F413180

General Info

Members Datasets Scaffolds Average Seq Length
337 226 337 146

Family's Representative Sequence

Representative Sequence 3300041491|Ga0451833_0300046|Ga0451833_0300046_89_613
Length 174
Sequence MLSWLGKKMIARNMARASAGDIAPTLKMDAEDVRFRFPGDSSWGGEIRGKRELEKWLRRFADTGLQISPDEVVLKGFPWKQTICIRGTDHLDTPEGERVYENRYVIWGHIRWGLLRDYEVYEDTQKSKALDEYLAARSDPYERLTALVGNTAGGQVDDASAVMVMVHQIRQVVA

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
128 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
129 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
130 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
147 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
148 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
149 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
225 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
226 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 11.87
Rhizosphere 85.46
Stem 0
Stem Tuber 0
Unclassified 2.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1028072 3300000546 Bacteria 603
2 JGI24748J21848_1004831 3300002074 Bacteria 1552
3 JGI24744J21845_10021457 3300002077 Bacteria 1270
4 JGI24034J26672_10000072 3300002239 Bacteria 25672
5 JGI25406J46586_10109147 3300003203 Unclassified 820
6 Ga0070658_10424084 3300005327 Bacteria 1144
7 Ga0070683_100018331 3300005329 Bacteria 6197
8 Ga0070690_100682484 3300005330 Bacteria 787
9 Ga0068869_100231015 3300005334 Bacteria 1470
10 Ga0070682_100175009 3300005337 Bacteria 1494
11 Ga0070682_100686889 3300005337 Unclassified 819
12 Ga0068868_100041450 3300005338 Bacteria 3587
13 Ga0070689_100032489 3300005340 Bacteria 3970
14 Ga0070691_10000003 3300005341 Bacteria 86538
15 Ga0070661_100040357 3300005344 Bacteria 3405
16 Ga0070668_100037466 3300005347 Bacteria 3703
17 Ga0070675_100095849 3300005354 Bacteria 2492
18 Ga0070671_100075990 3300005355 Bacteria 2806
19 Ga0070674_100000021 3300005356 Bacteria 87134
20 Ga0070674_100000075 3300005356 Bacteria 45822
21 Ga0070673_100053915 3300005364 Bacteria 3161
22 Ga0070688_100112992 3300005365 Bacteria 1809
23 Ga0070667_100356459 3300005367 Bacteria 1325
24 Ga0070714_100049650 3300005435 Bacteria 3572
25 Ga0070714_100195468 3300005435 Bacteria 1848
26 Ga0070714_100606837 3300005435 Unclassified 1051
27 Ga0070713_100065208 3300005436 Bacteria 3058
28 Ga0070713_102328883 3300005436 Bacteria 518
29 Ga0070710_10100267 3300005437 Unclassified 1723
30 Ga0070711_100060328 3300005439 Bacteria 2637
31 Ga0070705_100050291 3300005440 Bacteria 2424
32 Ga0070700_100018446 3300005441 Bacteria 4011
33 Ga0070700_100298839 3300005441 Bacteria 1174
34 Ga0070694_100181753 3300005444 Bacteria 1556
35 Ga0070694_100999797 3300005444 Unclassified 694
36 Ga0070663_100136722 3300005455 Bacteria 1867
37 Ga0070678_100094289 3300005456 Bacteria 2304
38 Ga0070662_100028924 3300005457 Bacteria 3862
39 Ga0068867_100035861 3300005459 Bacteria 3599
40 Ga0070685_10208500 3300005466 Bacteria 1274
41 Ga0070684_100013797 3300005535 Bacteria 6523
42 Ga0070684_100111403 3300005535 Bacteria 2454
43 Ga0070686_100023585 3300005544 Bacteria 3679
44 Ga0070695_100203172 3300005545 Bacteria 1417
45 Ga0070695_100347416 3300005545 Bacteria 1110
46 Ga0070693_100091085 3300005547 Bacteria 1838
47 Ga0070693_101289894 3300005547 Bacteria 564
48 Ga0070665_100050754 3300005548 Bacteria 4163
49 Ga0070665_101151214 3300005548 Bacteria 787
50 Ga0070704_100032903 3300005549 Bacteria 3502
51 Ga0068855_100294328 3300005563 Bacteria 1799
52 Ga0068855_100732930 3300005563 Unclassified 1055
53 Ga0070664_100039147 3300005564 Bacteria 3993
54 Ga0070664_100838884 3300005564 Bacteria 860
55 Ga0068857_100169314 3300005577 Bacteria 1985
56 Ga0068856_100081106 3300005614 Bacteria 3218
57 Ga0068856_100102468 3300005614 Bacteria 2856
58 Ga0068856_100909005 3300005614 Bacteria 899
59 Ga0068852_100037402 3300005616 Bacteria 4069
60 Ga0068852_100667368 3300005616 Bacteria 1048
61 Ga0068859_100207928 3300005617 Bacteria 2043
62 Ga0068864_100036766 3300005618 Bacteria 4176
63 Ga0068866_10000007 3300005718 Bacteria 121729
64 Ga0068866_10000469 3300005718 Bacteria 18473
65 Ga0068866_10037280 3300005718 Bacteria 2387
66 Ga0068866_10224568 3300005718 Unclassified 1135
67 Ga0068861_100118415 3300005719 Bacteria 2133
68 Ga0068863_100001610 3300005841 Bacteria 22316
69 Ga0068863_100021205 3300005841 Bacteria 6202
70 Ga0068858_100000329 3300005842 Bacteria 50177
71 Ga0068860_100003031 3300005843 Bacteria 17343
72 Ga0068860_101868824 3300005843 Bacteria 622
73 Ga0081455_10359908 3300005937 Bacteria 1023
74 Ga0081539_10003837 3300005985 Bacteria 17649
75 Ga0070715_10000003 3300006163 Bacteria 345282
76 Ga0070716_100087836 3300006173 Bacteria 1874
77 Ga0070712_100003453 3300006175 Bacteria 9726
78 Ga0075430_100771777 3300006846 Bacteria 792
79 Ga0075431_100302888 3300006847 Bacteria 1614
80 Ga0075433_10018893 3300006852 Bacteria 5737
81 Ga0075433_11645102 3300006852 Bacteria 553
82 Ga0068865_100607314 3300006881 Bacteria 925
