F413251

General Info

Members Datasets Scaffolds Average Seq Length
337 212 320 370

Family's Representative Sequence

Representative Sequence 3300049579|Ga0501043_0045984|Ga0501043_0045984_1193_2440
Length 415
Sequence MGEPPEDRAAAGNMPARPDGEMVPERYRLRKPKRNIECVSLRFFWEVVMRAWRTLLLVPAVLLTGAAAPPRPYTDADFARIPKLDAHVHANVDDPSFLALARRDGFELLSINVDYPDFPPLATQAAVAYKMRARDPRRFHFATTFSMKGFGAPGWTARAEREVDEGLRHGAVAVKVWKNIGMVARDAAGKRVFLDDPRFDPIMAHIQSRGIPLIAHQGEPKNCWLPLDQMTTDNDRSYFREHPEYYMFKHPEEPSYEALMAARDRFVARHPHLAFDGAHMASLEWSVDELARFLDRYPNAVVDLAARMTQVQFQSNADHAKVRAFFVKYQDRLMYGTDLTDSPPDPGARAQNPPATGLFTKEADDVWRSDWRYLATPLSQHIDAIKADAPGLALPRGVIDKIYYANARRFFHLKG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
5 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
6 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
7 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
8 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
9 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
10 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
11 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
12 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
13 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
14 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
15 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
16 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
17 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
21 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
86 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
150 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
151 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
154 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
155 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
161 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
162 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
163 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
164 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
165 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
166 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
176 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
177 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
188 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
191 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
211 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
212 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.96
Metatranscriptomes 0
Isolates 5.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.23
Nodule 0
Rhizoplane 4.45
Rhizosphere 71.22
Stem 0
Stem Tuber 0
Unclassified 18.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3608852 2162886007 Bacteria 6151
2 JGI24737J22298_10033805 3300001990 Bacteria 1587
3 JGI24735J21928_10011579 3300002067 Bacteria 2794
4 JGI25152J39213_1000029 3300002773 Bacteria 100162
5 JGI25150J39212_1000032 3300002774 Bacteria 99615
6 JGI25151J46595_10000010 3300003187 Bacteria 277507
7 JGI25153J46596_10000013 3300003215 Bacteria 303690
8 rootH1_10147825 3300003316 Unclassified 1888
9 Ga0055536_1001758 3300003781 Bacteria 12774
10 Ga0055531_10006307 3300003794 Bacteria 6754
11 Ga0055531_10010771 3300003794 Bacteria 4501
12 Ga0065165_1000284 3300005262 Bacteria 86057
13 Ga0065704_10071772 3300005289 Bacteria 9976
14 Ga0070658_10159754 3300005327 Bacteria 1890
15 Ga0070690_100096553 3300005330 Unclassified 1953
16 Ga0070670_100000304 3300005331 Bacteria 42358
17 Ga0070666_10054791 3300005335 Bacteria 2690
18 Ga0070682_100003132 3300005337 Bacteria 9166
19 Ga0070682_100009514 3300005337 Bacteria 5499
20 Ga0070682_100031293 3300005337 Bacteria 3217
21 Ga0070660_100002271 3300005339 Bacteria 13204
22 Ga0070661_100042944 3300005344 Bacteria 3302
23 Ga0070661_100172591 3300005344 Bacteria 1642
24 Ga0070675_100213325 3300005354 Bacteria 1679
25 Ga0070671_100058536 3300005355 Unclassified 3207
26 Ga0070659_100182768 3300005366 Bacteria 1721
27 Ga0070667_100028075 3300005367 Unclassified 4683
28 Ga0070711_100045626 3300005439 Bacteria 2982
29 Ga0070685_10078222 3300005466 Bacteria 1977
30 Ga0070686_100013812 3300005544 Unclassified 4635
31 Ga0070665_100017153 3300005548 Bacteria 7265
32 Ga0070665_100025610 3300005548 Bacteria 5942
33 Ga0070665_100118321 3300005548 Bacteria 2652
34 Ga0070665_100139681 3300005548 Bacteria 2426
35 Ga0070665_100328218 3300005548 Bacteria 1534
36 Ga0068855_100050774 3300005563 Bacteria 4886
37 Ga0070664_100080992 3300005564 Bacteria 2797
38 Ga0068857_100097417 3300005577 Bacteria 2637
39 Ga0068854_100015172 3300005578 Bacteria 5098
40 Ga0068856_100025702 3300005614 Bacteria 5741
41 Ga0070702_100085701 3300005615 Bacteria 1898
42 Ga0068859_100000255 3300005617 Bacteria 52872
43 Ga0068859_100063679 3300005617 Bacteria 3719
44 Ga0068863_100011117 3300005841 Bacteria 8728
45 Ga0068863_100121845 3300005841 Bacteria 2487
46 Ga0068863_100168580 3300005841 Unclassified 2100
47 Ga0068858_100005639 3300005842 Bacteria 12244
48 Ga0068858_100047974 3300005842 Bacteria 3958
