F413110

General Info

Members Datasets Scaffolds Average Seq Length
337 208 674 176

Family's Representative Sequence

Representative Sequence 3300025918|Ga0207662_10072505|Ga0207662_100725053
Length 218
Sequence MSDQFVAEIRIFPFNFPPTGWAFCDGQLMPISQNTALFSLLGTTYGGDGKSTFALPDMQGNAPMQPGQGQGLSLRDLGEMSGVESITLLVSEIPVHTHTMTSHNLDFADKQNPDPQSMIAKSANGNAYQTNTSTLLTTMAFQGLAPAGGGFHSDQRGADRPCRAGRAAHRLRPGSVAAGASTLCRRPRWRPVLSSHPRTAAGLRGSGRLGAGALRRPR

Samples

Sample ID Description Type Environment
1 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
151 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
161 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
162 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
163 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
164 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
175 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
176 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
177 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
178 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
179 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
180 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
181 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
182 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
183 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
184 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
185 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
186 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
187 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
188 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
189 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
190 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
191 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
192 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
193 3300049852 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control Metagenome Rhizosphere
194 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
195 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
196 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.44
Metatranscriptomes 3.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.15
Nodule 0
Rhizoplane 1.48
Rhizosphere 92.88
Stem 0
Stem Tuber 0
Unclassified 10.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207662_10072505 3300025918 Bacteria 2087
2 SwRhRL3b_contig_2124036 2162886006 Bacteria 928
3 SwRhRL2b_contig_218131 2162886007 Bacteria 903
4 SwRhRL2b_contig_3061735 2162886007 Bacteria 1035
5 MBSR1b_contig_35550 2162886012 Bacteria 1353
6 CNAas_1000839 3300000532 Bacteria 2907
7 rootL2_10219126 3300003322 Bacteria 2599
8 Ga0058859_11272668 3300004798 Unclassified 587
9 Ga0058863_11418228 3300004799 Bacteria 2209
10 Ga0058861_10094560 3300004800 Bacteria 2028
11 Ga0058862_11746648 3300004803 Bacteria 2008
12 Ga0065704_10003045 3300005289 Bacteria 5699
13 Ga0065715_10100678 3300005293 Bacteria 3280
14 Ga0065715_10138819 3300005293 Bacteria 1886
15 Ga0065715_10185485 3300005293 Bacteria 1448
16 Ga0065715_10549561 3300005293 Bacteria 717
17 Ga0065707_10002730 3300005295 Bacteria 5561
18 Ga0070676_10075972 3300005328 Bacteria 2027
19 Ga0070670_100370153 3300005331 Bacteria 1261
20 Ga0068869_100069864 3300005334 Unclassified 2598