83 Ga0075436_101195402 3300006914 Bacteria 574
84 Ga0097620_100207919 3300006931 Bacteria 2043
85 Ga0075435_100100423 3300007076 Unclassified 2397
86 Ga0111539_10117137 3300009094 Bacteria 3123
87 Ga0105245_10007717 3300009098 Bacteria 9422
88 Ga0105245_11187618 3300009098 Bacteria 811
89 Ga0105247_10000275 3300009101 Bacteria 47915
90 Ga0105247_10199380 3300009101 Bacteria 1344
91 Ga0114129_10120351 3300009147 Bacteria 3615
92 Ga0114129_10698015 3300009147 Bacteria 1304
93 Ga0105243_10045478 3300009148 Bacteria 3450
94 Ga0105243_10182966 3300009148 Bacteria 1824
95 Ga0105242_10000109 3300009176 Bacteria 59443
96 Ga0105242_10006926 3300009176 Bacteria 8746
97 Ga0105242_10025228 3300009176 Bacteria 4702
98 Ga0105248_10433094 3300009177 Bacteria 1481
99 Ga0105238_10000016 3300009551 Bacteria 236218
100 Ga0105249_10276286 3300009553 Bacteria 1676
101 Ga0105239_10043885 3300010375 Bacteria 4903
102 Ga0105239_11113600 3300010375 Bacteria 909
103 Ga0105246_10017323 3300011119 Bacteria 4577
104 Ga0157370_10020561 3300013104 Bacteria 6590
105 Ga0163162_10122398 3300013306 Bacteria 2706
106 Ga0157372_10017307 3300013307 Bacteria 7739
107 Ga0157375_10000126 3300013308 Bacteria 75410
108 Ga0157375_10012323 3300013308 Bacteria 7582
109 Ga0157375_10015812 3300013308 Bacteria 6762
110 Ga0157375_10252582 3300013308 Bacteria 1924
111 Ga0163163_10051219 3300014325 Bacteria 4071
112 Ga0157380_10279612 3300014326 Bacteria 1526
113 Ga0157377_10014431 3300014745 Bacteria 4020
114 Ga0157379_10322038 3300014968 Bacteria 1412
115 Ga0157376_10583996 3300014969 Bacteria 1110
116 Ga0163161_10000013 3300017792 Bacteria 258747
117 Ga0163161_10139565 3300017792 Bacteria 1834
118 Ga0207692_10105345 3300025898 Unclassified 1555
119 Ga0207642_10000008 3300025899 Bacteria 132651
120 Ga0207642_10000181 3300025899 Bacteria 18196
121 Ga0207642_10046972 3300025899 Bacteria 1927
122 Ga0207688_10027077 3300025901 Bacteria 3153
123 Ga0207685_10000003 3300025905 Bacteria 344527
124 Ga0207699_10213787 3300025906 Bacteria 1313
125 Ga0207643_10552925 3300025908 Unclassified 739
126 Ga0207671_10126432 3300025914 Bacteria 1959
127 Ga0207693_10052410 3300025915 Bacteria 3200
128 Ga0207663_10046208 3300025916 Bacteria 2682
129 Ga0207694_10000012 3300025924 Bacteria 411218
130 Ga0207659_10062614 3300025926 Bacteria 2686
131 Ga0207687_10028321 3300025927 Bacteria 3764
132 Ga0207700_10497477 3300025928 Unclassified 1079
133 Ga0207700_11623534 3300025928 Bacteria 572
134 Ga0207664_10182591 3300025929 Bacteria 1802
135 Ga0207664_10339480 3300025929 Bacteria 1328
136 Ga0207664_10615437 3300025929 Unclassified 976
137 Ga0207644_10080366 3300025931 Bacteria 2408
138 Ga0207690_10275532 3300025932 Bacteria 1309
139 Ga0207706_10009222 3300025933 Bacteria 9066
140 Ga0207686_10000212 3300025934 Bacteria 44261
141 Ga0207686_10004392 3300025934 Bacteria 7562
142 Ga0207709_10018925 3300025935 Bacteria 3863
143 Ga0207709_10101087 3300025935 Bacteria 1906
144 Ga0207669_10000032 3300025937 Bacteria 82757
145 Ga0207669_10000091 3300025937 Bacteria 45833
146 Ga0207669_10887849 3300025937 Bacteria 744
147 Ga0207704_10325358 3300025938 Bacteria 1188
148 Ga0207665_10110029 3300025939 Bacteria 1935
149 Ga0207665_10238317 3300025939 Bacteria 1339
150 Ga0207711_10339887 3300025941 Bacteria 1389
151 Ga0207689_10728926 3300025942 Unclassified 836
152 Ga0207679_10044566 3300025945 Bacteria 3201
153 Ga0207667_10409718 3300025949 Bacteria 1380
154 Ga0207651_10011382 3300025960 Bacteria 4980
155 Ga0207712_10195037 3300025961 Bacteria 1601
156 Ga0207712_10538136 3300025961 Bacteria 1003
157 Ga0207640_10168629 3300025981 Bacteria 1629
158 Ga0207658_10314679 3300025986 Bacteria 1353
159 Ga0207677_10115083 3300026023 Bacteria 2011
160 Ga0207703_10000122 3300026035 Bacteria 92656
161 Ga0207639_10176415 3300026041 Bacteria 1814
162 Ga0207678_10121902 3300026067 Bacteria 2225
163 Ga0207708_10004279 3300026075 Bacteria 10512
164 Ga0207708_10625913 3300026075 Unclassified 914
165 Ga0207702_10058674 3300026078 Bacteria 3276
166 Ga0207702_10091054 3300026078 Bacteria 2670
167 Ga0207641_10004106 3300026088 Bacteria 12687
168 Ga0207641_10178912 3300026088 Bacteria 1941
169 Ga0207648_10008333 3300026089 Bacteria 10057
170 Ga0207675_100115977 3300026118 Bacteria 2531
171 Ga0207675_100382243 3300026118 Bacteria 1385
172 Ga0207683_10137921 3300026121 Bacteria 2196
173 Ga0268266_10048004 3300028379 Bacteria 3659
174 Ga0268264_10004592 3300028381 Bacteria 11736
175 Ga0268264_10888994 3300028381 Bacteria 894
176 Ga0265337_1000123 3300028556 Bacteria 39654
177 Ga0265326_10000111 3300028558 Bacteria 41592
178 Ga0265322_10000005 3300028654 Bacteria 246112
179 Ga0265336_10005488 3300028666 Bacteria 4674
180 Ga0265338_10244914 3300028800 Bacteria 1326
181 Ga0265324_10001504 3300029957 Bacteria 13183
182 Ga0265320_10000293 3300031240 Bacteria 40653
183 Ga0265329_10008722 3300031242 Bacteria 3827
184 Ga0265331_10001064 3300031250 Bacteria 21387
185 Ga0265327_10000040 3300031251 Bacteria 291052