49 Ga0068860_100002826 3300005843 Bacteria 18060
50 Ga0068860_100061792 3300005843 Bacteria 3559
51 Ga0068862_100028894 3300005844 Unclassified 4671
52 Ga0068862_100096734 3300005844 Bacteria 2577
53 Ga0068862_100299972 3300005844 Bacteria 1478
54 Ga0097621_100101067 3300006237 Bacteria 2426
55 Ga0068871_100013690 3300006358 Bacteria 6028
56 Ga0068871_100041378 3300006358 Bacteria 3695
57 Ga0068865_100056514 3300006881 Bacteria 2734
58 Ga0068865_100070237 3300006881 Bacteria 2481
59 Ga0097620_100000255 3300006931 Bacteria 52872
60 Ga0097620_100063682 3300006931 Bacteria 3719
61 Ga0105251_10000866 3300009011 Bacteria 27126
62 Ga0105250_10060541 3300009092 Unclassified 1521
63 Ga0105240_10000630 3300009093 Bacteria 65019
64 Ga0105240_10003693 3300009093 Bacteria 23672
65 Ga0105240_10070564 3300009093 Unclassified 4321
66 Ga0105240_10546843 3300009093 Bacteria 1282
67 Ga0105247_10001084 3300009101 Bacteria 20303
68 Ga0105247_10058278 3300009101 Bacteria 2389
69 Ga0105243_10125904 3300009148 Bacteria 2167
70 Ga0105241_10072890 3300009174 Bacteria 2670
71 Ga0105242_10033833 3300009176 Bacteria 4095
72 Ga0105248_10009825 3300009177 Bacteria 10540
73 Ga0105248_10032406 3300009177 Bacteria 5840
74 Ga0105248_10310262 3300009177 Unclassified 1777
75 Ga0105237_10002242 3300009545 Bacteria 24086
76 Ga0105237_10006630 3300009545 Bacteria 12794
77 Ga0105237_10019210 3300009545 Bacteria 7061
78 Ga0105237_10021026 3300009545 Bacteria 6716
79 Ga0105237_10069674 3300009545 Bacteria 3513
80 Ga0105237_10493900 3300009545 Bacteria 1230
81 Ga0105238_10100673 3300009551 Bacteria 2873
82 Ga0105238_10163607 3300009551 Bacteria 2201
83 Ga0105238_10357182 3300009551 Unclassified 1450
84 Ga0105238_10473146 3300009551 Bacteria 1252
85 Ga0105249_10115727 3300009553 Bacteria 2541
86 Ga0105249_10339590 3300009553 Bacteria 1518
87 Ga0105239_10000633 3300010375 Bacteria 50164
88 Ga0105239_10085281 3300010375 Bacteria 3480
89 Ga0105239_10438464 3300010375 Unclassified 1481
90 Ga0157373_10007064 3300013100 Bacteria 8370
91 Ga0157371_10061059 3300013102 Bacteria 2673
92 Ga0157370_10040159 3300013104 Bacteria 4518
93 Ga0157369_10073302 3300013105 Bacteria 3673
94 Ga0157374_10258839 3300013296 Bacteria 1713
95 Ga0157378_10019114 3300013297 Bacteria 6020
96 Ga0163162_10079127 3300013306 Unclassified 3353
97 Ga0163162_10229277 3300013306 Unclassified 1987
98 Ga0157372_10083670 3300013307 Bacteria 3614
99 Ga0157372_10238642 3300013307 Bacteria 2109
100 Ga0157375_10017071 3300013308 Bacteria 6541
101 Ga0163163_10020656 3300014325 Bacteria 6206
102 Ga0163163_10064446 3300014325 Bacteria 3636
103 Ga0157380_10006829 3300014326 Bacteria 8066
104 Ga0182008_10008177 3300014497 Bacteria 5725
105 Ga0157379_10007231 3300014968 Bacteria 9604
106 Ga0157379_10049562 3300014968 Bacteria 3750
107 Ga0157379_10171141 3300014968 Unclassified 1961
108 Ga0182007_10002735 3300015262 Bacteria 8620
109 Ga0213871_10002628 3300021441 Bacteria 3332
110 Ga0209563_100030 3300025230 Bacteria 489259
111 Ga0207425_1000015 3300025245 Bacteria 466368
112 Ga0209129_1000126 3300025258 Bacteria 133335
113 Ga0209233_1010946 3300025261 Bacteria 2691
114 Ga0209676_1000035 3300025292 Bacteria 459284
115 Ga0209025_1000002 3300025294 Bacteria 1393142
116 Ga0209758_1000003 3300025297 Bacteria 1398533
117 Ga0209257_1000121 3300025304 Bacteria 222588
118 Ga0209257_1000197 3300025304 Bacteria 149491
119 Ga0207696_1047288 3300025711 Unclassified 1240
120 Ga0207713_1001692 3300025735 Bacteria 17054
121 Ga0207692_10119732 3300025898 Bacteria 1472
122 Ga0207710_10000118 3300025900 Bacteria 97453
123 Ga0207710_10054083 3300025900 Bacteria 1807
124 Ga0207647_10001672 3300025904 Bacteria 17077
125 Ga0207647_10054267 3300025904 Bacteria 2466
126 Ga0207685_10012518 3300025905 Bacteria 2592
127 Ga0207705_10067671 3300025909 Bacteria 2585
128 Ga0207695_10001494 3300025913 Bacteria 39002
129 Ga0207695_10013660 3300025913 Bacteria 9668
130 Ga0207695_10149288 3300025913 Unclassified 2278
131 Ga0207695_10193810 3300025913 Bacteria 1949
132 Ga0207671_10003529 3300025914 Bacteria 15504
133 Ga0207671_10229829 3300025914 Bacteria 1455
134 Ga0207693_10003494 3300025915 Bacteria 13412
135 Ga0207657_10005483 3300025919 Bacteria 13248
136 Ga0207657_10010315 3300025919 Bacteria 9328
137 Ga0207694_10019925 3300025924 Bacteria 5075
138 Ga0207694_10236383 3300025924 Bacteria 1493
139 Ga0207650_10001679 3300025925 Bacteria 15723
140 Ga0207650_10099515 3300025925 Bacteria 2235
141 Ga0207659_10251305 3300025926 Bacteria 1435
142 Ga0207664_10000068 3300025929 Bacteria 107432
143 Ga0207644_10009619 3300025931 Bacteria 6348
144 Ga0207644_10053855 3300025931 Bacteria 2896
145 Ga0207690_10001073 3300025932 Bacteria 17491
146 Ga0207690_10001680 3300025932 Bacteria 13637
147 Ga0207706_10010478 3300025933 Bacteria 8471
148 Ga0207686_10034375 3300025934 Bacteria 3034
149 Ga0207704_10022158 3300025938 Bacteria 3398
150 Ga0207704_10060945 3300025938 Unclassified 2337
151 Ga0207691_10027961 3300025940 Bacteria 5283
152 Ga0207711_10019383 3300025941 Bacteria 5665