21 Ga0070680_100000437 3300005336 Bacteria 28394
22 Ga0070680_100574321 3300005336 Bacteria 967
23 Ga0070682_100001148 3300005337 Bacteria 15112
24 Ga0068868_100198131 3300005338 Bacteria 1673
25 Ga0068868_100233221 3300005338 Bacteria 1544
26 Ga0070660_100129079 3300005339 Viruses 2022
27 Ga0070689_100248105 3300005340 Unclassified 1468
28 Ga0070689_100488167 3300005340 Bacteria 1053
29 Ga0070691_10486339 3300005341 Unclassified 711
30 Ga0070687_100000723 3300005343 Bacteria 10990
31 Ga0070687_100083582 3300005343 Bacteria 1748
32 Ga0070692_10005032 3300005345 Bacteria 5589
33 Ga0070692_10007688 3300005345 Bacteria 4765
34 Ga0070692_10051537 3300005345 Bacteria 2141
35 Ga0070692_10411434 3300005345 Bacteria 856
36 Ga0070692_10457124 3300005345 Viruses 818
37 Ga0070675_100754473 3300005354 Bacteria 888
38 Ga0070659_100002961 3300005366 Bacteria 12106
39 Ga0070703_10008816 3300005406 Bacteria 2840
40 Ga0070701_10155246 3300005438 Bacteria 1321
41 Ga0070705_100012212 3300005440 Unclassified 4360
42 Ga0070705_100032854 3300005440 Bacteria 2887
43 Ga0070700_100000913 3300005441 Bacteria 14589
44 Ga0070700_100033184 3300005441 Unclassified 3108
45 Ga0070700_100234206 3300005441 Bacteria 1308
46 Ga0070694_100001863 3300005444 Bacteria 12489
47 Ga0070694_100007175 3300005444 Bacteria 6786
48 Ga0070694_100014537 3300005444 Bacteria 4927
49 Ga0070694_100033799 3300005444 Bacteria 3369
50 Ga0070694_100733754 3300005444 Bacteria 805
51 Ga0070708_100153951 3300005445 Bacteria 2139
52 Ga0070662_100178424 3300005457 Bacteria 1673
53 Ga0070662_101362429 3300005457 Unclassified 611
54 Ga0070681_10000158 3300005458 Bacteria 52016
55 Ga0070681_10010318 3300005458 Bacteria 9221
56 Ga0070681_10064390 3300005458 Bacteria 3636
57 Ga0068867_100064714 3300005459 Bacteria 2719
58 Ga0070706_100586104 3300005467 Bacteria 1036
59 Ga0070707_100133906 3300005468 Bacteria 2411
60 Ga0070698_100028269 3300005471 Bacteria 5827
61 Ga0070698_100214030 3300005471 Bacteria 1861
62 Ga0070698_101193739 3300005471 Bacteria 710
63 Ga0070679_100000173 3300005530 Bacteria 51987
64 Ga0070679_100012182 3300005530 Bacteria 8215
65 Ga0070684_100017069 3300005535 Bacteria 5949
66 Ga0070684_100668059 3300005535 Bacteria 968
67 Ga0070697_100039041 3300005536 Bacteria 3838
68 Ga0068853_100002271 3300005539 Bacteria 14358
69 Ga0068853_100006081 3300005539 Bacteria 9555
70 Ga0068853_100054950 3300005539 Bacteria 3431
71 Ga0070686_100010649 3300005544 Bacteria 5195
72 Ga0070686_100375924 3300005544 Bacteria 1074
73 Ga0070695_100038159 3300005545 Bacteria 3029
74 Ga0070695_100073663 3300005545 Bacteria 2242
75 Ga0070695_100122700 3300005545 Bacteria 1780
76 Ga0070695_100129407 3300005545 Bacteria 1738
77 Ga0070695_100162144 3300005545 Bacteria 1570
78 Ga0070695_100180761 3300005545 Bacteria 1494
79 Ga0070696_100033027 3300005546 Bacteria 3554
80 Ga0070696_100117161 3300005546 Bacteria 1924
81 Ga0070693_100004428 3300005547 Bacteria 6640
82 Ga0070693_100163859 3300005547 Bacteria 1418
83 Ga0070704_100120262 3300005549 Bacteria 2016
84 Ga0070704_100146392 3300005549 Bacteria 1851
85 Ga0070704_100170649 3300005549 Bacteria 1730
86 Ga0070704_100373224 3300005549 Unclassified 1210
87 Ga0070704_100823826 3300005549 Bacteria 830
88 Ga0068855_100117046 3300005563 Unclassified 3054
89 Ga0068855_100312946 3300005563 Bacteria 1737