186 Ga0265316_10037923 3300031344 Bacteria 3886
187 Ga0265314_10000983 3300031711 Bacteria 33551
188 Ga0373956_0237116 3300035119 Bacteria 867
189 Ga0373937_0032638 3300036401 Bacteria 4723
190 Ga0373937_0091498 3300036401 Bacteria 2819
191 Ga0373925_0696094 3300037068 Bacteria 838
192 Ga0395898_0235596 3300037466 Bacteria 1746
193 Ga0436364_0456615 3300037853 Bacteria 3272
194 Ga0395901_0511682 3300038443 Bacteria 1221
195 Ga0436362_1159079 3300039453 Bacteria 3113
196 Ga0451800_0880557 3300041459 Unclassified 885
197 Ga0451833_0300046 3300041491 Bacteria 681
198 Ga0451835_0709387 3300041492 Bacteria 525
199 Ga0451847_0058565 3300041503 Unclassified 805
200 Ga0451853_0655662 3300041512 Unclassified 654
201 Ga0451853_2493003 3300041512 Bacteria 619
202 Ga0466966_0020605 3300044684 Bacteria 4333
203 Ga0466961_0295775 3300044693 Bacteria 989
204 Ga0466963_0069499 3300044694 Bacteria 2367
205 Ga0466971_0143395 3300044719 Archaea 1113
206 Ga0466971_0192419 3300044719 Bacteria 961
207 Ga0466957_0112018 3300044842 Bacteria 1731
208 Ga0466957_0122430 3300044842 Bacteria 1659
209 Ga0466957_0602207 3300044842 Bacteria 769
210 Ga0466959_0049759 3300045049 Bacteria 3078
211 Ga0466958_0004355 3300045836 Bacteria 7468
212 Ga0466958_0026443 3300045836 Bacteria 3429
213 Ga0495592_0000424 3300046454 Bacteria 32002
214 Ga0495592_0451956 3300046454 Bacteria 805
215 Ga0495603_0023061 3300046455 Bacteria 3768
216 Ga0495629_0017785 3300046459 Bacteria 5095
217 Ga0495638_0009281 3300046460 Bacteria 6914
218 Ga0495641_0088488 3300046461 Bacteria 1385
219 Ga0495651_0075210 3300046462 Bacteria 2561
220 Ga0495653_0006069 3300046463 Bacteria 9900
221 Ga0495653_0021809 3300046463 Bacteria 5185
222 Ga0495653_0027674 3300046463 Bacteria 4538
223 Ga0495653_0214542 3300046463 Bacteria 1298
224 Ga0495653_0437985 3300046463 Bacteria 824
225 Ga0495662_0000178 3300046476 Bacteria 25519
226 Ga0495662_0009169 3300046476 Bacteria 4855
227 Ga0495608_0003416 3300046511 Bacteria 11374
228 Ga0495618_0000037 3300046514 Bacteria 99735
229 Ga0495628_0011893 3300046516 Bacteria 7340
230 Ga0495628_0014655 3300046516 Bacteria 6566
231 Ga0495628_0569278 3300046516 Bacteria 812
232 Ga0495630_0000586 3300046517 Bacteria 26542
233 Ga0495630_0234724 3300046517 Bacteria 1401
234 Ga0495652_0000009 3300046529 Bacteria 311000
235 Ga0495586_0008630 3300046535 Bacteria 5425
236 Ga0495587_0006510 3300046536 Bacteria 7611
237 Ga0495587_0091741 3300046536 Bacteria 1754
238 Ga0495668_0060415 3300046616 Bacteria 2091
239 Ga0495634_0000021 3300046642 Bacteria 120521
240 Ga0495634_0572279 3300046642 Bacteria 657
241 Ga0495625_0004612 3300046660 Bacteria 12954
242 Ga0495635_0453871 3300046663 Bacteria 847
243 Ga0495657_0000040 3300046675 Bacteria 115899
244 Ga0495657_0003546 3300046675 Bacteria 12724
245 Ga0495669_0006178 3300046684 Bacteria 4997
246 Ga0495613_0000190 3300046689 Bacteria 60696
247 Ga0495613_0101824 3300046689 Bacteria 2074
248 Ga0495600_0001515 3300046809 Bacteria 12898
249 Ga0495600_0472644 3300046809 Unclassified 773
250 Ga0495604_0408562 3300047317 Bacteria 893
251 Ga0495674_0000010 3300047319 Bacteria 285794
252 Ga0495674_0335181 3300047319 Unclassified 1230
253 Ga0495676_0000860 3300047321 Bacteria 25376
254 Ga0495676_0002889 3300047321 Bacteria 15495
255 Ga0495680_0008091 3300047322 Bacteria 9587
256 Ga0495680_0008542 3300047322 Bacteria 9301
257 Ga0495680_0595461 3300047322 Bacteria 740
258 Ga0495675_0000051 3300047444 Bacteria 80375
259 Ga0495675_0445312 3300047444 Bacteria 750
260 Ga0495684_0100321 3300047471 Bacteria 2189
261 Ga0495686_0029983 3300047472 Bacteria 3535
262 Ga0495686_0289757 3300047472 Unclassified 907
263 Ga0496100_0000001 3300048903 Bacteria 530179
264 Ga0496100_0000024 3300048903 Bacteria 116138
265 Ga0496101_0000028 3300048904 Bacteria 198664
266 Ga0496101_0000072 3300048904 Bacteria 116138
267 Ga0496101_0019253 3300048904 Bacteria 4658
268 Ga0496102_0056519 3300048905 Bacteria 3580
269 Ga0496102_0354668 3300048905 Unclassified 1381
270 Ga0496102_0936236 3300048905 Bacteria 788
271 Ga0496104_0000214 3300048907 Bacteria 51141
272 Ga0496104_0035858 3300048907 Bacteria 4633
273 Ga0496104_1294125 3300048907 Bacteria 632
274 Ga0496105_0000876 3300048908 Bacteria 20602
275 Ga0496105_0013509 3300048908 Bacteria 6485
276 Ga0496105_0935041 3300048908 Bacteria 652
277 Ga0496106_0000040 3300048909 Bacteria 108754
278 Ga0496106_0000055 3300048909 Bacteria 91570
279 Ga0496106_0013105 3300048909 Bacteria 6118
280 Ga0496107_0000002 3300048910 Bacteria 320871
281 Ga0496107_0000025 3300048910 Bacteria 116138
282 Ga0496108_0000178 3300048911 Bacteria 58913
283 Ga0496108_0041269 3300048911 Bacteria 3851
284 Ga0496109_0001026 3300048912 Bacteria 23100
285 Ga0496109_0010089 3300048912 Bacteria 8060
286 Ga0496109_0038438 3300048912 Bacteria 4326
287 Ga0496109_0482497 3300048912 Unclassified 1170
288 Ga0496109_0606391 3300048912 Bacteria 1031
289 Ga0496109_1291036 3300048912 Bacteria 666