153 Ga0207711_10055201 3300025941 Bacteria 3411
154 Ga0207679_10108188 3300025945 Bacteria 2189
155 Ga0207667_10018588 3300025949 Bacteria 7789
156 Ga0207667_10032641 3300025949 Bacteria 5607
157 Ga0207667_10100273 3300025949 Bacteria 2987
158 Ga0207712_10189222 3300025961 Unclassified 1623
159 Ga0207640_10020340 3300025981 Bacteria 3939
160 Ga0207703_10000833 3300026035 Bacteria 30345
161 Ga0207703_10002148 3300026035 Bacteria 17332
162 Ga0207678_10033472 3300026067 Bacteria 4476
163 Ga0207678_10209392 3300026067 Bacteria 1668
164 Ga0207708_10078139 3300026075 Bacteria 2541
165 Ga0207641_10000880 3300026088 Bacteria 31415
166 Ga0207641_10290269 3300026088 Unclassified 1541
167 Ga0207648_10164634 3300026089 Bacteria 1959
168 Ga0207674_10010358 3300026116 Bacteria 10566
169 Ga0207683_10001839 3300026121 Bacteria 18749
170 Ga0268266_10000036 3300028379 Bacteria 348910
171 Ga0268266_10118870 3300028379 Bacteria 2350
172 Ga0268266_10144134 3300028379 Bacteria 2140
173 Ga0268266_10209399 3300028379 Bacteria 1787
174 Ga0268265_10126526 3300028380 Bacteria 2116
175 Ga0268265_10412784 3300028380 Bacteria 1251
176 Ga0268264_10000100 3300028381 Bacteria 227852
177 Ga0268264_10083384 3300028381 Bacteria 2738
178 Ga0316182_1406383 3300030745 Bacteria 1507
179 Ga0307513_10036018 3300031456 Bacteria 5530
180 Ga0307513_10074639 3300031456 Bacteria 3525
181 Ga0307410_10176188 3300031852 Bacteria 1615
182 Ga0307406_10001036 3300031901 Bacteria 15502
183 Ga0307407_10026730 3300031903 Bacteria 3060
184 Ga0307409_100164347 3300031995 Bacteria 1945
185 Ga0307414_10007137 3300032004 Bacteria 6272
186 Ga0307414_10125424 3300032004 Bacteria 1982
187 Ga0307510_10000001 3300033180 Bacteria 1172244
188 Ga0307510_10006124 3300033180 Bacteria 14334
189 Ga0373946_0037090 3300035171 Unclassified 1980
190 Ga0373937_0002206 3300036401 Bacteria 16281
191 Ga0373937_0015783 3300036401 Bacteria 6692
192 Ga0395900_0003323 3300037418 Bacteria 17387
193 Ga0395898_0280057 3300037466 Bacteria 1591
194 Ga0395905_0040615 3300037471 Bacteria 4365
195 Ga0436364_0626675 3300037853 Bacteria 4991
196 Ga0395901_0001307 3300038443 Bacteria 26259
197 Ga0395901_0001767 3300038443 Bacteria 22302
198 Ga0395901_0168929 3300038443 Bacteria 2295
199 Ga0237816_00003 3300039145 Bacteria 18184
200 Ga0436365_1022866 3300039437 Bacteria 3141
201 Ga0436360_0904959 3300039438 Bacteria 10322
202 Ga0436363_0666670 3300039450 Bacteria 3042
203 Ga0439465_0002567 3300041413 Bacteria 5914
204 Ga0451791_1597524 3300041451 Bacteria 4599
205 Ga0451793_1515601 3300041452 Bacteria 1352
206 Ga0451807_0892913 3300041486 Bacteria 3071
207 Ga0439433_0025759 3300041999 Bacteria 1330
208 Ga0439449_0004615 3300042007 Bacteria 5324
209 Ga0450901_000684 3300042533 Bacteria 4009
210 Ga0466966_0031170 3300044684 Bacteria 3458
211 Ga0466958_0115177 3300045836 Bacteria 1680
212 Ga0495638_0106277 3300046460 Bacteria 1672
213 Ga0495580_0004771 3300046472 Bacteria 11350
214 Ga0495580_0069530 3300046472 Unclassified 2460
215 Ga0495585_0094661 3300046492 Bacteria 1605
216 Ga0495596_0062489 3300046500 Bacteria 1449
217 Ga0495607_0120734 3300046501 Bacteria 1376
218 Ga0495606_0000279 3300046507 Bacteria 88805
219 Ga0495606_0031276 3300046507 Bacteria 3703
220 Ga0495610_0000013 3300046512 Bacteria 465872
221 Ga0495616_0001229 3300046513 Bacteria 18020
222 Ga0495616_0025978 3300046513 Bacteria 3123
223 Ga0495620_0003657 3300046515 Bacteria 8778
224 Ga0495628_0239911 3300046516 Unclassified 1356
225 Ga0495630_0187727 3300046517 Unclassified 1577
226 Ga0495643_0009249 3300046522 Bacteria 6140
227 Ga0495643_0094663 3300046522 Bacteria 1537
228 Ga0495663_0000922 3300046525 Bacteria 9840
229 Ga0495609_0004657 3300046538 Bacteria 7436
230 Ga0495609_0132440 3300046538 Bacteria 1067
231 Ga0495633_0000825 3300046558 Bacteria 27382
232 Ga0495633_0004765 3300046558 Bacteria 8511
233 Ga0495668_0000013 3300046616 Bacteria 452938
234 Ga0495668_0019649 3300046616 Bacteria 3892
235 Ga0495625_0005635 3300046660 Bacteria 11347
236 Ga0495625_0170601 3300046660 Bacteria 1453
237 Ga0495671_0038268 3300046692 Bacteria 2424
238 Ga0495687_000055 3300047443 Bacteria 194477
239 Ga0495681_0121727 3300047470 Bacteria 1119
240 Ga0495686_0000161 3300047472 Bacteria 126951
241 Ga0495686_0000849 3300047472 Bacteria 39236
242 Ga0495686_0015838 3300047472 Bacteria 5130
243 Ga0496101_0050745 3300048904 Bacteria 2987
244 Ga0496102_0012297 3300048905 Bacteria 7402
245 Ga0496102_0014154 3300048905 Bacteria 6930
246 Ga0496102_0117660 3300048905 Bacteria 2480
247 Ga0496102_0498493 3300048905 Unclassified 1140
248 Ga0496107_0050175 3300048910 Unclassified 3007
249 Ga0496109_0314627 3300048912 Bacteria 1477
250 Ga0496110_0011263 3300048913 Bacteria 7310
251 Ga0496114_0001529 3300048917 Bacteria 17547
252 Ga0496114_0027508 3300048917 Bacteria 4659
253 Ga0496117_0000035 3300048920 Bacteria 326449
254 Ga0496117_0007814 3300048920 Bacteria 10301
255 Ga0496117_0013468 3300048920 Bacteria 7132
256 Ga0496117_0059816 3300048920 Bacteria 2629
257 Ga0496117_0060237 3300048920 Bacteria 2618