90 Ga0070664_100027015 3300005564 Bacteria 4768
91 Ga0070664_100802418 3300005564 Viruses 880
92 Ga0068857_100004268 3300005577 Bacteria 12050
93 Ga0068857_100164505 3300005577 Bacteria 2014
94 Ga0068857_100278707 3300005577 Bacteria 1537
95 Ga0068857_100623866 3300005577 Bacteria 1020
96 Ga0068857_100783142 3300005577 Bacteria 910
97 Ga0068854_100095807 3300005578 Bacteria 2216
98 Ga0068854_100473719 3300005578 Unclassified 1050
99 Ga0068856_100006432 3300005614 Bacteria 11528
100 Ga0070702_100004924 3300005615 Bacteria 6154
101 Ga0070702_100066019 3300005615 Bacteria 2120
102 Ga0070702_100778761 3300005615 Unclassified 737
103 Ga0068852_100049225 3300005616 Unclassified 3604
104 Ga0068852_100049641 3300005616 Bacteria 3590
105 Ga0068859_100021579 3300005617 Bacteria 6464
106 Ga0068859_100096991 3300005617 Bacteria 3001
107 Ga0068859_100174698 3300005617 Viruses 2230
108 Ga0068859_100331013 3300005617 Bacteria 1617
109 Ga0068864_100005793 3300005618 Bacteria 10135
110 Ga0068864_100049776 3300005618 Bacteria 3605
111 Ga0068864_100092728 3300005618 Bacteria 2667
112 Ga0068864_100126449 3300005618 Bacteria 2291
113 Ga0068864_100398945 3300005618 Bacteria 1307
114 Ga0068864_100401210 3300005618 Bacteria 1303
115 Ga0068861_100025177 3300005719 Bacteria 4312
116 Ga0068861_100028043 3300005719 Viruses 4106
117 Ga0068851_10004808 3300005834 Bacteria 6113
118 Ga0068870_10046798 3300005840 Viruses 2271
119 Ga0068863_100044247 3300005841 Bacteria 4226
120 Ga0068863_100117149 3300005841 Bacteria 2538
121 Ga0068863_101179835 3300005841 Bacteria 771
122 Ga0068858_100032748 3300005842 Bacteria 4827
123 Ga0068858_100133647 3300005842 Bacteria 2327
124 Ga0068858_100226439 3300005842 Bacteria 1772
125 Ga0068860_100338665 3300005843 Unclassified 1479
126 Ga0068860_101551763 3300005843 Unclassified 684
127 Ga0068862_100340869 3300005844 Bacteria 1388
128 Ga0070717_10775027 3300006028 Bacteria 872
129 Ga0075363_100448119 3300006048 Bacteria 762
130 Ga0075364_10002050 3300006051 Bacteria 11248
131 Ga0075362_10051143 3300006177 Bacteria 1848
132 Ga0075367_10007908 3300006178 Bacteria 5478
133 Ga0075367_10018887 3300006178 Bacteria 3811
134 Ga0075366_10019878 3300006195 Bacteria 3890
135 Ga0075366_10135190 3300006195 Bacteria 1489
136 Ga0075366_10148955 3300006195 Bacteria 1417
137 Ga0097621_100000891 3300006237 Bacteria 20934
138 Ga0068871_100004032 3300006358 Bacteria 10144
139 Ga0068871_100016489 3300006358 Bacteria 5566
140 Ga0075428_100099848 3300006844 Bacteria 3165
141 Ga0075428_101495611 3300006844 Unclassified 707
142 Ga0075428_101993287 3300006844 Bacteria 602
143 Ga0075430_100089586 3300006846 Bacteria 2574
144 Ga0075431_100186937 3300006847 Bacteria 2124
145 Ga0075431_101064631 3300006847 Bacteria 774
146 Ga0075434_100080442 3300006871 Bacteria 3255
147 Ga0075429_100067193 3300006880 Bacteria 3120
148 Ga0075429_100433745 3300006880 Viruses 1151
149 Ga0075429_101251895 3300006880 Bacteria 647
150 Ga0068865_100030480 3300006881 Bacteria 3588
151 Ga0097620_100021577 3300006931 Bacteria 6464
152 Ga0097620_100096991 3300006931 Bacteria 3001
153 Ga0097620_100174699 3300006931 Viruses 2230
154 Ga0097620_100330993 3300006931 Bacteria 1617
155 Ga0075435_100096547 3300007076 Bacteria 2445
156 Ga0105251_10028257 3300009011 Bacteria 2835
157 Ga0105240_10052562 3300009093 Bacteria 5120
