0068860_10000073515 | 264 |
| 166 | 3300005844 | Ga0068862_100003360 | Ga0068862_1000033607 | 264 |
| 167 | 3300006881 | Ga0068865_100123963 | Ga0068865_1001239633 | 264 |
| 168 | 3300006931 | Ga0097620_100000096 | Ga0097620_10000009637 | 264 |
| 169 | 3300009011 | Ga0105251_10097905 | Ga0105251_100979052 | 264 |
| 170 | 3300009098 | Ga0105245_10251907 | Ga0105245_102519073 | 264 |
| 171 | 3300009101 | Ga0105247_10029380 | Ga0105247_100293803 | 264 |
| 172 | 3300009148 | Ga0105243_10395553 | Ga0105243_103955531 | 264 |
| 173 | 3300009177 | Ga0105248_10012733 | Ga0105248_100127334 | 264 |
| 174 | 3300009553 | Ga0105249_10062373 | Ga0105249_100623734 | 264 |
| 175 | 3300011119 | Ga0105246_10050363 | Ga0105246_100503632 | 264 |
| 176 | 3300011119 | Ga0105246_10067506 | Ga0105246_100675063 | 264 |
| 177 | 3300013297 | Ga0157378_10024461 | Ga0157378_100244614 | 264 |
| 178 | 3300013297 | Ga0157378_10407452 | Ga0157378_104074522 | 264 |
| 179 | 3300013306 | Ga0163162_10137191 | Ga0163162_101371913 | 264 |
| 180 | 3300013308 | Ga0157375_10027356 | Ga0157375_100273563 | 264 |
| 181 | 3300013308 | Ga0157375_10602807 | Ga0157375_106028072 | 264 |
| 182 | 3300014325 | Ga0163163_10002637 | Ga0163163_100026377 | 264 |
| 183 | 3300025315 | Ga0207697_10050110 | Ga0207697_100501103 | 264 |
| 184 | 3300025900 | Ga0207710_10012999 | Ga0207710_100129993 | 264 |
| 185 | 3300025925 | Ga0207650_10007429 | Ga0207650_100074298 | 264 |
| 186 | 3300025927 | Ga0207687_10164630 | Ga0207687_101646303 | 264 |
| 187 | 3300025933 | Ga0207706_10036516 | Ga0207706_100365163 | 264 |
| 188 | 3300025936 | Ga0207670_10565950 | Ga0207670_105659501 | 264 |
| 189 | 3300025938 | Ga0207704_10126683 | Ga0207704_101266831 | 264 |
| 190 | 3300025940 | Ga0207691_10078122 | Ga0207691_100781222 | 264 |
| 191 | 3300025941 | Ga0207711_10014327 | Ga0207711_100143272 | 264 |
| 192 | 3300025942 | Ga0207689_10000334 | Ga0207689_1000033429 | 264 |
| 193 | 3300025960 | Ga0207651_10039092 | Ga0207651_100390921 | 264 |
| 194 | 3300025972 | Ga0207668_10002532 | Ga0207668_100025325 | 264 |
| 195 | 3300025986 | Ga0207658_10008515 | Ga0207658_100085153 | 264 |
| 196 | 3300026035 | Ga0207703_10000206 | Ga0207703_1000020646 | 264 |
| 197 | 3300026089 | Ga0207648_10002856 | Ga0207648_100028564 | 264 |
| 198 | 3300026095 | Ga0207676_10002625 | Ga0207676_1000262510 | 264 |
| 199 | 3300026118 | Ga0207675_100002403 | Ga0207675_1000024035 | 264 |
| 200 | 3300026142 | Ga0207698_10284288 | Ga0207698_102842882 | 264 |
| 201 | 3300028380 | Ga0268265_10046143 | Ga0268265_100461434 | 264 |
| 202 | 3300028381 | Ga0268264_10001364 | Ga0268264_1000136423 | 264 |
| 203 | 3300032133 | Ga0316583_10069587 | Ga0316583_100695872 | 264 |
| 204 | 3300042876 | Ga0451577_0005285 | Ga0451577_0005285_11283_12095 | 264 |
| 205 | 3300042876 | Ga0451577_0715434 | Ga0451577_0715434_90_893 | 264 |