258 Ga0496118_0000038 3300048921 Bacteria 315464
259 Ga0496118_0012956 3300048921 Bacteria 7939
260 Ga0496118_0015130 3300048921 Bacteria 7164
261 Ga0496118_0030269 3300048921 Bacteria 4521
262 Ga0496118_0034748 3300048921 Bacteria 4106
263 Ga0496118_0069573 3300048921 Bacteria 2548
264 Ga0496118_0122267 3300048921 Bacteria 1693
265 Ga0496119_0001248 3300048922 Bacteria 31613
266 Ga0496119_0002918 3300048922 Bacteria 18242
267 Ga0496119_0005478 3300048922 Bacteria 12140
268 Ga0496119_0041969 3300048922 Bacteria 2906
269 Ga0496119_0138628 3300048922 Bacteria 1316
270 Ga0496120_0000086 3300048923 Bacteria 154099
271 Ga0496120_0000345 3300048923 Bacteria 76569
272 Ga0496120_0005233 3300048923 Bacteria 10427
273 Ga0496121_0000078 3300048924 Bacteria 233455
274 Ga0496121_0001819 3300048924 Bacteria 34405
275 Ga0496121_0059399 3300048924 Bacteria 3153
276 Ga0496121_0187716 3300048924 Bacteria 1485
277 Ga0496122_0001224 3300048925 Bacteria 43437
278 Ga0496122_0021408 3300048925 Bacteria 5790
279 Ga0496122_0026584 3300048925 Bacteria 4981
280 Ga0496122_0063266 3300048925 Bacteria 2701
281 Ga0496123_0000993 3300048926 Bacteria 43586
282 Ga0496123_0006377 3300048926 Bacteria 11449
283 Ga0496123_0026629 3300048926 Bacteria 4327
284 Ga0496124_0000018 3300048927 Bacteria 442940
285 Ga0496124_0000110 3300048927 Bacteria 166321
286 Ga0496124_0001470 3300048927 Bacteria 34616
287 Ga0496124_0003134 3300048927 Bacteria 20487
288 Ga0496124_0049341 3300048927 Bacteria 3591
289 Ga0496125_0016800 3300048928 Bacteria 7014
290 Ga0496125_0039683 3300048928 Bacteria 4049
291 Ga0496125_0061800 3300048928 Bacteria 3001
292 Ga0496125_0065571 3300048928 Bacteria 2875
293 Ga0496126_0012207 3300048929 Bacteria 8814
294 Ga0496126_0019137 3300048929 Bacteria 6752
295 Ga0496126_0080859 3300048929 Bacteria 2874
296 Ga0501031_0058182 3300049568 Bacteria 2519
297 Ga0501032_0005817 3300049569 Bacteria 9122
298 Ga0501032_0024403 3300049569 Bacteria 4176
299 Ga0501033_0021450 3300049570 Bacteria 4873
300 Ga0501034_0026303 3300049571 Bacteria 5926
301 Ga0501034_0104925 3300049571 Bacteria 2819
302 Ga0501034_0117182 3300049571 Bacteria 2651
303 Ga0501036_0061960 3300049572 Bacteria 3168
304 Ga0501037_0020506 3300049573 Bacteria 4881
305 Ga0501043_0028297 3300049579 Bacteria 4399
306 Ga0501043_0030264 3300049579 Bacteria 4254
307 Ga0501043_0045984 3300049579 Bacteria 3432
308 Ga0501046_0094705 3300049580 Bacteria 2295
309 Ga0501047_0031072 3300049581 Bacteria 5150
310 Ga0501047_0042992 3300049581 Bacteria 4365
311 Ga0501035_0004965 3300049822 Bacteria 12614
312 Ga0501044_0026493 3300049823 Bacteria 6135
313 Ga0501044_0286218 3300049823 Bacteria 1581
314 Ga0501044_0301972 3300049823 Bacteria 1529
315 nmdc:mga00v17_2123_c1 3300050491 Bacteria 10196
316 nmdc:mga08y16_32929_c1 3300050511 Bacteria 5446
317 nmdc:mga0rr50_239408_c1 3300050513 Unclassified 1504
318 Ga0500616_0000279 3300053153 Bacteria 75756
319 Ga0500611_004618 3300053727 Bacteria 1871
320 Ga0500596_000023 3300053735 Bacteria 21746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046538 Ga0495609_0132440 Ga0495609_0132440_19_942 307
2 iso_pu_bacteria 2842757796 2842760192 320
3 3300037853 Ga0436364_0626675 Ga0436364_0626675_3946_4962 328
4 iso_pu_bacteria 2842780639 2842781268 332
5 3300005337 Ga0070682_100031293 Ga0070682_1000312932 334
6 3300048922 Ga0496119_0138628 Ga0496119_0138628_46_1149 334
7 3300041999 Ga0439433_0025759 Ga0439433_0025759_68_1075 335
8 3300048905 Ga0496102_0117660 Ga0496102_0117660_29_1072 336
9 3300048920 Ga0496117_0007814 Ga0496117_0007814_28_1038 336
10 3300009093 Ga0105240_10000630 Ga0105240_1000063035 339
11 3300010375 Ga0105239_10000633 Ga0105239_1000063323 339
12 3300025913 Ga0207695_10001494 Ga0207695_1000149426 339
13 3300048921 Ga0496118_0069573 Ga0496118_0069573_1054_2160 339
14 3300048924 Ga0496121_0000078 Ga0496121_0000078_37863_38969 339
15 3300048924 Ga0496121_0001819 Ga0496121_0001819_3970_5076 339
16 3300048929 Ga0496126_0012207 Ga0496126_0012207_5747_6853 339
17 3300026067 Ga0207678_10209392 Ga0207678_102093922 341
18 3300047472 Ga0495686_0000161 Ga0495686_0000161_28508_29692 341
19 3300009177 Ga0105248_10009825 Ga0105248_100098259 342
20 3300009545 Ga0105237_10002242 Ga0105237_100022425 342
21 3300041486 Ga0451807_0892913 Ga0451807_0892913_1482_2585 342
22 3300047470 Ga0495681_0121727 Ga0495681_0121727_25_1059 343
23 3300005577 Ga0068857_100097417 Ga0068857_1000974173 345
24 3300005578 Ga0068854_100015172 Ga0068854_1000151723 345
25 3300009545 Ga0105237_10006630 Ga0105237_100066305 345
26 3300013306 Ga0163162_10229277 Ga0163162_102292772 345
27 3300025914 Ga0207671_10003529 Ga0207671_100035293 345
28 3300025981 Ga0207640_10020340 Ga0207640_100203402 345
29 3300048927 Ga0496124_0003134 Ga0496124_0003134_7900_9003 345
30 3300005344 Ga0070661_100172591 Ga0070661_1001725912 346
31 3300005617 Ga0068859_100063679 Ga0068859_1000636792 346
32 3300006931 Ga0097620_100063682 Ga0097620_1000636823 346
33 3300009093 Ga0105240_10003693 Ga0105240_100036935 346