158 Ga0111539_10031416 3300009094 Bacteria 6451
159 Ga0111539_10080774 3300009094 Bacteria 3824
160 Ga0111539_10123206 3300009094 Bacteria 3038
161 Ga0111539_10244634 3300009094 Bacteria 2088
162 Ga0111539_11201216 3300009094 Unclassified 881
163 Ga0105245_10413717 3300009098 Unclassified 1350
164 Ga0105245_10535020 3300009098 Bacteria 1192
165 Ga0105247_10237254 3300009101 Bacteria 1241
166 Ga0105247_10480330 3300009101 Bacteria 902
167 Ga0114129_10007892 3300009147 Bacteria 15148
168 Ga0114129_10032137 3300009147 Bacteria 7419
169 Ga0114129_10037559 3300009147 Bacteria 6837
170 Ga0114129_11821915 3300009147 Bacteria 740
171 Ga0114129_12129310 3300009147 Bacteria 676
172 Ga0105243_10243356 3300009148 Bacteria 1602
173 Ga0105241_10019067 3300009174 Bacteria 5059
174 Ga0105241_10090069 3300009174 Viruses 2419
175 Ga0105241_10161510 3300009174 Bacteria 1842
176 Ga0105241_10191136 3300009174 Bacteria 1704
177 Ga0105241_10212891 3300009174 Bacteria 1620
178 Ga0105241_11243833 3300009174 Bacteria 707
179 Ga0105242_10148862 3300009176 Bacteria 2039
180 Ga0105237_10005382 3300009545 Bacteria 14468
181 Ga0105237_10013164 3300009545 Bacteria 8678
182 Ga0105238_10015837 3300009551 Bacteria 7633
183 Ga0105238_10118925 3300009551 Bacteria 2622
184 Ga0105238_10912050 3300009551 Bacteria 897
185 Ga0105249_10204490 3300009553 Unclassified 1934
186 Ga0105239_10142773 3300010375 Bacteria 2669
187 Ga0105246_10005033 3300011119 Bacteria 8039
188 Ga0105246_10207416 3300011119 Bacteria 1527
189 Ga0105246_10402019 3300011119 Bacteria 1138
190 Ga0157373_10576841 3300013100 Unclassified 817
191 Ga0157378_10048611 3300013297 Bacteria 3772
192 Ga0157378_10257656 3300013297 Viruses 1672
193 Ga0163162_10091382 3300013306 Bacteria 3127
194 Ga0163162_10218915 3300013306 Bacteria 2034
195 Ga0163162_10904845 3300013306 Bacteria 995
196 Ga0163162_12289230 3300013306 Unclassified 621
197 Ga0157372_10005077 3300013307 Bacteria 13994
198 Ga0157375_10436430 3300013308 Bacteria 1475
199 Ga0163163_10005607 3300014325 Bacteria 10874
200 Ga0163163_10013210 3300014325 Bacteria 7549
201 Ga0163163_10026475 3300014325 Bacteria 5544
202 Ga0157380_10361253 3300014326 Bacteria 1363
203 Ga0157377_10184140 3300014745 Bacteria 1315
204 Ga0207656_10002644 3300025321 Bacteria 6066
205 Ga0207653_10009230 3300025885 Bacteria 3072
206 Ga0207647_10001140 3300025904 Bacteria 20474
207 Ga0207645_10460960 3300025907 Unclassified 858
208 Ga0207643_10008550 3300025908 Bacteria 5490
209 Ga0207654_10025603 3300025911 Bacteria 3184
210 Ga0207654_10232507 3300025911 Unclassified 1228
211 Ga0207654_10301856 3300025911 Bacteria 1089
212 Ga0207654_10615919 3300025911 Bacteria 775
213 Ga0207707_10000072 3300025912 Bacteria 102454
214 Ga0207707_10272044 3300025912 Bacteria 1468
215 Ga0207695_10055442 3300025913 Unclassified 4130
216 Ga0207671_10004857 3300025914 Bacteria 12651
217 Ga0207660_10000584 3300025917 Bacteria 24554
218 Ga0207660_10118151 3300025917 Bacteria 2005
219 Ga0207657_10013508 3300025919 Bacteria 8008
220 Ga0207652_10000083 3300025921 Bacteria 101957
221 Ga0207694_10026015 3300025924 Bacteria 4449
222 Ga0207650_10342551 3300025925 Bacteria 1228
223 Ga0207687_10969866 3300025927 Unclassified 729
224 Ga0207690_10008511 3300025932 Bacteria 6086
225 Ga0207706_10536959 3300025933 Bacteria 1008
226 Ga0207709_10277035 3300025935 Bacteria 1237