| 206 | 3300044712 | Ga0453684_0194350 | Ga0453684_0194350_943_1755 | 264 |
| 207 | 3300044712 | Ga0453684_0734966 | Ga0453684_0734966_225_1028 | 264 |
| 208 | 3300048910 | Ga0496107_0270425 | Ga0496107_0270425_48_881 | 264 |
| 209 | 3300048912 | Ga0496109_0009899 | Ga0496109_0009899_259_1092 | 264 |
| 210 | 3300002075 | JGI24738J21930_10017077 | JGI24738J21930_100170771 | 265 |
| 211 | 3300005329 | Ga0070683_100151790 | Ga0070683_1001517903 | 265 |
| 212 | 3300005330 | Ga0070690_100220651 | Ga0070690_1002206512 | 265 |
| 213 | 3300005334 | Ga0068869_100239973 | Ga0068869_1002399731 | 265 |
| 214 | 3300005334 | Ga0068869_100610080 | Ga0068869_1006100801 | 265 |
| 215 | 3300005336 | Ga0070680_100430092 | Ga0070680_1004300921 | 265 |
| 216 | 3300005337 | Ga0070682_100191419 | Ga0070682_1001914191 | 265 |
| 217 | 3300005339 | Ga0070660_100201914 | Ga0070660_1002019142 | 265 |
| 218 | 3300005344 | Ga0070661_100391327 | Ga0070661_1003913271 | 265 |
| 219 | 3300005345 | Ga0070692_10083159 | Ga0070692_100831591 | 265 |
| 220 | 3300005366 | Ga0070659_100451430 | Ga0070659_1004514301 | 265 |
| 221 | 3300005455 | Ga0070663_100017434 | Ga0070663_1000174345 | 265 |
| 222 | 3300005459 | Ga0068867_100619042 | Ga0068867_1006190421 | 265 |
| 223 | 3300005471 | Ga0070698_100523663 | Ga0070698_1005236632 | 265 |
| 224 | 3300005535 | Ga0070684_100023758 | Ga0070684_1000237583 | 265 |
| 225 | 3300005543 | Ga0070672_100251554 | Ga0070672_1002515543 | 265 |
| 226 | 3300005547 | Ga0070693_100277200 | Ga0070693_1002772001 | 265 |
| 227 | 3300005563 | Ga0068855_100315928 | Ga0068855_1003159283 | 265 |
| 228 | 3300005578 | Ga0068854_100393815 | Ga0068854_1003938152 | 265 |
| 229 | 3300005614 | Ga0068856_100648497 | Ga0068856_1006484972 | 265 |
| 230 | 3300005616 | Ga0068852_100016361 | Ga0068852_1000163614 | 265 |
| 231 | 3300005719 | Ga0068861_100120852 | Ga0068861_1001208524 | 265 |
| 232 | 3300005840 | Ga0068870_10040098 | Ga0068870_100400983 | 265 |
| 233 | 3300005842 | Ga0068858_100268888 | Ga0068858_1002688881 | 265 |
| 234 | 3300006881 | Ga0068865_100173272 | Ga0068865_1001732723 | 265 |
| 235 | 3300009098 | Ga0105245_10069455 | Ga0105245_100694554 | 265 |
| 236 | 3300009098 | Ga0105245_10071892 | Ga0105245_100718921 | 265 |
| 237 | 3300009148 | Ga0105243_10327262 | Ga0105243_103272623 | 265 |
| 238 | 3300009176 | Ga0105242_10566930 | Ga0105242_105669301 | 265 |
| 239 | 3300009551 | Ga0105238_10543877 | Ga0105238_105438772 | 265 |
| 240 | 3300011119 | Ga0105246_10131342 | Ga0105246_101313424 | 265 |
| 241 | 3300013307 | Ga0157372_10679164 | Ga0157372_106791642 | 265 |
| 242 | 3300025908 | Ga0207643_10060271 | Ga0207643_100602712 | 265 |
| 243 | 3300025921 | Ga0207652_10276924 | Ga0207652_102769242 | 265 |
| 244 | 3300025927 | Ga0207687_10023470 | Ga0207687_100234704 | 265 |
| 245 | 3300025933 | Ga0207706_10607951 | Ga0207706_106079511 | 265 |