290 Ga0496110_0038770 3300048913 Bacteria 4147
291 Ga0496110_0645197 3300048913 Bacteria 958
292 Ga0496111_0009258 3300048914 Bacteria 6565
293 Ga0496111_0049188 3300048914 Bacteria 3039
294 Ga0496112_0984767 3300048915 Unclassified 763
295 Ga0496113_0091370 3300048916 Bacteria 2346
296 Ga0496113_0108141 3300048916 Bacteria 2161
297 Ga0496113_0241945 3300048916 Bacteria 1440
298 Ga0496114_0000003 3300048917 Bacteria 630981
299 Ga0496115_0000031 3300048918 Bacteria 138258
300 Ga0496115_0016776 3300048918 Bacteria 5581
301 Ga0496115_0341591 3300048918 Bacteria 1222
302 Ga0496118_0287556 3300048921 Unclassified 911
303 Ga0501039_0227462 3300049575 Unclassified 1466
304 Ga0501042_0062044 3300049578 Bacteria 2670
305 Ga0501042_0441641 3300049578 Bacteria 943
306 Ga0501048_0593916 3300049582 Bacteria 795
307 Ga0501070_0177541 3300049586 Unclassified 1753
308 Ga0501072_0037399 3300049588 Bacteria 3807
309 Ga0501075_0232460 3300049591 Unclassified 1406
310 Ga0501076_0853676 3300049592 Unclassified 751
311 Ga0501080_0423273 3300049742 Bacteria 1196
312 Ga0501081_0017973 3300049743 Bacteria 4690
313 nmdc:mga05p37_414860_c1 3300050507 Bacteria 1568
314 nmdc:mga09592_748719_c1 3300050508 Bacteria 829
315 nmdc:mga06r32_1113883_c1 3300050510 Bacteria 738
316 nmdc:mga06r32_176064_c1 3300050510 Bacteria 2124
317 nmdc:mga06r32_264767_c1 3300050510 Bacteria 1706
318 nmdc:mga0n895_115687_c1 3300050512 Bacteria 2700
319 nmdc:mga0rr50_386394_c1 3300050513 Bacteria 1181
320 nmdc:mga0rr50_417815_c1 3300050513 Bacteria 1134
321 nmdc:mga0a205_27717_c1 3300050515 Bacteria 5410
322 nmdc:mga0a205_45198_c1 3300050515 Bacteria 4246
323 Ga0495601_0000022 3300053077 Bacteria 148418
324 Ga0495601_0051464 3300053077 Unclassified 2599
325 Ga0495601_0393711 3300053077 Unclassified 899
326 Ga0495612_0019928 3300053078 Bacteria 2687
327 Ga0495655_0000005 3300053083 Bacteria 257472
328 Ga0495595_0000009 3300053084 Bacteria 193039
329 Ga0495595_0000213 3300053084 Bacteria 23371
330 Ga0495619_0000001 3300053085 Bacteria 586054
331 Ga0495619_0000057 3300053085 Bacteria 93948
332 Ga0495619_0000119 3300053085 Bacteria 58302
333 Ga0495619_0030999 3300053085 Bacteria 3463
334 Ga0495619_0323485 3300053085 Bacteria 1067
335 Ga0500641_0001110 3300053096 Bacteria 9563
336 Ga0500628_000013 3300053129 Bacteria 106419
337 Ga0466962_0007152 3300061719 Bacteria 5347

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049742 Ga0501080_0423273 Ga0501080_0423273_168_596 132
2 3300005337 Ga0070682_100175009 Ga0070682_1001750092 136
3 3300005843 Ga0068860_101868824 Ga0068860_1018688241 136
4 3300048907 Ga0496104_1294125 Ga0496104_1294125_178_600 136
5 3300005614 Ga0068856_100909005 Ga0068856_1009090052 137
6 3300025929 Ga0207664_10339480 Ga0207664_103394802 137
7 3300044694 Ga0466963_0069499 Ga0466963_0069499_402_830 138
8 3300005341 Ga0070691_10000003 Ga0070691_1000000339 139
9 3300005435 Ga0070714_100049650 Ga0070714_1000496505 139
10 3300005444 Ga0070694_100999797 Ga0070694_1009997971 139
11 3300005545 Ga0070695_100203172 Ga0070695_1002031721 139
12 3300013308 Ga0157375_10252582 Ga0157375_102525822 139
13 3300036401 Ga0373937_0091498 Ga0373937_0091498_1528_1950 139
14 3300044719 Ga0466971_0143395 Ga0466971_0143395_322_756 139
15 3300044719 Ga0466971_0192419 Ga0466971_0192419_254_688 139
16 3300044842 Ga0466957_0122430 Ga0466957_0122430_1102_1536 139
17 3300044842 Ga0466957_0602207 Ga0466957_0602207_256_690 139
18 3300045836 Ga0466958_0004355 Ga0466958_0004355_4014_4448 139
19 3300048908 Ga0496105_0935041 Ga0496105_0935041_202_633 139
20 3300000546 LJNas_1028072 LJNas_10280721 140
21 3300002074 JGI24748J21848_1004831 JGI24748J21848_10048313 140
22 3300002077 JGI24744J21845_10021457 JGI24744J21845_100214571 140
23 3300002239 JGI24034J26672_10000072 JGI24034J26672_1000007225 140
24 3300003203 JGI25406J46586_10109147 JGI25406J46586_101091471 140
25 3300005327 Ga0070658_10424084 Ga0070658_104240842 140
26 3300005329 Ga0070683_100018331 Ga0070683_1000183317 140
27 3300005330 Ga0070690_100682484 Ga0070690_1006824842 140
28 3300005334 Ga0068869_100231015 Ga0068869_1002310151 140
29 3300005337 Ga0070682_100686889 Ga0070682_1006868892 140
30 3300005338 Ga0068868_100041450 Ga0068868_1000414504 140
31 3300005340 Ga0070689_100032489 Ga0070689_1000324895 140
32 3300005344 Ga0070661_100040357 Ga0070661_1000403574 140
33 3300005347 Ga0070668_100037466 Ga0070668_1000374663 140
34 3300005354 Ga0070675_100095849 Ga0070675_1000958492 140
35 3300005355 Ga0070671_100075990 Ga0070671_1000759904 140
36 3300005356 Ga0070674_100000021 Ga0070674_1000000219 140
37 3300005356 Ga0070674_100000075 Ga0070674_1000000757 140
38 3300005364 Ga0070673_100053915 Ga0070673_1000539152 140
39 3300005365 Ga0070688_100112992 Ga0070688_1001129923 140
40 3300005367 Ga0070667_100356459 Ga0070667_1003564592 140
41 3300005435 Ga0070714_100195468 Ga0070714_1001954682 140
42 3300005435 Ga0070714_100606837 Ga0070714_1006068372 140
43 3300005436 Ga0070713_100065208 Ga0070713_1000652083 140