227 Ga0207670_10364881 3300025936 Bacteria 1147
228 Ga0207689_10017403 3300025942 Unclassified 6082
229 Ga0207689_10984533 3300025942 Bacteria 711
230 Ga0207679_10630202 3300025945 Viruses 968
231 Ga0207667_10387930 3300025949 Viruses 1423
232 Ga0207667_11786264 3300025949 Unclassified 579
233 Ga0207712_10840787 3300025961 Bacteria 809
234 Ga0207640_10396592 3300025981 Unclassified 1123
235 Ga0207703_10046475 3300026035 Bacteria 3496
236 Ga0207639_10032970 3300026041 Bacteria 3818
237 Ga0207639_10103057 3300026041 Bacteria 2311
238 Ga0207708_10002293 3300026075 Bacteria 14068
239 Ga0207708_10052990 3300026075 Unclassified 3090
240 Ga0207708_10065176 3300026075 Bacteria 2784
241 Ga0207702_10008531 3300026078 Bacteria 8638
242 Ga0207641_10034651 3300026088 Bacteria 4201
243 Ga0207676_10011171 3300026095 Bacteria 6411
244 Ga0207676_10049356 3300026095 Bacteria 3273
245 Ga0207676_10114649 3300026095 Bacteria 2261
246 Ga0207674_10008335 3300026116 Bacteria 11992
247 Ga0207674_10466878 3300026116 Bacteria 1220
248 Ga0207674_11470663 3300026116 Bacteria 650
249 Ga0207675_100010289 3300026118 Bacteria 8763
250 Ga0207698_10029253 3300026142 Bacteria 3943
251 Ga0207428_10025585 3300027907 Bacteria 4939
252 Ga0207428_10688495 3300027907 Bacteria 732
253 Ga0207428_10886087 3300027907 Bacteria 631
254 Ga0268264_10312264 3300028381 Unclassified 1484
255 Ga0268264_11401959 3300028381 Unclassified 709
256 Ga0307408_100213791 3300031548 Bacteria 1569
257 Ga0307416_100223796 3300032002 Viruses 1807
258 Ga0307416_101256849 3300032002 Bacteria 846
259 Ga0373959_0000713 3300034820 Bacteria 5683
260 Ga0395900_0074762 3300037418 Bacteria 3483
261 Ga0395898_0085130 3300037466 Bacteria 3047
262 Ga0395905_0190520 3300037471 Bacteria 1924
263 Ga0395905_0806805 3300037471 Bacteria 841
264 Ga0436365_1535139 3300039437 Bacteria 7891
265 Ga0436365_1836393 3300039437 Bacteria 1501
266 Ga0451853_0075256 3300041512 Bacteria 1489
267 Ga0439462_0005713 3300042015 Bacteria 3075
268 Ga0466957_0963610 3300044842 Bacteria 612
269 Ga0466967_0049229 3300045976 Bacteria 3684
270 Ga0495638_0002963 3300046460 Bacteria 13549
271 Ga0495643_0000286 3300046522 Bacteria 72166
272 Ga0495598_0021997 3300046537 Bacteria 1702
273 Ga0495659_0019682 3300046664 Bacteria 2259
274 Ga0495669_0115522 3300046684 Bacteria 1256
275 Ga0496100_0076265 3300048903 Bacteria 2251
276 Ga0496102_0162369 3300048905 Bacteria 2102
277 Ga0496106_0392908 3300048909 Bacteria 1115
278 Ga0496107_0092190 3300048910 Bacteria 2215
279 Ga0496112_0354601 3300048915 Bacteria 1409
280 Ga0501310_001221 3300049130 Bacteria 2306
281 Ga0501307_000829 3300049162 Bacteria 2351
282 Ga0501290_005298 3300049513 Bacteria 1612
283 Ga0501291_002189 3300049514 Bacteria 2319
284 Ga0501293_005064 3300049516 Bacteria 1050
285 Ga0501298_008553 3300049521 Unclassified 1722
286 Ga0501311_001349 3300049527 Bacteria 2101
287 Ga0501312_001653 3300049528 Bacteria 2246
288 Ga0501321_004665 3300049537 Bacteria 1321
289 Ga0501323_010696 3300049539 Bacteria 1097
290 Ga0501038_0005469 3300049574 Bacteria 11800
291 Ga0501041_0218819 3300049577 Bacteria 1195
292 Ga0501046_0992904 3300049580 Unclassified 583
293 Ga0501074_0118243 3300049590 Bacteria 1896
294 Ga0501076_0262664 3300049592 Bacteria 1414
295 Ga0501077_0374982 3300049593 Bacteria 909