34 3300025913 Ga0207695_10013660 Ga0207695_100136605 346
35 3300036401 Ga0373937_0002206 Ga0373937_0002206_8133_9215 347
36 3300048926 Ga0496123_0006377 Ga0496123_0006377_2943_4046 347
37 3300048927 Ga0496124_0000110 Ga0496124_0000110_137976_139079 347
38 3300015262 Ga0182007_10002735 Ga0182007_100027352 348
39 3300046513 Ga0495616_0001229 Ga0495616_0001229_11061_12188 348
40 3300048923 Ga0496120_0005233 Ga0496120_0005233_2185_3291 348
41 3300048924 Ga0496121_0059399 Ga0496121_0059399_625_1731 348
42 3300048928 Ga0496125_0061800 Ga0496125_0061800_1084_2190 348
43 3300048928 Ga0496125_0065571 Ga0496125_0065571_453_1565 348
44 3300050513 nmdc:mga0rr50_239408_c1 nmdc:mga0rr50_239408_c1_116_1255 348
45 3300005439 Ga0070711_100045626 Ga0070711_1000456261 349
46 3300025898 Ga0207692_10119732 Ga0207692_101197322 349
47 3300038443 Ga0395901_0168929 Ga0395901_0168929_1034_2164 349
48 3300053727 Ga0500611_004618 Ga0500611_004618_578_1705 349
49 iso_pu_bacteria 2599185354 2600201451 349
50 iso_pu_bacteria 2599185359 2600228884 349
51 iso_pu_bacteria 2751185897 2753765618 349
52 iso_pu_bacteria 2928968154 2928968873 349
53 iso_pu_bacteria 8057101203 8057102334 349
54 3300005366 Ga0070659_100182768 Ga0070659_1001827682 350
55 3300005841 Ga0068863_100168580 Ga0068863_1001685802 350
56 3300009174 Ga0105241_10072890 Ga0105241_100728903 350
57 3300013100 Ga0157373_10007064 Ga0157373_100070642 350
58 3300013102 Ga0157371_10061059 Ga0157371_100610592 350
59 3300013307 Ga0157372_10238642 Ga0157372_102386422 350
60 3300014497 Ga0182008_10008177 Ga0182008_100081774 350
61 3300014968 Ga0157379_10049562 Ga0157379_100495622 350
62 3300025949 Ga0207667_10018588 Ga0207667_100185882 350
63 3300037466 Ga0395898_0280057 Ga0395898_0280057_364_1494 350
64 3300038443 Ga0395901_0001767 Ga0395901_0001767_10442_11572 350
65 3300046472 Ga0495580_0004771 Ga0495580_0004771_6457_7608 350
66 3300048910 Ga0496107_0050175 Ga0496107_0050175_930_2081 350
67 3300048913 Ga0496110_0011263 Ga0496110_0011263_2276_3427 350
68 3300048917 Ga0496114_0027508 Ga0496114_0027508_1782_2933 350
69 3300005262 Ga0065165_1000284 Ga0065165_100028481 351
70 3300009551 Ga0105238_10100673 Ga0105238_101006733 351
71 3300039450 Ga0436363_0666670 Ga0436363_0666670_412_1494 351
72 3300046513 Ga0495616_0025978 Ga0495616_0025978_1364_2506 351
73 3300003316 rootH1_10147825 rootH1_101478252 352
74 3300045836 Ga0466958_0115177 Ga0466958_0115177_573_1667 352
75 3300046501 Ga0495607_0120734 Ga0495607_0120734_133_1236 352
76 3300049579 Ga0501043_0045984 Ga0501043_0045984_1193_2440 352
77 3300049823 Ga0501044_0301972 Ga0501044_0301972_409_1512 352
78 iso_pu_bacteria 2818991466 2819716570 352
79 3300005548 Ga0070665_100025610 Ga0070665_1000256105 353
80 3300005844 Ga0068862_100028894 Ga0068862_1000288943 353
81 3300006881 Ga0068865_100070237 Ga0068865_1000702372 353
82 3300009093 Ga0105240_10070564 Ga0105240_100705643 353
83 3300009148 Ga0105243_10125904 Ga0105243_101259041 353
84 3300009551 Ga0105238_10163607 Ga0105238_101636072 353
85 3300025913 Ga0207695_10149288 Ga0207695_101492882 353
86 3300025938 Ga0207704_10022158 Ga0207704_100221582 353
87 3300047472 Ga0495686_0000849 Ga0495686_0000849_31861_32961 353
88 3300048905 Ga0496102_0014154 Ga0496102_0014154_1673_2779 353
89 3300048920 Ga0496117_0000035 Ga0496117_0000035_225831_226937 353
90 3300048920 Ga0496117_0013468 Ga0496117_0013468_3443_4549 353
91 3300048921 Ga0496118_0000038 Ga0496118_0000038_2900_4006 353
92 3300048921 Ga0496118_0034748 Ga0496118_0034748_1247_2353 353
93 3300048922 Ga0496119_0002918 Ga0496119_0002918_1765_2871 353
94 3300048922 Ga0496119_0005478 Ga0496119_0005478_5215_6321 353
95 3300048923 Ga0496120_0000086 Ga0496120_0000086_94340_95446 353
96 3300048927 Ga0496124_0049341 Ga0496124_0049341_1923_3029 353
97 3300049823 Ga0501044_0286218 Ga0501044_0286218_359_1465 353
98 3300003794 Ga0055531_10006307 Ga0055531_100063072 354
99 3300005337 Ga0070682_100009514 Ga0070682_1000095144 354
100 3300005339 Ga0070660_100002271 Ga0070660_1000022712 354
101 3300005563 Ga0068855_100050774 Ga0068855_1000507743 354
102 3300005841 Ga0068863_100011117 Ga0068863_1000111172 354
103 3300005842 Ga0068858_100005639 Ga0068858_10000563912 354
104 3300005843 Ga0068860_100002826 Ga0068860_1000028268 354
105 3300005844 Ga0068862_100299972 Ga0068862_1002999722 354
106 3300006358 Ga0068871_100041378 Ga0068871_1000413783 354
107 3300009093 Ga0105240_10546843 Ga0105240_105468431 354
108 3300009101 Ga0105247_10001084 Ga0105247_1000108417 354
109 3300009101 Ga0105247_10058278 Ga0105247_100582782 354
110 3300009177 Ga0105248_10032406 Ga0105248_100324062 354
111 3300009545 Ga0105237_10021026 Ga0105237_100210262 354
112 3300009551 Ga0105238_10357182 Ga0105238_103571822 354
113 3300009553 Ga0105249_10339590 Ga0105249_103395902 354
114 3300010375 Ga0105239_10438464 Ga0105239_104384641 354
115 3300013105 Ga0157369_10073302 Ga0157369_100733023 354
116 3300013306 Ga0163162_10079127 Ga0163162_100791275 354
117 3300014325 Ga0163163_10020656 Ga0163163_100206565 354