44 3300005436 Ga0070713_102328883 Ga0070713_1023288831 140
45 3300005437 Ga0070710_10100267 Ga0070710_101002672 140
46 3300005439 Ga0070711_100060328 Ga0070711_1000603283 140
47 3300005440 Ga0070705_100050291 Ga0070705_1000502914 140
48 3300005441 Ga0070700_100018446 Ga0070700_1000184464 140
49 3300005441 Ga0070700_100298839 Ga0070700_1002988392 140
50 3300005444 Ga0070694_100181753 Ga0070694_1001817532 140
51 3300005455 Ga0070663_100136722 Ga0070663_1001367222 140
52 3300005456 Ga0070678_100094289 Ga0070678_1000942894 140
53 3300005457 Ga0070662_100028924 Ga0070662_1000289242 140
54 3300005459 Ga0068867_100035861 Ga0068867_1000358613 140
55 3300005466 Ga0070685_10208500 Ga0070685_102085002 140
56 3300005535 Ga0070684_100013797 Ga0070684_1000137975 140
57 3300005535 Ga0070684_100111403 Ga0070684_1001114033 140
58 3300005544 Ga0070686_100023585 Ga0070686_1000235853 140
59 3300005545 Ga0070695_100347416 Ga0070695_1003474161 140
60 3300005547 Ga0070693_100091085 Ga0070693_1000910852 140
61 3300005547 Ga0070693_101289894 Ga0070693_1012898941 140
62 3300005548 Ga0070665_100050754 Ga0070665_1000507544 140
63 3300005548 Ga0070665_101151214 Ga0070665_1011512142 140
64 3300005549 Ga0070704_100032903 Ga0070704_1000329034 140
65 3300005563 Ga0068855_100294328 Ga0068855_1002943283 140
66 3300005563 Ga0068855_100732930 Ga0068855_1007329302 140
67 3300005564 Ga0070664_100039147 Ga0070664_1000391474 140
68 3300005564 Ga0070664_100838884 Ga0070664_1008388842 140
69 3300005577 Ga0068857_100169314 Ga0068857_1001693142 140
70 3300005614 Ga0068856_100081106 Ga0068856_1000811062 140
71 3300005614 Ga0068856_100102468 Ga0068856_1001024684 140
72 3300005616 Ga0068852_100037402 Ga0068852_1000374024 140
73 3300005616 Ga0068852_100667368 Ga0068852_1006673681 140
74 3300005617 Ga0068859_100207928 Ga0068859_1002079283 140
75 3300005618 Ga0068864_100036766 Ga0068864_1000367664 140
76 3300005718 Ga0068866_10000007 Ga0068866_1000000794 140
77 3300005718 Ga0068866_10000469 Ga0068866_100004699 140
78 3300005718 Ga0068866_10037280 Ga0068866_100372803 140
79 3300005718 Ga0068866_10224568 Ga0068866_102245682 140
80 3300005719 Ga0068861_100118415 Ga0068861_1001184152 140
81 3300005841 Ga0068863_100001610 Ga0068863_10000161017 140
82 3300005841 Ga0068863_100021205 Ga0068863_1000212052 140
83 3300005842 Ga0068858_100000329 Ga0068858_10000032934 140
84 3300005843 Ga0068860_100003031 Ga0068860_10000303113 140
85 3300005937 Ga0081455_10359908 Ga0081455_103599081 140
86 3300005985 Ga0081539_10003837 Ga0081539_1000383713 140
87 3300006163 Ga0070715_10000003 Ga0070715_10000003325 140
88 3300006173 Ga0070716_100087836 Ga0070716_1000878363 140
89 3300006175 Ga0070712_100003453 Ga0070712_1000034537 140
90 3300006846 Ga0075430_100771777 Ga0075430_1007717771 140
91 3300006847 Ga0075431_100302888 Ga0075431_1003028882 140
92 3300006852 Ga0075433_10018893 Ga0075433_100188935 140
93 3300006852 Ga0075433_11645102 Ga0075433_116451021 140
94 3300006881 Ga0068865_100607314 Ga0068865_1006073142 140
95 3300006914 Ga0075436_101195402 Ga0075436_1011954021 140
96 3300006931 Ga0097620_100207919 Ga0097620_1002079193 140
97 3300007076 Ga0075435_100100423 Ga0075435_1001004231 140
98 3300009094 Ga0111539_10117137 Ga0111539_101171374 140
99 3300009098 Ga0105245_10007717 Ga0105245_100077175 140
100 3300009098 Ga0105245_11187618 Ga0105245_111876182 140
101 3300009101 Ga0105247_10000275 Ga0105247_100002758 140
102 3300009101 Ga0105247_10199380 Ga0105247_101993803 140
103 3300009147 Ga0114129_10120351 Ga0114129_101203514 140
104 3300009147 Ga0114129_10698015 Ga0114129_106980152 140
105 3300009148 Ga0105243_10045478 Ga0105243_100454784 140
106 3300009148 Ga0105243_10182966 Ga0105243_101829663 140
107 3300009176 Ga0105242_10000109 Ga0105242_1000010924 140
108 3300009176 Ga0105242_10006926 Ga0105242_100069268 140
109 3300009176 Ga0105242_10025228 Ga0105242_100252284 140
110 3300009177 Ga0105248_10433094 Ga0105248_104330943 140
111 3300009551 Ga0105238_10000016 Ga0105238_1000001621 140
112 3300009553 Ga0105249_10276286 Ga0105249_102762862 140
113 3300010375 Ga0105239_10043885 Ga0105239_100438855 140
114 3300010375 Ga0105239_11113600 Ga0105239_111136001 140
115 3300011119 Ga0105246_10017323 Ga0105246_100173237 140
116 3300013104 Ga0157370_10020561 Ga0157370_100205616 140
117 3300013306 Ga0163162_10122398 Ga0163162_101223984 140
118 3300013307 Ga0157372_10017307 Ga0157372_100173078 140
119 3300013308 Ga0157375_10000126 Ga0157375_1000012684 140
120 3300013308 Ga0157375_10012323 Ga0157375_100123236 140
121 3300013308 Ga0157375_10015812 Ga0157375_100158126 140
122 3300014325 Ga0163163_10051219 Ga0163163_100512194 140
123 3300014326 Ga0157380_10279612 Ga0157380_102796122 140
124 3300014745 Ga0157377_10014431 Ga0157377_100144312 140
125 3300014968 Ga0157379_10322038 Ga0157379_103220383 140
126 3300014969 Ga0157376_10583996 Ga0157376_105839962 140
127 3300017792 Ga0163161_10000013 Ga0163161_1000001398 140
128 3300017792 Ga0163161_10139565 Ga0163161_101395654 140