296 Ga0501202_002316 3300049652 Bacteria 3188
297 Ga0501207_000807 3300049654 Bacteria 3704
298 Ga0501208_068601 3300049655 Bacteria 709
299 Ga0501217_000471 3300049661 Bacteria 6612
300 Ga0501223_029480 3300049663 Bacteria 1067
301 Ga0501224_003402 3300049664 Bacteria 2216
302 Ga0501233_001737 3300049668 Bacteria 3754
303 Ga0501235_003127 3300049669 Bacteria 3569
304 Ga0501240_000813 3300049673 Bacteria 2786
305 Ga0501247_000492 3300049677 Bacteria 3155
306 Ga0501249_003116 3300049679 Bacteria 3338
307 Ga0501257_000865 3300049686 Bacteria 6085
308 Ga0501219_008195 3300049703 Bacteria 762
309 Ga0501221_027895 3300049704 Bacteria 1158
310 Ga0501225_0002335 3300049705 Bacteria 5851
311 Ga0501234_005416 3300049707 Bacteria 1997
312 Ga0501273_000762 3300049770 Bacteria 2769
313 Ga0501276_003824 3300049773 Bacteria 1109
314 Ga0501283_001161 3300049779 Bacteria 3466
315 Ga0501220_01547 3300049852 Bacteria 878
316 Ga0501226_001172 3300049853 Bacteria 3399
317 nmdc:mga03683_127110_c1 3300050489 Bacteria 1138
318 nmdc:mga03n38_451619_c1 3300050490 Bacteria 715
319 nmdc:mga00v17_28629_c1 3300050491 Bacteria 3264
320 nmdc:mga0k408_219140_c1 3300050493 Bacteria 1136
321 nmdc:mga0k408_74308_c1 3300050493 Bacteria 1986
322 nmdc:mga05p37_51658_c1 3300050507 Bacteria 5054
323 nmdc:mga09592_1002620_c1 3300050508 Bacteria 698
324 nmdc:mga09592_215107_c1 3300050508 Bacteria 1665
325 nmdc:mga06r32_232335_c1 3300050510 Bacteria 1832
326 nmdc:mga08y16_1734_c1 3300050511 Bacteria 22134
327 nmdc:mga08y16_328645_c1 3300050511 Bacteria 812
328 nmdc:mga08y16_466138_c1 3300050511 Bacteria 1287
329 nmdc:mga08y16_93204_c1 3300050511 Viruses 3138
330 nmdc:mga08x19_588429_c1 3300050514 Bacteria 788
331 nmdc:mga0a205_241763_c1 3300050515 Unclassified 1686
332 nmdc:mga0a205_41603_c1 3300050515 Unclassified 4426
333 nmdc:mga0a205_61742_c1 3300050515 Bacteria 3620
334 Ga0500554_218503 3300053102 Bacteria 634
335 Ga0501084_0405088 3300054114 Bacteria 1153
336 Ga0587070_008633 3300059491 Bacteria 1449
337 Ga0587092_003545 3300059512 Bacteria 1785
338 Ga0207662_10072505
339 SwRhRL3b_contig_2124036
340 SwRhRL2b_contig_218131
341 SwRhRL2b_contig_3061735
342 MBSR1b_contig_35550
343 CNAas_1000839
344 rootL2_10219126
345 Ga0058859_11272668
346 Ga0058863_11418228
347 Ga0058861_10094560
348 Ga0058862_11746648
349 Ga0065704_10003045
350 Ga0065715_10100678
351 Ga0065715_10138819
352 Ga0065715_10185485
353 Ga0065715_10549561
354 Ga0065707_10002730
355 Ga0070676_10075972
356 Ga0070670_100370153
357 Ga0068869_100069864
358 Ga0070680_100000437
359 Ga0070680_100574321
360 Ga0070682_100001148
361 Ga0068868_100198131
362 Ga0068868_100233221
363 Ga0070660_100129079
364 Ga0070689_100248105
365 Ga0070689_100488167
366 Ga0070691_10486339
367 Ga0070687_100000723
368 Ga0070687_100083582
369 Ga0070692_10005032
370 Ga0070692_10007688
371 Ga0070692_10051537
372 Ga0070692_10411434
373 Ga0070692_10457124
374 Ga0070675_100754473
375 Ga0070659_100002961
376 Ga0070703_10008816
377 Ga0070701_10155246
378 Ga0070705_100012212
379 Ga0070705_100032854
380 Ga0070700_100000913
381 Ga0070700_100033184
382 Ga0070700_100234206
383 Ga0070694_100001863
384 Ga0070694_100007175
385 Ga0070694_100014537
386 Ga0070694_100033799
387 Ga0070694_100733754
388 Ga0070708_100153951
389 Ga0070662_100178424
390 Ga0070662_101362429
391 Ga0070681_10000158
392 Ga0070681_10010318