118 3300014968 Ga0157379_10007231 Ga0157379_100072315 354
119 3300014968 Ga0157379_10171141 Ga0157379_101711412 354
120 3300025304 Ga0209257_1000197 Ga0209257_100019741 354
121 3300025900 Ga0207710_10054083 Ga0207710_100540833 354
122 3300025913 Ga0207695_10193810 Ga0207695_101938101 354
123 3300025919 Ga0207657_10005483 Ga0207657_100054839 354
124 3300025949 Ga0207667_10100273 Ga0207667_101002732 354
125 3300025961 Ga0207712_10189222 Ga0207712_101892222 354
126 3300026035 Ga0207703_10002148 Ga0207703_1000214814 354
127 3300026088 Ga0207641_10000880 Ga0207641_100008806 354
128 3300028380 Ga0268265_10412784 Ga0268265_104127841 354
129 3300028381 Ga0268264_10000100 Ga0268264_1000010061 354
130 3300033180 Ga0307510_10006124 Ga0307510_100061245 354
131 3300046512 Ga0495610_0000013 Ga0495610_0000013_26880_27989 354
132 3300046515 Ga0495620_0003657 Ga0495620_0003657_3247_4356 354
133 3300046522 Ga0495643_0094663 Ga0495643_0094663_301_1419 354
134 3300046525 Ga0495663_0000922 Ga0495663_0000922_1543_2664 354
135 3300046538 Ga0495609_0004657 Ga0495609_0004657_5584_6693 354
136 3300046660 Ga0495625_0005635 Ga0495625_0005635_5394_6503 354
137 3300046692 Ga0495671_0038268 Ga0495671_0038268_161_1282 354
138 3300047472 Ga0495686_0015838 Ga0495686_0015838_61_1149 354
139 3300048905 Ga0496102_0498493 Ga0496102_0498493_12_1088 354
140 3300048920 Ga0496117_0059816 Ga0496117_0059816_605_1714 354
141 3300048921 Ga0496118_0012956 Ga0496118_0012956_4342_5451 354
142 3300048925 Ga0496122_0021408 Ga0496122_0021408_2143_3252 354
143 3300050511 nmdc:mga08y16_32929_c1 nmdc:mga08y16_32929_c1_4042_5181 354
144 3300003781 Ga0055536_1001758 Ga0055536_10017584 355
145 3300009553 Ga0105249_10115727 Ga0105249_101157273 355
146 3300025292 Ga0209676_1000035 Ga0209676_1000035198 355
147 3300031456 Ga0307513_10074639 Ga0307513_100746393 355
148 3300033180 Ga0307510_10000001 Ga0307510_10000001332 355
149 3300046492 Ga0495585_0094661 Ga0495585_0094661_415_1506 355
150 3300046616 Ga0495668_0019649 Ga0495668_0019649_493_1596 355
151 3300048917 Ga0496114_0001529 Ga0496114_0001529_112_1320 355
152 3300048929 Ga0496126_0019137 Ga0496126_0019137_4251_5468 355
153 3300005354 Ga0070675_100213325 Ga0070675_1002133251 356
154 3300013308 Ga0157375_10017071 Ga0157375_100170711 356
155 3300025926 Ga0207659_10251305 Ga0207659_102513051 356
156 3300025940 Ga0207691_10027961 Ga0207691_100279614 356
157 3300032004 Ga0307414_10007137 Ga0307414_100071372 356
158 3300037471 Ga0395905_0040615 Ga0395905_0040615_2106_3188 356
159 3300048905 Ga0496102_0012297 Ga0496102_0012297_4428_5531 356
160 3300048920 Ga0496117_0060237 Ga0496117_0060237_858_1961 356
161 3300048921 Ga0496118_0030269 Ga0496118_0030269_2587_3690 356
162 3300001990 JGI24737J22298_10033805 JGI24737J22298_100338052 357
163 3300002067 JGI24735J21928_10011579 JGI24735J21928_100115793 357
164 3300005327 Ga0070658_10159754 Ga0070658_101597542 357
165 3300005344 Ga0070661_100042944 Ga0070661_1000429442 357
166 3300005564 Ga0070664_100080992 Ga0070664_1000809922 357
167 3300025904 Ga0207647_10054267 Ga0207647_100542672 357
168 3300025925 Ga0207650_10099515 Ga0207650_100995152 357
169 3300025945 Ga0207679_10108188 Ga0207679_101081882 357
170 3300026067 Ga0207678_10033472 Ga0207678_100334723 357
171 3300026116 Ga0207674_10010358 Ga0207674_100103584 357
172 3300028379 Ga0268266_10144134 Ga0268266_101441342 357
173 3300037418 Ga0395900_0003323 Ga0395900_0003323_13363_14484 357
174 3300038443 Ga0395901_0001307 Ga0395901_0001307_15059_16180 357
175 3300041413 Ga0439465_0002567 Ga0439465_0002567_1690_2820 357
176 3300042007 Ga0439449_0004615 Ga0439449_0004615_3875_4975 357
177 3300044684 Ga0466966_0031170 Ga0466966_0031170_2286_3404 357
178 3300048921 Ga0496118_0015130 Ga0496118_0015130_5687_6811 357
179 3300048922 Ga0496119_0041969 Ga0496119_0041969_1242_2366 357
180 3300048924 Ga0496121_0187716 Ga0496121_0187716_306_1430 357
181 3300048927 Ga0496124_0000018 Ga0496124_0000018_14367_15527 357
182 3300048928 Ga0496125_0016800 Ga0496125_0016800_1848_2972 357
183 iso_pu_bacteria 2643221639 2644222561 357
184 3300002773 JGI25152J39213_1000029 JGI25152J39213_100002988 358
185 3300002774 JGI25150J39212_1000032 JGI25150J39212_10000323 358
186 3300003187 JGI25151J46595_10000010 JGI25151J46595_10000010175 358
187 3300003215 JGI25153J46596_10000013 JGI25153J46596_10000013175 358
188 3300005355 Ga0070671_100058536 Ga0070671_1000585362 358
189 3300005367 Ga0070667_100028075 Ga0070667_1000280753 358
190 3300005544 Ga0070686_100013812 Ga0070686_1000138124 358
191 3300005548 Ga0070665_100118321 Ga0070665_1001183213 358
192 3300005617 Ga0068859_100000255 Ga0068859_10000025548 358
193 3300005841 Ga0068863_100121845 Ga0068863_1001218453 358
194 3300006237 Ga0097621_100101067 Ga0097621_1001010672 358
195 3300006931 Ga0097620_100000255 Ga0097620_1000002558 358
196 3300009092 Ga0105250_10060541 Ga0105250_100605412 358
197 3300013297 Ga0157378_10019114 Ga0157378_100191143 358
198 3300025245 Ga0207425_1000015 Ga0207425_1000015117 358
199 3300025258 Ga0209129_1000126 Ga0209129_10001263 358