129 3300025898 Ga0207692_10105345 Ga0207692_101053452 140
130 3300025899 Ga0207642_10000008 Ga0207642_10000008102 140
131 3300025899 Ga0207642_10000181 Ga0207642_100001818 140
132 3300025899 Ga0207642_10046972 Ga0207642_100469723 140
133 3300025901 Ga0207688_10027077 Ga0207688_100270774 140
134 3300025905 Ga0207685_10000003 Ga0207685_10000003319 140
135 3300025906 Ga0207699_10213787 Ga0207699_102137873 140
136 3300025908 Ga0207643_10552925 Ga0207643_105529251 140
137 3300025914 Ga0207671_10126432 Ga0207671_101264323 140
138 3300025915 Ga0207693_10052410 Ga0207693_100524104 140
139 3300025916 Ga0207663_10046208 Ga0207663_100462084 140
140 3300025924 Ga0207694_10000012 Ga0207694_10000012400 140
141 3300025926 Ga0207659_10062614 Ga0207659_100626142 140
142 3300025927 Ga0207687_10028321 Ga0207687_100283214 140
143 3300025928 Ga0207700_10497477 Ga0207700_104974772 140
144 3300025928 Ga0207700_11623534 Ga0207700_116235342 140
145 3300025929 Ga0207664_10182591 Ga0207664_101825913 140
146 3300025929 Ga0207664_10615437 Ga0207664_106154372 140
147 3300025931 Ga0207644_10080366 Ga0207644_100803662 140
148 3300025932 Ga0207690_10275532 Ga0207690_102755323 140
149 3300025933 Ga0207706_10009222 Ga0207706_100092227 140
150 3300025934 Ga0207686_10000212 Ga0207686_1000021247 140
151 3300025934 Ga0207686_10004392 Ga0207686_100043927 140
152 3300025935 Ga0207709_10018925 Ga0207709_100189252 140
153 3300025935 Ga0207709_10101087 Ga0207709_101010873 140
154 3300025937 Ga0207669_10000032 Ga0207669_100000329 140
155 3300025937 Ga0207669_10000091 Ga0207669_1000009148 140
156 3300025937 Ga0207669_10887849 Ga0207669_108878492 140
157 3300025938 Ga0207704_10325358 Ga0207704_103253582 140
158 3300025939 Ga0207665_10110029 Ga0207665_101100292 140
159 3300025939 Ga0207665_10238317 Ga0207665_102383172 140
160 3300025941 Ga0207711_10339887 Ga0207711_103398872 140
161 3300025942 Ga0207689_10728926 Ga0207689_107289262 140
162 3300025945 Ga0207679_10044566 Ga0207679_100445665 140
163 3300025949 Ga0207667_10409718 Ga0207667_104097182 140
164 3300025960 Ga0207651_10011382 Ga0207651_100113826 140
165 3300025961 Ga0207712_10195037 Ga0207712_101950373 140
166 3300025961 Ga0207712_10538136 Ga0207712_105381362 140
167 3300025981 Ga0207640_10168629 Ga0207640_101686292 140
168 3300025986 Ga0207658_10314679 Ga0207658_103146792 140
169 3300026023 Ga0207677_10115083 Ga0207677_101150833 140
170 3300026035 Ga0207703_10000122 Ga0207703_1000012221 140
171 3300026041 Ga0207639_10176415 Ga0207639_101764152 140
172 3300026067 Ga0207678_10121902 Ga0207678_101219023 140
173 3300026075 Ga0207708_10004279 Ga0207708_1000427910 140
174 3300026075 Ga0207708_10625913 Ga0207708_106259132 140
175 3300026078 Ga0207702_10058674 Ga0207702_100586745 140
176 3300026078 Ga0207702_10091054 Ga0207702_100910543 140
177 3300026088 Ga0207641_10004106 Ga0207641_100041067 140
178 3300026088 Ga0207641_10178912 Ga0207641_101789122 140
179 3300026089 Ga0207648_10008333 Ga0207648_100083339 140
180 3300026118 Ga0207675_100115977 Ga0207675_1001159772 140
181 3300026118 Ga0207675_100382243 Ga0207675_1003822432 140
182 3300026121 Ga0207683_10137921 Ga0207683_101379214 140
183 3300028379 Ga0268266_10048004 Ga0268266_100480045 140
184 3300028381 Ga0268264_10004592 Ga0268264_100045925 140
185 3300028381 Ga0268264_10888994 Ga0268264_108889941 140
186 3300028556 Ga0265337_1000123 Ga0265337_100012316 140
187 3300028558 Ga0265326_10000111 Ga0265326_1000011116 140
188 3300028654 Ga0265322_10000005 Ga0265322_10000005237 140
189 3300028666 Ga0265336_10005488 Ga0265336_100054886 140
190 3300028800 Ga0265338_10244914 Ga0265338_102449142 140
191 3300029957 Ga0265324_10001504 Ga0265324_100015045 140
192 3300031240 Ga0265320_10000293 Ga0265320_1000029315 140
193 3300031242 Ga0265329_10008722 Ga0265329_100087223 140
194 3300031250 Ga0265331_10001064 Ga0265331_1000106415 140
195 3300031251 Ga0265327_10000040 Ga0265327_1000004023 140
196 3300031344 Ga0265316_10037923 Ga0265316_100379232 140
197 3300031711 Ga0265314_10000983 Ga0265314_1000098323 140
198 3300035119 Ga0373956_0237116 Ga0373956_0237116_224_652 140
199 3300036401 Ga0373937_0032638 Ga0373937_0032638_592_1020 140
200 3300037068 Ga0373925_0696094 Ga0373925_0696094_353_817 140
201 3300037466 Ga0395898_0235596 Ga0395898_0235596_69_503 140
202 3300037853 Ga0436364_0456615 Ga0436364_0456615_2521_2955 140
203 3300038443 Ga0395901_0511682 Ga0395901_0511682_508_942 140
204 3300039453 Ga0436362_1159079 Ga0436362_1159079_2136_2570 140
205 3300041459 Ga0451800_0880557 Ga0451800_0880557_253_675 140
206 3300041491 Ga0451833_0300046 Ga0451833_0300046_89_613 140
207 3300041492 Ga0451835_0709387 Ga0451835_0709387_69_491 140
208 3300041503 Ga0451847_0058565 Ga0451847_0058565_41_463 140
209 3300041512 Ga0451853_0655662 Ga0451853_0655662_163_585 140
210 3300041512 Ga0451853_2493003 Ga0451853_2493003_125_547 140
211 3300044684 Ga0466966_0020605 Ga0466966_0020605_1369_1803 140
212 3300044693 Ga0466961_0295775 Ga0466961_0295775_482_916 140