393 Ga0070681_10064390
394 Ga0068867_100064714
395 Ga0070706_100586104
396 Ga0070707_100133906
397 Ga0070698_100028269
398 Ga0070698_100214030
399 Ga0070698_101193739
400 Ga0070679_100000173
401 Ga0070679_100012182
402 Ga0070684_100017069
403 Ga0070684_100668059
404 Ga0070697_100039041
405 Ga0068853_100002271
406 Ga0068853_100006081
407 Ga0068853_100054950
408 Ga0070686_100010649
409 Ga0070686_100375924
410 Ga0070695_100038159
411 Ga0070695_100073663
412 Ga0070695_100122700
413 Ga0070695_100129407
414 Ga0070695_100162144
415 Ga0070695_100180761
416 Ga0070696_100033027
417 Ga0070696_100117161
418 Ga0070693_100004428
419 Ga0070693_100163859
420 Ga0070704_100120262
421 Ga0070704_100146392
422 Ga0070704_100170649
423 Ga0070704_100373224
424 Ga0070704_100823826
425 Ga0068855_100117046
426 Ga0068855_100312946
427 Ga0070664_100027015
428 Ga0070664_100802418
429 Ga0068857_100004268
430 Ga0068857_100164505
431 Ga0068857_100278707
432 Ga0068857_100623866
433 Ga0068857_100783142
434 Ga0068854_100095807
435 Ga0068854_100473719
436 Ga0068856_100006432
437 Ga0070702_100004924
438 Ga0070702_100066019
439 Ga0070702_100778761
440 Ga0068852_100049225
441 Ga0068852_100049641
442 Ga0068859_100021579
443 Ga0068859_100096991
444 Ga0068859_100174698
445 Ga0068859_100331013
446 Ga0068864_100005793
447 Ga0068864_100049776
448 Ga0068864_100092728
449 Ga0068864_100126449
450 Ga0068864_100398945
451 Ga0068864_100401210
452 Ga0068861_100025177
453 Ga0068861_100028043
454 Ga0068851_10004808
455 Ga0068870_10046798
456 Ga0068863_100044247
457 Ga0068863_100117149
458 Ga0068863_101179835
459 Ga0068858_100032748
460 Ga0068858_100133647
461 Ga0068858_100226439
462 Ga0068860_100338665
463 Ga0068860_101551763
464 Ga0068862_100340869
465 Ga0070717_10775027
466 Ga0075363_100448119
467 Ga0075364_10002050
468 Ga0075362_10051143
469 Ga0075367_10007908
470 Ga0075367_10018887
471 Ga0075366_10019878
472 Ga0075366_10135190
473 Ga0075366_10148955
474 Ga0097621_100000891
475 Ga0068871_100004032
476 Ga0068871_100016489
477 Ga0075428_100099848
478 Ga0075428_101495611
479 Ga0075428_101993287
480 Ga0075430_100089586
481 Ga0075431_100186937
482 Ga0075431_101064631
483 Ga0075434_100080442
484 Ga0075429_100067193
485 Ga0075429_100433745
486 Ga0075429_101251895
487 Ga0068865_100030480
488 Ga0097620_100021577
489 Ga0097620_100096991
490 Ga0097620_100174699
491 Ga0097620_100330993
492 Ga0075435_100096547
493 Ga0105251_10028257
494 Ga0105240_10052562
495 Ga0111539_10031416
496 Ga0111539_10080774
497 Ga0111539_10123206
498 Ga0111539_10244634
499 Ga0111539_11201216
500 Ga0105245_10413717
501 Ga0105245_10535020
502 Ga0105247_10237254
503 Ga0105247_10480330
504 Ga0114129_10007892
505 Ga0114129_10032137
506 Ga0114129_10037559
507 Ga0114129_11821915
508 Ga0114129_12129310
509 Ga0105243_10243356
510 Ga0105241_10019067
511 Ga0105241_10090069
512 Ga0105241_10161510
513 Ga0105241_10191136
514 Ga0105241_10212891
515 Ga0105241_11243833
516 Ga0105242_10148862
517 Ga0105237_10005382
518 Ga0105237_10013164
519 Ga0105238_10015837
520 Ga0105238_10118925
521 Ga0105238_10912050
522 Ga0105249_10204490
523 Ga0105239_10142773
524 Ga0105246_10005033
525 Ga0105246_10207416
526 Ga0105246_10402019
527 Ga0157373_10576841
528 Ga0157378_10048611
529 Ga0157378_10257656
530 Ga0163162_10091382
531 Ga0163162_10218915
532 Ga0163162_10904845