| 246 | 3300025935 | Ga0207709_10014048 | Ga0207709_100140482 | 265 |
| 247 | 3300025938 | Ga0207704_10494613 | Ga0207704_104946131 | 265 |
| 248 | 3300025940 | Ga0207691_10287115 | Ga0207691_102871152 | 265 |
| 249 | 3300025944 | Ga0207661_10515313 | Ga0207661_105153132 | 265 |
| 250 | 3300025945 | Ga0207679_10485615 | Ga0207679_104856151 | 265 |
| 251 | 3300025949 | Ga0207667_10237693 | Ga0207667_102376931 | 265 |
| 252 | 3300025981 | Ga0207640_10325540 | Ga0207640_103255402 | 265 |
| 253 | 3300026116 | Ga0207674_10591921 | Ga0207674_105919212 | 265 |
| 254 | 3300026118 | Ga0207675_100541999 | Ga0207675_1005419992 | 265 |
| 255 | 3300026121 | Ga0207683_10465479 | Ga0207683_104654792 | 265 |
| 256 | 3300026142 | Ga0207698_10507452 | Ga0207698_105074522 | 265 |
| 257 | 3300035695 | Ga0373927_0129510 | Ga0373927_0129510_619_1419 | 265 |
| 258 | 3300037068 | Ga0373925_0063459 | Ga0373925_0063459_685_1485 | 265 |
| 259 | 3300048904 | Ga0496101_0497912 | Ga0496101_0497912_56_853 | 265 |
| 260 | 3300050510 | nmdc:mga06r32_94541_c1 | nmdc:mga06r32_94541_c1_71_976 | 265 |
| 261 | 3300050511 | nmdc:mga08y16_14090_c1 | nmdc:mga08y16_14090_c1_7587_8384 | 265 |
| 262 | 3300005295 | Ga0065707_10089189 | Ga0065707_100891894 | 266 |
| 263 | 3300005295 | Ga0065707_10228287 | Ga0065707_102282872 | 266 |
| 264 | 3300005345 | Ga0070692_10032679 | Ga0070692_100326792 | 266 |
| 265 | 3300005353 | Ga0070669_100577114 | Ga0070669_1005771141 | 266 |
| 266 | 3300005406 | Ga0070703_10018916 | Ga0070703_100189161 | 266 |
| 267 | 3300005438 | Ga0070701_10236766 | Ga0070701_102367662 | 266 |
| 268 | 3300005444 | Ga0070694_100428417 | Ga0070694_1004284171 | 266 |
| 269 | 3300005445 | Ga0070708_100001354 | Ga0070708_10000135410 | 266 |
| 270 | 3300005467 | Ga0070706_100179119 | Ga0070706_1001791192 | 266 |
| 271 | 3300005468 | Ga0070707_100179831 | Ga0070707_1001798312 | 266 |
| 272 | 3300005471 | Ga0070698_100030199 | Ga0070698_1000301994 | 266 |
| 273 | 3300005536 | Ga0070697_100195898 | Ga0070697_1001958981 | 266 |
| 274 | 3300005536 | Ga0070697_100256363 | Ga0070697_1002563632 | 266 |
| 275 | 3300005545 | Ga0070695_100043827 | Ga0070695_1000438273 | 266 |
| 276 | 3300005549 | Ga0070704_100045989 | Ga0070704_1000459892 | 266 |
| 277 | 3300006844 | Ga0075428_100112019 | Ga0075428_1001120192 | 266 |
| 278 | 3300006844 | Ga0075428_100112019 | Ga0075428_1001120193 | 266 |
| 279 | 3300006844 | Ga0075428_100448597 | Ga0075428_1004485972 | 266 |
| 280 | 3300006846 | Ga0075430_100109517 | Ga0075430_1001095172 | 266 |
| 281 | 3300006871 | Ga0075434_100398451 | Ga0075434_1003984512 | 266 |
| 282 | 3300006880 | Ga0075429_100163366 | Ga0075429_1001633662 | 266 |
| 283 | 3300009147 | Ga0114129_10023422 | Ga0114129_100234228 | 266 |
| 284 | 3300009147 | Ga0114129_10053340 | Ga0114129_100533402 | 266 |
| 285 | 3300009147 | Ga0114129_10053340 | Ga0114129_100533403 | 266 |