213 3300044842 Ga0466957_0112018 Ga0466957_0112018_1050_1484 140
214 3300045049 Ga0466959_0049759 Ga0466959_0049759_804_1238 140
215 3300045836 Ga0466958_0026443 Ga0466958_0026443_838_1272 140
216 3300046454 Ga0495592_0000424 Ga0495592_0000424_11739_12161 140
217 3300046454 Ga0495592_0451956 Ga0495592_0451956_369_791 140
218 3300046455 Ga0495603_0023061 Ga0495603_0023061_848_1270 140
219 3300046459 Ga0495629_0017785 Ga0495629_0017785_2704_3126 140
220 3300046460 Ga0495638_0009281 Ga0495638_0009281_3785_4207 140
221 3300046461 Ga0495641_0088488 Ga0495641_0088488_885_1307 140
222 3300046462 Ga0495651_0075210 Ga0495651_0075210_1927_2349 140
223 3300046463 Ga0495653_0006069 Ga0495653_0006069_3636_4058 140
224 3300046463 Ga0495653_0021809 Ga0495653_0021809_4107_4529 140
225 3300046463 Ga0495653_0027674 Ga0495653_0027674_3466_3918 140
226 3300046463 Ga0495653_0214542 Ga0495653_0214542_331_759 140
227 3300046463 Ga0495653_0437985 Ga0495653_0437985_180_602 140
228 3300046476 Ga0495662_0000178 Ga0495662_0000178_5739_6161 140
229 3300046476 Ga0495662_0009169 Ga0495662_0009169_1239_1661 140
230 3300046511 Ga0495608_0003416 Ga0495608_0003416_8997_9419 140
231 3300046514 Ga0495618_0000037 Ga0495618_0000037_85913_86335 140
232 3300046516 Ga0495628_0011893 Ga0495628_0011893_4040_4462 140
233 3300046516 Ga0495628_0014655 Ga0495628_0014655_900_1322 140
234 3300046516 Ga0495628_0569278 Ga0495628_0569278_272_694 140
235 3300046517 Ga0495630_0000586 Ga0495630_0000586_19564_19986 140
236 3300046517 Ga0495630_0234724 Ga0495630_0234724_589_1011 140
237 3300046529 Ga0495652_0000009 Ga0495652_0000009_174125_174547 140
238 3300046535 Ga0495586_0008630 Ga0495586_0008630_2951_3373 140
239 3300046536 Ga0495587_0006510 Ga0495587_0006510_3984_4406 140
240 3300046536 Ga0495587_0091741 Ga0495587_0091741_751_1173 140
241 3300046616 Ga0495668_0060415 Ga0495668_0060415_10_432 140
242 3300046642 Ga0495634_0000021 Ga0495634_0000021_45128_45580 140
243 3300046642 Ga0495634_0572279 Ga0495634_0572279_169_597 140
244 3300046660 Ga0495625_0004612 Ga0495625_0004612_11191_11613 140
245 3300046663 Ga0495635_0453871 Ga0495635_0453871_367_795 140
246 3300046675 Ga0495657_0000040 Ga0495657_0000040_27669_28133 140
247 3300046675 Ga0495657_0003546 Ga0495657_0003546_6715_7137 140
248 3300046684 Ga0495669_0006178 Ga0495669_0006178_3127_3549 140
249 3300046689 Ga0495613_0000190 Ga0495613_0000190_12524_12946 140
250 3300046689 Ga0495613_0101824 Ga0495613_0101824_62_514 140
251 3300046809 Ga0495600_0001515 Ga0495600_0001515_7263_7685 140
252 3300046809 Ga0495600_0472644 Ga0495600_0472644_183_635 140
253 3300047317 Ga0495604_0408562 Ga0495604_0408562_321_749 140
254 3300047319 Ga0495674_0000010 Ga0495674_0000010_283558_283980 140
255 3300047319 Ga0495674_0335181 Ga0495674_0335181_782_1210 140
256 3300047321 Ga0495676_0000860 Ga0495676_0000860_17279_17710 140
257 3300047321 Ga0495676_0002889 Ga0495676_0002889_4791_5213 140
258 3300047322 Ga0495680_0008091 Ga0495680_0008091_5093_5515 140
259 3300047322 Ga0495680_0008542 Ga0495680_0008542_3634_4083 140
260 3300047322 Ga0495680_0595461 Ga0495680_0595461_129_557 140
261 3300047444 Ga0495675_0000051 Ga0495675_0000051_27641_28105 140
262 3300047444 Ga0495675_0445312 Ga0495675_0445312_316_738 140
263 3300047471 Ga0495684_0100321 Ga0495684_0100321_1125_1565 140
264 3300047472 Ga0495686_0029983 Ga0495686_0029983_2729_3151 140
265 3300047472 Ga0495686_0289757 Ga0495686_0289757_248_670 140
266 3300048903 Ga0496100_0000001 Ga0496100_0000001_120798_121229 140
267 3300048903 Ga0496100_0000024 Ga0496100_0000024_22378_22800 140
268 3300048904 Ga0496101_0000028 Ga0496101_0000028_120787_121218 140
269 3300048904 Ga0496101_0000072 Ga0496101_0000072_93339_93761 140
270 3300048904 Ga0496101_0019253 Ga0496101_0019253_1714_2178 140
271 3300048905 Ga0496102_0056519 Ga0496102_0056519_2196_2660 140
272 3300048905 Ga0496102_0354668 Ga0496102_0354668_444_866 140
273 3300048905 Ga0496102_0936236 Ga0496102_0936236_171_599 140
274 3300048907 Ga0496104_0000214 Ga0496104_0000214_14061_14483 140
275 3300048907 Ga0496104_0035858 Ga0496104_0035858_1874_2338 140
276 3300048908 Ga0496105_0000876 Ga0496105_0000876_13743_14165 140
277 3300048908 Ga0496105_0013509 Ga0496105_0013509_4671_5135 140
278 3300048909 Ga0496106_0000040 Ga0496106_0000040_14994_15416 140
279 3300048909 Ga0496106_0000055 Ga0496106_0000055_13717_14148 140
280 3300048909 Ga0496106_0013105 Ga0496106_0013105_3453_3917 140
281 3300048910 Ga0496107_0000002 Ga0496107_0000002_127259_127690 140
282 3300048910 Ga0496107_0000025 Ga0496107_0000025_22378_22800 140
283 3300048911 Ga0496108_0000178 Ga0496108_0000178_19600_20052 140
284 3300048911 Ga0496108_0041269 Ga0496108_0041269_1025_1489 140
285 3300048912 Ga0496109_0001026 Ga0496109_0001026_16482_16934 140
286 3300048912 Ga0496109_0010089 Ga0496109_0010089_6126_6578 140
287 3300048912 Ga0496109_0038438 Ga0496109_0038438_2363_2827 140
288 3300048912 Ga0496109_0482497 Ga0496109_0482497_634_1056 140