533 Ga0163162_12289230
534 Ga0157372_10005077
535 Ga0157375_10436430
536 Ga0163163_10005607
537 Ga0163163_10013210
538 Ga0163163_10026475
539 Ga0157380_10361253
540 Ga0157377_10184140
541 Ga0207656_10002644
542 Ga0207653_10009230
543 Ga0207647_10001140
544 Ga0207645_10460960
545 Ga0207643_10008550
546 Ga0207654_10025603
547 Ga0207654_10232507
548 Ga0207654_10301856
549 Ga0207654_10615919
550 Ga0207707_10000072
551 Ga0207707_10272044
552 Ga0207695_10055442
553 Ga0207671_10004857
554 Ga0207660_10000584
555 Ga0207660_10118151
556 Ga0207657_10013508
557 Ga0207652_10000083
558 Ga0207694_10026015
559 Ga0207650_10342551
560 Ga0207687_10969866
561 Ga0207690_10008511
562 Ga0207706_10536959
563 Ga0207709_10277035
564 Ga0207670_10364881
565 Ga0207689_10017403
566 Ga0207689_10984533
567 Ga0207679_10630202
568 Ga0207667_10387930
569 Ga0207667_11786264
570 Ga0207712_10840787
571 Ga0207640_10396592
572 Ga0207703_10046475
573 Ga0207639_10032970
574 Ga0207639_10103057
575 Ga0207708_10002293
576 Ga0207708_10052990
577 Ga0207708_10065176
578 Ga0207702_10008531
579 Ga0207641_10034651
580 Ga0207676_10011171
581 Ga0207676_10049356
582 Ga0207676_10114649
583 Ga0207674_10008335
584 Ga0207674_10466878
585 Ga0207674_11470663
586 Ga0207675_100010289
587 Ga0207698_10029253
588 Ga0207428_10025585
589 Ga0207428_10688495
590 Ga0207428_10886087
591 Ga0268264_10312264
592 Ga0268264_11401959
593 Ga0307408_100213791
594 Ga0307416_100223796
595 Ga0307416_101256849
596 Ga0373959_0000713
597 Ga0395900_0074762
598 Ga0395898_0085130
599 Ga0395905_0190520
600 Ga0395905_0806805
601 Ga0436365_1535139
602 Ga0436365_1836393
603 Ga0451853_0075256
604 Ga0439462_0005713
605 Ga0466957_0963610
606 Ga0466967_0049229
607 Ga0495638_0002963
608 Ga0495643_0000286
609 Ga0495598_0021997
610 Ga0495659_0019682
611 Ga0495669_0115522
612 Ga0496100_0076265
613 Ga0496102_0162369
614 Ga0496106_0392908
615 Ga0496107_0092190
616 Ga0496112_0354601
617 Ga0501310_001221
618 Ga0501307_000829
619 Ga0501290_005298
620 Ga0501291_002189
621 Ga0501293_005064
622 Ga0501298_008553
623 Ga0501311_001349
624 Ga0501312_001653
625 Ga0501321_004665
626 Ga0501323_010696
627 Ga0501038_0005469
628 Ga0501041_0218819
629 Ga0501046_0992904
630 Ga0501074_0118243
631 Ga0501076_0262664
632 Ga0501077_0374982
633 Ga0501202_002316
634 Ga0501207_000807
635 Ga0501208_068601
636 Ga0501217_000471
637 Ga0501223_029480
638 Ga0501224_003402
639 Ga0501233_001737
640 Ga0501235_003127
641 Ga0501240_000813
642 Ga0501247_000492
643 Ga0501249_003116
644 Ga0501257_000865
645 Ga0501219_008195
646 Ga0501221_027895
647 Ga0501225_0002335
648 Ga0501234_005416
649 Ga0501273_000762
650 Ga0501276_003824
651 Ga0501283_001161
652 Ga0501220_01547
653 Ga0501226_001172
654 nmdc:mga03683_127110_c1
655 nmdc:mga03n38_451619_c1
656 nmdc:mga00v17_28629_c1
657 nmdc:mga0k408_219140_c1
658 nmdc:mga0k408_74308_c1
659 nmdc:mga05p37_51658_c1
660 nmdc:mga09592_1002620_c1
661 nmdc:mga09592_215107_c1
662 nmdc:mga06r32_232335_c1
663 nmdc:mga08y16_1734_c1
664 nmdc:mga08y16_328645_c1
665 nmdc:mga08y16_466138_c1
666 nmdc:mga08y16_93204_c1
667 nmdc:mga08x19_588429_c1
668 nmdc:mga0a205_241763_c1
669 nmdc:mga0a205_41603_c1
670 nmdc:mga0a205_61742_c1
671 Ga0500554_218503
672 Ga0501084_0405088
673 Ga0587070_008633
674 Ga0587092_003545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

7

63

0.97

Map