| 286 | 3300009148 | Ga0105243_10157754 | Ga0105243_101577541 | 266 |
| 287 | 3300025885 | Ga0207653_10000317 | Ga0207653_1000031730 | 266 |
| 288 | 3300025910 | Ga0207684_10057784 | Ga0207684_100577842 | 266 |
| 289 | 3300025935 | Ga0207709_10047347 | Ga0207709_100473472 | 266 |
| 290 | 3300031728 | Ga0316578_10036540 | Ga0316578_100365402 | 266 |
| 291 | 3300044673 | Ga0453683_0247861 | Ga0453683_0247861_15_824 | 266 |
| 292 | 3300049587 | Ga0501071_0049073 | Ga0501071_0049073_1953_2753 | 266 |
| 293 | 3300049742 | Ga0501080_0551837 | Ga0501080_0551837_75_875 | 266 |
| 294 | 3300050507 | nmdc:mga05p37_37448_c1 | nmdc:mga05p37_37448_c1_2105_2950 | 266 |
| 295 | 3300050507 | nmdc:mga05p37_37448_c1 | nmdc:mga05p37_37448_c1_992_1795 | 266 |
| 296 | 3300050507 | nmdc:mga05p37_56372_c1 | nmdc:mga05p37_56372_c1_246_1049 | 266 |
| 297 | 3300050508 | nmdc:mga09592_123424_c1 | nmdc:mga09592_123424_c1_368_1222 | 266 |
| 298 | 3300050508 | nmdc:mga09592_42906_c1 | nmdc:mga09592_42906_c1_1771_2574 | 266 |
| 299 | 3300050508 | nmdc:mga09592_42906_c1 | nmdc:mga09592_42906_c1_2884_3729 | 266 |
| 300 | 3300050510 | nmdc:mga06r32_539745_c1 | nmdc:mga06r32_539745_c1_190_1044 | 266 |
| 301 | 3300050512 | nmdc:mga0n895_54850_c1 | nmdc:mga0n895_54850_c1_1776_2591 | 266 |
| 302 | 3300005334 | Ga0068869_100090510 | Ga0068869_1000905102 | 267 |
| 303 | 3300025942 | Ga0207689_10217511 | Ga0207689_102175112 | 267 |
| 304 | 3300035117 | Ga0373953_0042152 | Ga0373953_0042152_446_1279 | 267 |
| 305 | 3300035119 | Ga0373956_0123303 | Ga0373956_0123303_142_975 | 267 |
| 306 | 3300005333 | Ga0070677_10084574 | Ga0070677_100845741 | 268 |
| 307 | 3300005577 | Ga0068857_100576012 | Ga0068857_1005760121 | 268 |
| 308 | 3300005985 | Ga0081539_10066619 | Ga0081539_100666192 | 268 |
| 309 | 3300006844 | Ga0075428_100096644 | Ga0075428_1000966442 | 268 |
| 310 | 3300006880 | Ga0075429_100002122 | Ga0075429_10000212211 | 268 |
| 311 | 3300006880 | Ga0075429_100111338 | Ga0075429_1001113381 | 268 |
| 312 | 3300009147 | Ga0114129_10001121 | Ga0114129_1000112131 | 268 |
| 313 | 3300031852 | Ga0307410_10055347 | Ga0307410_100553472 | 268 |
| 314 | 3300032126 | Ga0307415_100104430 | Ga0307415_1001044301 | 268 |
| 315 | 3300032168 | Ga0316593_10033854 | Ga0316593_100338543 | 268 |
| 316 | 3300035398 | Ga0316574_0094671 | Ga0316574_0094671_901_1716 | 268 |
| 317 | 3300036712 | Ga0316584_0182924 | Ga0316584_0182924_219_1034 | 268 |
| 318 | 3300038735 | Ga0400485_07613 | Ga0400485_07613_735_1559 | 268 |
| 319 | 3300049667 | Ga0501230_019960 | Ga0501230_019960_119_925 | 268 |
| 320 | 3300050507 | nmdc:mga05p37_785_c1 | nmdc:mga05p37_785_c1_6200_7006 | 268 |
| 321 | 3300050508 | nmdc:mga09592_16849_c1 | nmdc:mga09592_16849_c1_863_1669 | 268 |
| 322 | 3300050508 | nmdc:mga09592_21571_c1 | nmdc:mga09592_21571_c1_3021_3827 | 268 |
| 323 | 3300005444 | Ga0070694_100085037 | Ga0070694_1000850372 | 269 |