200 3300025294 Ga0209025_1000002 Ga0209025_10000021015 358
201 3300025297 Ga0209758_1000003 Ga0209758_10000031022 358
202 3300025711 Ga0207696_1047288 Ga0207696_10472882 358
203 3300025900 Ga0207710_10000118 Ga0207710_1000011822 358
204 3300025905 Ga0207685_10012518 Ga0207685_100125183 358
205 3300025931 Ga0207644_10009619 Ga0207644_100096193 358
206 3300025931 Ga0207644_10053855 Ga0207644_100538553 358
207 3300025941 Ga0207711_10019383 Ga0207711_100193834 358
208 3300026035 Ga0207703_10000833 Ga0207703_1000083317 358
209 3300026088 Ga0207641_10290269 Ga0207641_102902692 358
210 3300049569 Ga0501032_0005817 Ga0501032_0005817_3552_4697 358
211 3300049571 Ga0501034_0104925 Ga0501034_0104925_816_1961 358
212 3300009545 Ga0105237_10493900 Ga0105237_104939002 359
213 3300014326 Ga0157380_10006829 Ga0157380_100068294 359
214 3300026075 Ga0207708_10078139 Ga0207708_100781392 359
215 3300039438 Ga0436360_0904959 Ga0436360_0904959_6010_7107 359
216 3300031852 Ga0307410_10176188 Ga0307410_101761882 360
217 3300031901 Ga0307406_10001036 Ga0307406_1000103610 360
218 3300031903 Ga0307407_10026730 Ga0307407_100267302 360
219 3300031995 Ga0307409_100164347 Ga0307409_1001643472 360
220 3300046558 Ga0495633_0000825 Ga0495633_0000825_13095_14180 360
221 3300048928 Ga0496125_0039683 Ga0496125_0039683_81_1223 360
222 3300048912 Ga0496109_0314627 Ga0496109_0314627_169_1320 361
223 3300048925 Ga0496122_0063266 Ga0496122_0063266_122_1249 361
224 3300049571 Ga0501034_0026303 Ga0501034_0026303_4642_5742 361
225 3300049573 Ga0501037_0020506 Ga0501037_0020506_1647_2747 361
226 3300049579 Ga0501043_0030264 Ga0501043_0030264_1579_2679 361
227 3300005337 Ga0070682_100003132 Ga0070682_1000031326 362
228 3300005842 Ga0068858_100047974 Ga0068858_1000479743 362
229 3300009176 Ga0105242_10033833 Ga0105242_100338333 362
230 3300014325 Ga0163163_10064446 Ga0163163_100644462 362
231 3300025230 Ga0209563_100030 Ga0209563_100030340 362
232 3300025261 Ga0209233_1010946 Ga0209233_10109465 362
233 3300025934 Ga0207686_10034375 Ga0207686_100343752 362
234 3300026089 Ga0207648_10164634 Ga0207648_101646341 362
235 3300028379 Ga0268266_10000036 Ga0268266_1000003695 362
236 3300031456 Ga0307513_10036018 Ga0307513_100360187 362
237 3300046500 Ga0495596_0062489 Ga0495596_0062489_236_1366 362
238 3300046507 Ga0495606_0000279 Ga0495606_0000279_44122_45252 362
239 3300046522 Ga0495643_0009249 Ga0495643_0009249_3364_4494 362
240 3300046616 Ga0495668_0000013 Ga0495668_0000013_7079_8209 362
241 3300046660 Ga0495625_0170601 Ga0495625_0170601_208_1338 362
242 3300047443 Ga0495687_000055 Ga0495687_000055_43909_45039 362
243 3300053153 Ga0500616_0000279 Ga0500616_0000279_45728_46849 362
244 3300053735 Ga0500596_000023 Ga0500596_000023_12152_13282 362
245 3300005548 Ga0070665_100017153 Ga0070665_1000171534 363
246 3300021441 Ga0213871_10002628 Ga0213871_100026282 363
247 3300028379 Ga0268266_10209399 Ga0268266_102093991 363
248 3300041451 Ga0451791_1597524 Ga0451791_1597524_14_1129 363
249 3300005466 Ga0070685_10078222 Ga0070685_100782222 364
250 iso_pu_bacteria 2643221577 2643895986 364
251 iso_pu_bacteria 2643221685 2644478169 364
252 3300005548 Ga0070665_100139681 Ga0070665_1001396812 365
253 3300028379 Ga0268266_10118870 Ga0268266_101188702 365
254 iso_pu_bacteria 2895498888 2895499861 365
255 iso_pu_bacteria 2895511927 2895512837 365
256 3300048925 Ga0496122_0026584 Ga0496122_0026584_781_1905 366
257 3300048926 Ga0496123_0026629 Ga0496123_0026629_2760_3884 366
258 3300005330 Ga0070690_100096553 Ga0070690_1000965532 367
259 3300005335 Ga0070666_10054791 Ga0070666_100547912 367
260 3300005548 Ga0070665_100328218 Ga0070665_1003282182 367
261 3300005614 Ga0068856_100025702 Ga0068856_1000257023 367
262 3300005843 Ga0068860_100061792 Ga0068860_1000617922 367
263 3300006358 Ga0068871_100013690 Ga0068871_1000136905 367
264 3300006881 Ga0068865_100056514 Ga0068865_1000565141 367
265 3300009177 Ga0105248_10310262 Ga0105248_103102622 367
266 3300009545 Ga0105237_10019210 Ga0105237_100192104 367
267 3300010375 Ga0105239_10085281 Ga0105239_100852813 367
268 3300013296 Ga0157374_10258839 Ga0157374_102588392 367
269 3300025915 Ga0207693_10003494 Ga0207693_1000349410 367
270 3300025938 Ga0207704_10060945 Ga0207704_100609452 367
271 3300025941 Ga0207711_10055201 Ga0207711_100552012 367
272 3300026121 Ga0207683_10001839 Ga0207683_100018398 367
273 3300028381 Ga0268264_10083384 Ga0268264_100833842 367
274 3300035171 Ga0373946_0037090 Ga0373946_0037090_721_1872 367
275 3300036401 Ga0373937_0015783 Ga0373937_0015783_2427_3578 367
276 3300039145 Ga0237816_00003 Ga0237816_00003_6244_7422 367
277 3300046472 Ga0495580_0069530 Ga0495580_0069530_1020_2171 367
278 3300046516 Ga0495628_0239911 Ga0495628_0239911_12_1163 367
279 3300046517 Ga0495630_0187727 Ga0495630_0187727_78_1229 367
280 3300048904 Ga0496101_0050745 Ga0496101_0050745_142_1293 367
281 3300049568 Ga0501031_0058182 Ga0501031_0058182_1304_2431 367
282 3300049569 Ga0501032_0024403 Ga0501032_0024403_261_1388 367
283 3300049570 Ga0501033_0021450 Ga0501033_0021450_224_1351 367
284 3300049572 Ga0501036_0061960 Ga0501036_0061960_80_1207 367
285 3300049579 Ga0501043_0028297 Ga0501043_0028297_1946_3073 367
286 3300049580 Ga0501046_0094705 Ga0501046_0094705_120_1247 367
287 3300049581 Ga0501047_0042992 Ga0501047_0042992_1656_2783 367
288 3300049822 Ga0501035_0004965 Ga0501035_0004965_3914_5041 367
289 3300049823 Ga0501044_0026493 Ga0501044_0026493_4533_5660 367
290 3300030745 Ga0316182_1406383 Ga0316182_14063831 368
291 3300042533 Ga0450901_000684 Ga0450901_000684_1975_3108 368
292 iso_pu_bacteria 2894414249 2894418021 368
293 iso_pu_bacteria 2919130084 2919132203 368
294 iso_pu_bacteria 2929195423 2929199059 368
295 iso_pu_bacteria 2939611941 2939613151 368
296 3300005844 Ga0068862_100096734 Ga0068862_1000967342 369
297 3300009551 Ga0105238_10473146 Ga0105238_104731461 369
298 3300013104 Ga0157370_10040159 Ga0157370_100401593 369
299 3300025924 Ga0207694_10236383 Ga0207694_102363831 369
300 3300028380 Ga0268265_10126526 Ga0268265_101265262 369
301 3300005615 Ga0070702_100085701 Ga0070702_1000857012 370
302 3300050491 nmdc:mga00v17_2123_c1 nmdc:mga00v17_2123_c1_7746_8870 370
303 3300032004 Ga0307414_10125424 Ga0307414_101254242 371
304 3300049571 Ga0501034_0117182 Ga0501034_0117182_1239_2426 371
305 3300049581 Ga0501047_0031072 Ga0501047_0031072_2307_3494 371
306 3300009545 Ga0105237_10069674 Ga0105237_100696743 372
307 3300013307 Ga0157372_10083670 Ga0157372_100836702 372
308 3300025904 Ga0207647_10001672 Ga0207647_100016728 372
309 3300025909 Ga0207705_10067671 Ga0207705_100676712 372
310 3300025914 Ga0207671_10229829 Ga0207671_102298291 372
311 3300025919 Ga0207657_10010315 Ga0207657_100103156 372
312 3300025924 Ga0207694_10019925 Ga0207694_100199253 372
313 3300025929 Ga0207664_10000068 Ga0207664_1000006856 372
314 3300025932 Ga0207690_10001073 Ga0207690_100010738 372
315 3300025932 Ga0207690_10001680 Ga0207690_100016804 372
316 3300025933 Ga0207706_10010478 Ga0207706_100104787 372
317 3300025949 Ga0207667_10032641 Ga0207667_100326412 372
318 3300039437 Ga0436365_1022866 Ga0436365_1022866_836_1999 372
319 3300041452 Ga0451793_1515601 Ga0451793_1515601_36_1169 372
320 3300046460 Ga0495638_0106277 Ga0495638_0106277_105_1238 372
321 3300048929 Ga0496126_0080859 Ga0496126_0080859_273_1415 372
322 3300003794 Ga0055531_10010771 Ga0055531_100107713 373
323 3300025304 Ga0209257_1000121 Ga0209257_100012143 373
324 3300046507 Ga0495606_0031276 Ga0495606_0031276_828_1985 373
325 2162886007 SwRhRL2b_contig_3608852 SwRhRL2b_0355.00006820 374
326 3300005289 Ga0065704_10071772 Ga0065704_100717722 374
327 3300005331 Ga0070670_100000304 Ga0070670_10000030412 374
328 3300009011 Ga0105251_10000866 Ga0105251_1000086611 374
329 3300025735 Ga0207713_1001692 Ga0207713_100169211 374
330 3300025925 Ga0207650_10001679 Ga0207650_1000167911 374
331 3300046558 Ga0495633_0004765 Ga0495633_0004765_492_1661 374
332 3300048921 Ga0496118_0122267 Ga0496118_0122267_256_1428 374
333 3300048922 Ga0496119_0001248 Ga0496119_0001248_25051_26223 374
334 3300048923 Ga0496120_0000345 Ga0496120_0000345_10099_11271 374
335 3300048925 Ga0496122_0001224 Ga0496122_0001224_25639_26763 374
336 3300048926 Ga0496123_0000993 Ga0496123_0000993_25789_26913 374
337 3300048927 Ga0496124_0001470 Ga0496124_0001470_16746_17870 374

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

84

413

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xrt-assembly2.cif.gz_B the crystal structure of a novel, latent dihydroorotase from aquifex aeolicus at 1.7 a resolution 0.6115 46 366
7uek-assembly1.cif.gz_A crystal structure of a de novo designed ovoid tim barrel ot3 0.6028 49 319
1o66-assembly1.cif.gz_E crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase 0.6 39 267
1o66-assembly1.cif.gz_B crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase 0.5876 39 267
4mjm-assembly1.cif.gz_B crystal structure of the inosine 5'-monophosphate dehydrogenase, with a short internal deletion of cbs domain from bacillus anthracis str. ames 0.5876 54 179
ID Description Score Start End Superfamily
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7893 58 366 3.20.20.140
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7116 58 366 3.20.20.140
2a7vA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.6967 121 182 3.40.640.10
3k4wC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.6756 45 369 3.20.20.140
3k4wC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.6691 45 369 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A519KZY9-F1-model_v4 Amidohydrolase 0.9941 108 366 GO:0016787
GO:0016829
AF-A0A1Q4FEZ0-F1-model_v4 Hydrolase 0.9903 39 368 GO:0016787
GO:0016829
AF-A0A1Q4FEZ0-F1-model_v4 Hydrolase 0.9844 39 368 GO:0016787
GO:0016829
AF-A0A1I3KCJ6-F1-model_v4 Amidohydrolase 0.9832 34 366 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A1N7NC39-F1-model_v4 Amidohydrolase 0.9831 45 368 GO:0005737
GO:0016787
GO:0016831
GO:0019748

Feature Viewer

pLDDT pTM Quality
89.15 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map