289 3300048912 Ga0496109_0606391 Ga0496109_0606391_147_581 140
290 3300048912 Ga0496109_1291036 Ga0496109_1291036_13_435 140
291 3300048913 Ga0496110_0038770 Ga0496110_0038770_874_1338 140
292 3300048913 Ga0496110_0645197 Ga0496110_0645197_374_802 140
293 3300048914 Ga0496111_0009258 Ga0496111_0009258_2038_2502 140
294 3300048914 Ga0496111_0049188 Ga0496111_0049188_996_1424 140
295 3300048915 Ga0496112_0984767 Ga0496112_0984767_87_509 140
296 3300048916 Ga0496113_0091370 Ga0496113_0091370_1621_2073 140
297 3300048916 Ga0496113_0108141 Ga0496113_0108141_300_722 140
298 3300048916 Ga0496113_0241945 Ga0496113_0241945_123_551 140
299 3300048917 Ga0496114_0000003 Ga0496114_0000003_550220_550642 140
300 3300048918 Ga0496115_0000031 Ga0496115_0000031_100861_101283 140
301 3300048918 Ga0496115_0016776 Ga0496115_0016776_1156_1578 140
302 3300048918 Ga0496115_0341591 Ga0496115_0341591_140_604 140
303 3300048921 Ga0496118_0287556 Ga0496118_0287556_317_739 140
304 3300049575 Ga0501039_0227462 Ga0501039_0227462_439_861 140
305 3300049578 Ga0501042_0062044 Ga0501042_0062044_366_788 140
306 3300049578 Ga0501042_0441641 Ga0501042_0441641_442_864 140
307 3300049582 Ga0501048_0593916 Ga0501048_0593916_216_638 140
308 3300049586 Ga0501070_0177541 Ga0501070_0177541_893_1336 140
309 3300049588 Ga0501072_0037399 Ga0501072_0037399_2554_2976 140
310 3300049591 Ga0501075_0232460 Ga0501075_0232460_243_665 140
311 3300049592 Ga0501076_0853676 Ga0501076_0853676_183_605 140
312 3300049743 Ga0501081_0017973 Ga0501081_0017973_536_958 140
313 3300050507 nmdc:mga05p37_414860_c1 nmdc:mga05p37_414860_c1_204_653 140
314 3300050508 nmdc:mga09592_748719_c1 nmdc:mga09592_748719_c1_329_775 140
315 3300050510 nmdc:mga06r32_1113883_c1 nmdc:mga06r32_1113883_c1_138_584 140
316 3300050510 nmdc:mga06r32_176064_c1 nmdc:mga06r32_176064_c1_488_937 140
317 3300050510 nmdc:mga06r32_264767_c1 nmdc:mga06r32_264767_c1_755_1201 140
318 3300050512 nmdc:mga0n895_115687_c1 nmdc:mga0n895_115687_c1_541_990 140
319 3300050513 nmdc:mga0rr50_386394_c1 nmdc:mga0rr50_386394_c1_22_444 140
320 3300050513 nmdc:mga0rr50_417815_c1 nmdc:mga0rr50_417815_c1_271_720 140
321 3300050515 nmdc:mga0a205_27717_c1 nmdc:mga0a205_27717_c1_3050_3505 140
322 3300050515 nmdc:mga0a205_45198_c1 nmdc:mga0a205_45198_c1_3565_4014 140
323 3300053077 Ga0495601_0000022 Ga0495601_0000022_67438_67860 140
324 3300053077 Ga0495601_0051464 Ga0495601_0051464_1069_1491 140
325 3300053077 Ga0495601_0393711 Ga0495601_0393711_62_490 140
326 3300053078 Ga0495612_0019928 Ga0495612_0019928_551_979 140
327 3300053083 Ga0495655_0000005 Ga0495655_0000005_184697_185119 140
328 3300053084 Ga0495595_0000009 Ga0495595_0000009_164907_165371 140
329 3300053084 Ga0495595_0000213 Ga0495595_0000213_4962_5384 140
330 3300053085 Ga0495619_0000001 Ga0495619_0000001_23872_24324 140
331 3300053085 Ga0495619_0000057 Ga0495619_0000057_87766_88230 140
332 3300053085 Ga0495619_0000119 Ga0495619_0000119_4403_4843 140
333 3300053085 Ga0495619_0030999 Ga0495619_0030999_1814_2242 140
334 3300053085 Ga0495619_0323485 Ga0495619_0323485_236_664 140
335 3300053096 Ga0500641_0001110 Ga0500641_0001110_8417_8839 140
336 3300053129 Ga0500628_000013 Ga0500628_000013_72529_72951 140
337 3300061719 Ga0466962_0007152 Ga0466962_0007152_2421_2855 140

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uad-assembly1.cif.gz_A ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.831 6 126
3nbr-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase d38np39gd99n from pseudomonas testosteroni (tksi) with 4-androstene-3,17-dione bound 0.821 6 126
1tuh-assembly1.cif.gz_A-2 structure of bal32a from a soil-derived mobile gene cassette 0.8103 8 128
3ec9-assembly1.cif.gz_A crystal structure of a ntf2-like protein (bth_i0051) from burkholderia thailandensis e264 at 1.60 a resolution 0.7953 7 126
3ebt-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (bpss0132) from burkholderia pseudomallei k96243 at 1.30 a resolution 0.7931 8 125
ID Description Score Start End Superfamily
af_I1LCK9_37_142_1.10.520.10 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1; 0.8138 23 122 1.10.520.10
1tuhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8103 8 128 3.10.450.50
af_I6XW93_5_142_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7977 8 131 3.10.450.50
6d34B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7928 8 125 3.10.450.50
3fh1A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7785 7 123 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A2W5XU91-F1-model_v4 SnoaL-like domain-containing protein 0.9966 1 137
AF-A0A838V0I2-F1-model_v4 SnoaL-like domain-containing protein 0.9733 1 140
AF-A0A1F8RRN4-F1-model_v4 SnoaL-like domain-containing protein 0.9715 1 138
AF-D3F1P6-F1-model_v4 SnoaL-like domain-containing protein 0.971 3 136
AF-A0A2W5XU91-F1-model_v4 SnoaL-like domain-containing protein 0.9684 1 137

Feature Viewer

pLDDT pTM Quality
93.2 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map