| 324 | 3300009147 | Ga0114129_10343414 | Ga0114129_103434142 | 269 |
| 325 | 3300009147 | Ga0114129_10965125 | Ga0114129_109651251 | 269 |
| 326 | 3300049576 | Ga0501040_0352691 | Ga0501040_0352691_190_1005 | 269 |
| 327 | 2162886012 | MBSR1b_contig_9553136 | MBSR1b_0272.00006110 | 271 |
| 328 | 3300005343 | Ga0070687_100109946 | Ga0070687_1001099461 | 271 |
| 329 | 3300005345 | Ga0070692_10017278 | Ga0070692_100172783 | 271 |
| 330 | 3300005406 | Ga0070703_10013762 | Ga0070703_100137622 | 271 |
| 331 | 3300005444 | Ga0070694_100041097 | Ga0070694_1000410972 | 271 |
| 332 | 3300005545 | Ga0070695_100022759 | Ga0070695_1000227592 | 271 |
| 333 | 3300005549 | Ga0070704_100133080 | Ga0070704_1001330802 | 271 |
| 334 | 3300006852 | Ga0075433_10124579 | Ga0075433_101245792 | 271 |
| 335 | 3300025885 | Ga0207653_10023233 | Ga0207653_100232332 | 271 |
| 336 | 3300025918 | Ga0207662_10107354 | Ga0207662_101073542 | 271 |
| 337 | 3300050515 | nmdc:mga0a205_49332_c1 | nmdc:mga0a205_49332_c1_527_1342 | 271 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4afz-assembly2.cif.gz_B | human chymase - fynomer complex | 0.7674 | 28 | 269 |
| 1fuj-assembly1.cif.gz_D | pr3 (myeloblastin) | 0.766 | 25 | 266 |
| 1fi8-assembly1.cif.gz_A | rat granzyme b [n66q] complexed to ecotin [81-84 iepd] | 0.766 | 36 | 267 |
| 1fi8-assembly1.cif.gz_B | rat granzyme b [n66q] complexed to ecotin [81-84 iepd] | 0.7644 | 36 | 267 |
| 4niv-assembly1.cif.gz_A | crystal structure of trypsiligase (k60e/n143h/y151h/d189k trypsin) trigonal form | 0.7607 | 29 | 269 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P17207_42_140_2.40.10.10 | Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases | 0.79 | 26 | 136 | 2.40.10.10 |
| af_P17207_42_140_2.40.10.10 | Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases | 0.7829 | 26 | 136 | 2.40.10.10 |
| af_Q9VRS6_31_271_2.40.10.10 | Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases | 0.7768 | 25 | 268 | 2.40.10.10 |
| af_P32822_32_130_2.40.10.10 | Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases | 0.7755 | 36 | 141 | 2.40.10.10 |
| af_G3V8K8_195_280_2.40.10.10 | Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases | 0.7736 | 36 | 134 | 2.40.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S1YI27-F1-model_v4 | Peptidase S1 domain-containing protein | 0.9036 | 33 | 80 |
GO:0004252
GO:0006508 |
| AF-A0A7J9Y0U8-F1-model_v4 | Trypsin-like serine protease | 0.8879 | 19 | 270 |
GO:0004252
GO:0006508 |
| AF-A0A511R174-F1-model_v4 | Peptidase S1 domain-containing protein | 0.8765 | 79 | 266 |
GO:0004252
GO:0006508 |
| AF-A0A2V7L301-F1-model_v4 | Serine protease | 0.8677 | 25 | 266 |
GO:0004252
GO:0006508 |
| AF-A0A6J4VVH0-F1-model_v4 | Peptidase S1 domain-containing protein | 0.8634 | 19 | 267 |
GO:0004252
GO:0006508 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar