F413046

General Info

Members Datasets Scaffolds Average Seq Length
337 152 674 202

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10089646|Ga0105240_100896462
Length 231
Sequence MEFFRRRANPMSGLRKGLVNPIMGGMGRKRGDMELALDPPRLQAVPDAPLAAAATASDADLLARVADRDRDAFEVLYLRYIRSIYGLALRRLRDRERAEDAVQETFAAIWRSASSYRPERGPAAPWLYAIARNAVVDRFRGHIEPTGEVPDLASGEPGPADRAETAYVSWRVHRALEALSEREREVVELAYWSGLSQSEVAEYLHIPLGTVKTRTRSALSKLADVLEGDDL

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
37 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
38 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
43 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
63 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
64 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
65 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
66 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
67 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
68 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
69 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
72 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
73 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
76 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
97 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
98 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
148 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.25
Metatranscriptomes 4.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.19
Nodule 0
Rhizoplane 4.45
Rhizosphere 94.36
Stem 0
Stem Tuber 0
Unclassified 9.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10089646 3300009093 Bacteria 3761
2 Ga0070658_10016442 3300005327 Bacteria 5921
3 Ga0070658_10037475 3300005327 Bacteria 3909
4 Ga0070658_10068990 3300005327 Bacteria 2891
5 Ga0070658_10168845 3300005327 Bacteria 1837
6 Ga0070683_100000373 3300005329 Bacteria 31119
7 Ga0070683_100009162 3300005329 Bacteria 8449
8 Ga0070680_100055429 3300005336 Bacteria 3239
9 Ga0070680_100118985 3300005336 Bacteria 2204
10 Ga0070680_100350187 3300005336 Bacteria 1256
11 Ga0070682_100006444 3300005337 Bacteria 6598
12 Ga0070660_100003281 3300005339 Bacteria 11114
13 Ga0070660_100005997 3300005339 Bacteria 8401
14 Ga0070660_100053604 3300005339 Bacteria 3111
15 Ga0070660_100353726 3300005339 Unclassified 1210
16 Ga0070661_100041177 3300005344 Bacteria 3371
17 Ga0070661_100095708 3300005344 Bacteria 2202
18 Ga0070661_100212552 3300005344 Unclassified 1481
19 Ga0070674_100197241 3300005356 Bacteria 1552
20 Ga0070659_100041559 3300005366 Bacteria 3595
21 Ga0070659_100264768 3300005366 Bacteria 1427
22 Ga0070659_100804409 3300005366 Unclassified 818
23 Ga0070659_100809297 3300005366 Bacteria 815
24 Ga0070709_10046900 3300005434 Unclassified 2689
25 Ga0070714_100007856 3300005435 Bacteria 8308
26 Ga0070714_100010962 3300005435 Bacteria 7179
27 Ga0070714_100099455 3300005435 Bacteria 2560
28 Ga0070714_100591616 3300005435 Unclassified 1065
29 Ga0070714_101160717 3300005435 Unclassified 753
30 Ga0070713_100125313 3300005436 Bacteria 2258
31 Ga0070713_100560921 3300005436 Unclassified 1082
32 Ga0070681_10034475 3300005458 Bacteria 5082
33 Ga0070681_10088900 3300005458 Bacteria 3041
34 Ga0070681_10108162 3300005458 Bacteria 2721
35 Ga0070681_10146629 3300005458 Bacteria 2289
36 Ga0070681_10385369 3300005458 Bacteria 1312
37 Ga0070707_100418925 3300005468 Unclassified 1300
38 Ga0070698_100046034 3300005471 Bacteria 4461
39 Ga0070698_100088207 3300005471 Bacteria 3087
40 Ga0070699_100368739 3300005518 Bacteria 1295
41 Ga0070679_100059598 3300005530 Bacteria 3804
42 Ga0070679_100120003 3300005530 Unclassified 2614
43 Ga0070679_100174224 3300005530 Bacteria 2124
44 Ga0070679_100185097 3300005530 Bacteria 2054
45 Ga0070679_100253240 3300005530 Bacteria 1717
46 Ga0070684_100113096 3300005535 Bacteria 2436
47 Ga0070684_100154823 3300005535 Bacteria 2078
48 Ga0070684_100324317 3300005535 Bacteria 1415
49 Ga0070695_100195801 3300005545 Bacteria 1441
50 Ga0070696_100479294 3300005546 Unclassified 986
51 Ga0068855_100005085 3300005563 Bacteria 16033
52 Ga0068855_100044913 3300005563 Bacteria 5227
53 Ga0068852_100012558 3300005616 Bacteria 6434
54 Ga0068852_100181221 3300005616 Bacteria 1981
55 Ga0070717_10227550 3300006028 Bacteria 1641
56 Ga0075365_10336444 3300006038 Bacteria 1064
57 Ga0075364_10206441 3300006051 Bacteria 1332
58 Ga0070716_100154521 3300006173 Bacteria 1480
59 Ga0070712_100220006 3300006175 Bacteria 1503
60 Ga0075362_10062912 3300006177 Bacteria 1682
61 Ga0075436_100168346 3300006914 Bacteria 1547
62 Ga0105240_10004954 3300009093 Bacteria 20027
63 Ga0105240_10076226 3300009093 Bacteria 4135
64 Ga0105240_10759723 3300009093 Bacteria 1053
65 Ga0105238_10206243 3300009551 Bacteria 1942
66 Ga0105238_10472451 3300009551 Bacteria 1253
67 Ga0157373_10885670 3300013100 Unclassified 662
68 Ga0157371_10207822 3300013102 Bacteria 1404
69 Ga0157370_10029004 3300013104 Bacteria 5437
70 Ga0157369_10005681 3300013105 Bacteria 14493
71 Ga0157369_10030256 3300013105 Bacteria 5973
72 Ga0157369_10035071 3300013105 Bacteria 5502
73 Ga0157369_10135741 3300013105 Bacteria 2605
74 Ga0157369_10343911 3300013105 Bacteria 1549
75 Ga0157372_10162233 3300013307 Bacteria 2584
76 Ga0157372_10248259 3300013307 Bacteria 2066
77 Ga0182008_10002853 3300014497 Bacteria 10702
78 Ga0182008_10209175 3300014497 Bacteria 995
79 Ga0182007_10006799 3300015262 Bacteria 4868
80 Ga0197907_11047976 3300020069 Bacteria 1865
81 Ga0197907_11444815 3300020069 Bacteria 1773
82 Ga0206356_10518193 3300020070 Bacteria 985
83 Ga0206356_10554391 3300020070 Bacteria 1890
84 Ga0206356_10810889 3300020070 Bacteria 4701
85 Ga0206356_10830103 3300020070 Bacteria 3564
86 Ga0206354_10424275 3300020081 Bacteria 3169
87 Ga0206354_10442118 3300020081 Bacteria 2436
88 Ga0206354_10654699 3300020081 Bacteria 2230
89 Ga0206353_10064668 3300020082 Bacteria 3687
90 Ga0206353_10141117 3300020082 Bacteria 4174
91 Ga0206353_11018911 3300020082 Bacteria 9470
92 Ga0206353_11116827 3300020082 Bacteria 5448
93 Ga0206353_11615723 3300020082 Unclassified 1156
94 Ga0213871_10015849 3300021441 Bacteria 1808
95 Ga0224712_10019081 3300022467 Bacteria 2306
96 Ga0224712_10023492 3300022467 Bacteria 2141
97 Ga0207705_10004374 3300025909 Bacteria 10682
98 Ga0207705_10041487 3300025909 Bacteria 3302
99 Ga0207705_10145046 3300025909 Bacteria 1775
100 Ga0207705_10193385 3300025909 Bacteria 1539
101 Ga0207707_10023022 3300025912 Bacteria 5450
102 Ga0207707_10064211 3300025912 Bacteria 3196
103 Ga0207707_10181393 3300025912 Bacteria 1838
104 Ga0207707_10260427 3300025912 Bacteria 1505
105 Ga0207707_10450374 3300025912 Unclassified 1101
106 Ga0207695_10027324 3300025913 Bacteria 6356
107 Ga0207695_10086916 3300025913 Bacteria 3151
108 Ga0207695_10202545 3300025913 Bacteria 1898
109 Ga0207693_10577756 3300025915 Unclassified 876
110 Ga0207660_10090197 3300025917 Bacteria 2271
111 Ga0207660_10183878 3300025917 Bacteria 1624
112 Ga0207660_10420233 3300025917 Bacteria 1078
113 Ga0207657_10002409 3300025919 Bacteria 20204
114 Ga0207657_10003083 3300025919 Bacteria 17829
115 Ga0207657_10024689 3300025919 Bacteria 5558
116 Ga0207657_10176555 3300025919 Unclassified 1728
117 Ga0207649_10018071 3300025920 Bacteria 4003
118 Ga0207649_10028651 3300025920 Bacteria 3280
119 Ga0207649_10384667 3300025920 Unclassified 1046
120 Ga0207652_10008595 3300025921 Bacteria 8217
121 Ga0207652_10030667 3300025921 Bacteria 4505
122 Ga0207652_10032438 3300025921 Bacteria 4391
123 Ga0207652_10186821 3300025921 Bacteria 1864
124 Ga0207694_10242064 3300025924 Bacteria 1474
125 Ga0207700_10146498 3300025928 Bacteria 1947
126 Ga0207664_10008730 3300025929 Bacteria 7085
127 Ga0207664_10032828 3300025929 Bacteria 3982
128 Ga0207664_10186898 3300025929 Unclassified 1782
129 Ga0207664_10592158 3300025929 Bacteria 996
130 Ga0207690_10762655 3300025932 Bacteria 798
131 Ga0207669_10074057 3300025937 Bacteria 2152
132 Ga0207665_10527523 3300025939 Bacteria 915
133 Ga0207661_10005839 3300025944 Bacteria 8684
134 Ga0207661_10291575 3300025944 Unclassified 1460
135 Ga0207667_10042931 3300025949 Bacteria 4801
136 Ga0207667_10101896 3300025949 Bacteria 2961
137 Ga0207667_10674846 3300025949 Bacteria 1037
138 Ga0207667_11098730 3300025949 Bacteria 779
139 Ga0207639_10884651 3300026041 Bacteria 834
140 Ga0207702_10197891 3300026078 Bacteria 1861
141 Ga0265337_1042978 3300028556 Bacteria 1294
142 Ga0265326_10022974 3300028558 Bacteria 1784
143 Ga0265319_1005524 3300028563 Bacteria 6041
144 Ga0265334_10000542 3300028573 Bacteria 19259
145 Ga0265334_10149352 3300028573 Bacteria 825
146 Ga0265318_10000276 3300028577 Bacteria 43159
147 Ga0265318_10005723 3300028577 Bacteria 5811
148 Ga0265323_10118262 3300028653 Bacteria 865
149 Ga0265322_10030949 3300028654 Bacteria 1527
150 Ga0265336_10066990 3300028666 Bacteria 1074
151 Ga0265338_10009647 3300028800 Bacteria 11455
152 Ga0265338_10018336 3300028800 Bacteria 7497
153 Ga0265338_10027890 3300028800 Bacteria 5650
154 Ga0265338_10028087 3300028800 Bacteria 5622
155 Ga0265330_10000888 3300031235 Bacteria 18608
156 Ga0265328_10001224 3300031239 Bacteria 11887
157 Ga0265320_10029021 3300031240 Bacteria 2866
158 Ga0265320_10140211 3300031240 Bacteria 1095
159 Ga0265325_10001745 3300031241 Bacteria 15083
160 Ga0265329_10004524 3300031242 Bacteria 5765
161 Ga0265329_10011225 3300031242 Bacteria 3261
162 Ga0265340_10001237 3300031247 Bacteria 14637
163 Ga0265340_10056758 3300031247 Bacteria 1883
164 Ga0265339_10042865 3300031249 Bacteria 2504
165 Ga0265331_10000959 3300031250 Bacteria 22955
166 Ga0265331_10021613 3300031250 Bacteria 3291
167 Ga0265327_10012224 3300031251 Bacteria 5819
168 Ga0265316_10002153 3300031344 Bacteria 20707
169 Ga0265316_10053879 3300031344 Bacteria 3150
170 Ga0265313_10002758 3300031595 Bacteria 14812
171 Ga0265314_10018788 3300031711 Bacteria 5372
172 Ga0265314_10027632 3300031711 Bacteria 4246
173 Ga0265314_10154685 3300031711 Bacteria 1402
174 Ga0265342_10011564 3300031712 Bacteria 6030
175 Ga0265342_10017711 3300031712 Bacteria 4627
176 Ga0307413_10197956 3300031824 Bacteria 1448
177 Ga0307406_10025783 3300031901 Bacteria 3522
178 Ga0307407_10078949 3300031903 Bacteria 1984
179 Ga0307412_10083774 3300031911 Bacteria 2212
180 Ga0307416_100888632 3300032002 Bacteria 990
181 Ga0307414_10451331 3300032004 Bacteria 1127
182 Ga0307415_100122426 3300032126 Bacteria 1953
183 Ga0373945_0010063 3300035116 Bacteria 3110
184 Ga0395899_0059485 3300037312 Bacteria 2817
185 Ga0395900_0058305 3300037418 Bacteria 3975
186 Ga0395900_0134639 3300037418 Bacteria 2531
187 Ga0395900_0233099 3300037418 Bacteria 1850
188 Ga0395900_0681266 3300037418 Unclassified 963
189 Ga0395898_0109744 3300037466 Bacteria 2645
190 Ga0395898_0276185 3300037466 Bacteria 1602
191 Ga0395898_0305521 3300037466 Bacteria 1517
192 Ga0395898_1092677 3300037466 Bacteria 731
193 Ga0395901_0073900 3300038443 Bacteria 3556
194 Ga0395901_0118984 3300038443 Bacteria 2776
195 Ga0395901_0350423 3300038443 Bacteria 1524
196 Ga0395901_0400271 3300038443 Bacteria 1411
197 Ga0395901_0429128 3300038443 Bacteria 1354
198 Ga0395901_0634174 3300038443 Bacteria 1074
199 Ga0395901_0702936 3300038443 Bacteria 1008
200 Ga0436360_0718639 3300039438 Bacteria 2317
201 Ga0436362_0405266 3300039453 Bacteria 1199
202 Ga0466969_0037552 3300044656 Bacteria 2442
203 Ga0466972_0189051 3300044658 Bacteria 965
204 Ga0466972_0325509 3300044658 Bacteria 718
205 Ga0466965_0032145 3300044683 Bacteria 2563
206 Ga0466966_0004058 3300044684 Bacteria 9667
207 Ga0466966_0048641 3300044684 Bacteria 2701
208 Ga0466961_0018390 3300044693 Bacteria 4494
209 Ga0466961_0030679 3300044693 Bacteria 3454
210 Ga0466961_0062709 3300044693 Bacteria 2362
211 Ga0466961_0317976 3300044693 Unclassified 950
212 Ga0466963_0000914 3300044694 Bacteria 15029
213 Ga0466963_0001298 3300044694 Bacteria 13275
214 Ga0466963_0002207 3300044694 Bacteria 10769
215 Ga0466963_0004328 3300044694 Bacteria 8241
216 Ga0466963_0011980 3300044694 Bacteria 5296
217 Ga0466963_0015949 3300044694 Bacteria 4663
218 Ga0466963_0066982 3300044694 Bacteria 2409
219 Ga0466963_0108439 3300044694 Bacteria 1905
220 Ga0466963_0228472 3300044694 Unclassified 1304
221 Ga0466963_0537282 3300044694 Bacteria 825
222 Ga0466964_0005774 3300044706 Bacteria 4608
223 Ga0466964_0036992 3300044706 Bacteria 1959
224 Ga0466964_0096768 3300044706 Unclassified 1294
225 Ga0466964_0109368 3300044706 Bacteria 1230
226 Ga0466964_0366316 3300044706 Bacteria 744
227 Ga0466971_0000350 3300044719 Bacteria 17732
228 Ga0466971_0014706 3300044719 Bacteria 3444
229 Ga0466971_0024658 3300044719 Bacteria 2683
230 Ga0466971_0129357 3300044719 Bacteria 1171
231 Ga0466971_0131832 3300044719 Bacteria 1160
232 Ga0466968_0019491 3300044735 Bacteria 2730
233 Ga0466968_0043342 3300044735 Bacteria 1904
234 Ga0466968_0059894 3300044735 Bacteria 1640
235 Ga0466968_0062574 3300044735 Bacteria 1607
236 Ga0466968_0207190 3300044735 Bacteria 920
237 Ga0466957_0000833 3300044842 Bacteria 15747
238 Ga0466957_0011590 3300044842 Bacteria 5094
239 Ga0466957_0028805 3300044842 Bacteria 3308
240 Ga0466957_0036936 3300044842 Bacteria 2939
241 Ga0466957_0674242 3300044842 Unclassified 728
242 Ga0466957_0856254 3300044842 Unclassified 648
243 Ga0466959_0029171 3300045049 Bacteria 4088
244 Ga0466959_0031766 3300045049 Bacteria 3907
245 Ga0466959_0037865 3300045049 Bacteria 3564
246 Ga0466959_0059877 3300045049 Bacteria 2771
247 Ga0466959_0190873 3300045049 Bacteria 1430
248 Ga0466958_0000492 3300045836 Bacteria 16518
249 Ga0466958_0001960 3300045836 Bacteria 10114
250 Ga0466958_0002049 3300045836 Bacteria 9957
251 Ga0466958_0008430 3300045836 Bacteria 5717
252 Ga0466958_0008552 3300045836 Bacteria 5682
253 Ga0466967_0000295 3300045976 Bacteria 22299
254 Ga0466967_0001317 3300045976 Bacteria 14199
255 Ga0466967_0013679 3300045976 Bacteria 6284
256 Ga0466967_0020088 3300045976 Bacteria 5389
257 Ga0466967_0024031 3300045976 Bacteria 5004
258 Ga0466967_0027275 3300045976 Bacteria 4749
259 Ga0466967_0037168 3300045976 Bacteria 4164
260 Ga0466967_0038971 3300045976 Bacteria 4080
261 Ga0466967_0055514 3300045976 Bacteria 3489
262 Ga0466967_0062227 3300045976 Bacteria 3312
263 Ga0466967_0064570 3300045976 Bacteria 3256
264 Ga0466967_0096251 3300045976 Bacteria 2700
265 Ga0466967_0121367 3300045976 Bacteria 2415
266 Ga0466967_0154953 3300045976 Bacteria 2145
267 Ga0466967_0169281 3300045976 Bacteria 2054
268 Ga0466967_0190148 3300045976 Unclassified 1939
269 Ga0466967_0594899 3300045976 Bacteria 1091
270 Ga0466967_0694535 3300045976 Bacteria 1007
271 Ga0495592_0010091 3300046454 Bacteria 7113
272 Ga0495592_0215187 3300046454 Bacteria 1288
273 Ga0495603_0077899 3300046455 Bacteria 1944
274 Ga0495641_0027243 3300046461 Bacteria 2781
275 Ga0495653_0074644 3300046463 Bacteria 2526
276 Ga0495582_0412087 3300046473 Unclassified 779
277 Ga0495594_0128756 3300046499 Bacteria 1433
278 Ga0495594_0307425 3300046499 Bacteria 903
279 Ga0495608_0142368 3300046511 Bacteria 1530
280 Ga0495630_0082353 3300046517 Unclassified 2429
281 Ga0495630_0233560 3300046517 Bacteria 1405
282 Ga0495644_0045851 3300046523 Bacteria 1644
283 Ga0495652_0167817 3300046529 Bacteria 1697
284 Ga0495652_0232754 3300046529 Bacteria 1377
285 Ga0495645_0233382 3300046543 Bacteria 1231
286 Ga0495667_0445239 3300046559 Bacteria 814
287 Ga0495634_0101906 3300046642 Bacteria 1854
288 Ga0495635_0205360 3300046663 Bacteria 1335
289 Ga0495635_0426421 3300046663 Archaea 879
290 Ga0495657_0026167 3300046675 Bacteria 4133
291 Ga0495657_0201628 3300046675 Bacteria 1212
292 Ga0495680_0028988 3300047322 Bacteria 4536
293 Ga0495593_0059106 3300047673 Bacteria 2009
294 Ga0495602_0671267 3300048088 Unclassified 706
295 Ga0496100_0151207 3300048903 Unclassified 1656
296 Ga0496101_0861837 3300048904 Bacteria 714
297 Ga0496102_1020609 3300048905 Unclassified 748
298 Ga0496102_1348610 3300048905 Bacteria 632
299 Ga0496103_0073821 3300048906 Bacteria 2137
300 Ga0496104_0051381 3300048907 Bacteria 3891
301 Ga0496104_0608659 3300048907 Unclassified 1003
302 Ga0496110_1025063 3300048913 Bacteria 733
303 Ga0496112_0068713 3300048915 Bacteria 3499
304 Ga0496112_0177714 3300048915 Bacteria 2093
305 Ga0496112_0368284 3300048915 Bacteria 1378
306 Ga0496112_0506870 3300048915 Bacteria 1142
307 Ga0496113_0062910 3300048916 Bacteria 2804
308 Ga0496114_0046771 3300048917 Bacteria 3596
309 Ga0496115_0012935 3300048918 Bacteria 6293
310 Ga0501047_0260713 3300049581 Bacteria 1581
311 Ga0501067_0054278 3300049583 Bacteria 2220
312 Ga0501067_0073346 3300049583 Bacteria 1896
313 Ga0501069_0112310 3300049585 Bacteria 1552
314 Ga0501069_0166387 3300049585 Bacteria 1271
315 Ga0501070_0029937 3300049586 Bacteria 4561
316 Ga0501070_0139995 3300049586 Bacteria 1998
317 Ga0501072_0002846 3300049588 Bacteria 12987
318 Ga0501074_0013217 3300049590 Bacteria 6002
319 Ga0501074_0062380 3300049590 Bacteria 2684
320 Ga0501079_0361312 3300049741 Bacteria 1138
321 Ga0501080_0109498 3300049742 Bacteria 2560
322 Ga0501080_0133536 3300049742 Bacteria 2297
323 nmdc:mga03683_104439_c1 3300050489 Bacteria 1247
324 Ga0495601_0049963 3300053077 Unclassified 2638
325 Ga0495619_0017777 3300053085 Bacteria 4505
326 Ga0495619_0025934 3300053085 Unclassified 3768
327 Ga0495619_0439343 3300053085 Bacteria 900
328 Ga0495619_0509869 3300053085 Bacteria 827
329 Ga0501084_0248632 3300054114 Bacteria 1501
330 Ga0466962_0004216 3300061719 Bacteria 6887
331 Ga0466962_0005858 3300061719 Bacteria 5904
332 Ga0466962_0021829 3300061719 Bacteria 3074
333 Ga0466962_0023407 3300061719 Bacteria 2969
334 Ga0466962_0026806 3300061719 Bacteria 2767
335 Ga0466962_0031080 3300061719 Bacteria 2556
336 Ga0466962_0205102 3300061719 Bacteria 964
337 Ga0530510_0267478 3300061734 Bacteria 1276
338 Ga0105240_10089646
339 Ga0070658_10016442
340 Ga0070658_10037475
341 Ga0070658_10068990
342 Ga0070658_10168845
343 Ga0070683_100000373
344 Ga0070683_100009162
345 Ga0070680_100055429
346 Ga0070680_100118985
347 Ga0070680_100350187
348 Ga0070682_100006444
349 Ga0070660_100003281
350 Ga0070660_100005997
351 Ga0070660_100053604
352 Ga0070660_100353726
353 Ga0070661_100041177
354 Ga0070661_100095708
355 Ga0070661_100212552
356 Ga0070674_100197241
357 Ga0070659_100041559
358 Ga0070659_100264768
359 Ga0070659_100804409
360 Ga0070659_100809297
361 Ga0070709_10046900
362 Ga0070714_100007856
363 Ga0070714_100010962
364 Ga0070714_100099455
365 Ga0070714_100591616
366 Ga0070714_101160717
367 Ga0070713_100125313
368 Ga0070713_100560921
369 Ga0070681_10034475
370 Ga0070681_10088900
371 Ga0070681_10108162
372 Ga0070681_10146629
373 Ga0070681_10385369
374 Ga0070707_100418925
375 Ga0070698_100046034
376 Ga0070698_100088207
377 Ga0070699_100368739
378 Ga0070679_100059598
379 Ga0070679_100120003
380 Ga0070679_100174224
381 Ga0070679_100185097
382 Ga0070679_100253240
383 Ga0070684_100113096
384 Ga0070684_100154823
385 Ga0070684_100324317
386 Ga0070695_100195801
387 Ga0070696_100479294
388 Ga0068855_100005085
389 Ga0068855_100044913
390 Ga0068852_100012558
391 Ga0068852_100181221
392 Ga0070717_10227550
393 Ga0075365_10336444
394 Ga0075364_10206441
395 Ga0070716_100154521
396 Ga0070712_100220006
397 Ga0075362_10062912
398 Ga0075436_100168346
399 Ga0105240_10004954
400 Ga0105240_10076226
401 Ga0105240_10759723
402 Ga0105238_10206243
403 Ga0105238_10472451
404 Ga0157373_10885670
405 Ga0157371_10207822
406 Ga0157370_10029004
407 Ga0157369_10005681
408 Ga0157369_10030256
409 Ga0157369_10035071
410 Ga0157369_10135741
411 Ga0157369_10343911
412 Ga0157372_10162233
413 Ga0157372_10248259
414 Ga0182008_10002853
415 Ga0182008_10209175
416 Ga0182007_10006799
417 Ga0197907_11047976
418 Ga0197907_11444815
419 Ga0206356_10518193
420 Ga0206356_10554391
421 Ga0206356_10810889
422 Ga0206356_10830103
423 Ga0206354_10424275
424 Ga0206354_10442118
425 Ga0206354_10654699
426 Ga0206353_10064668
427 Ga0206353_10141117
428 Ga0206353_11018911
429 Ga0206353_11116827
430 Ga0206353_11615723
431 Ga0213871_10015849
432 Ga0224712_10019081
433 Ga0224712_10023492
434 Ga0207705_10004374
435 Ga0207705_10041487
436 Ga0207705_10145046
437 Ga0207705_10193385
438 Ga0207707_10023022
439 Ga0207707_10064211
440 Ga0207707_10181393
441 Ga0207707_10260427
442 Ga0207707_10450374
443 Ga0207695_10027324
444 Ga0207695_10086916
445 Ga0207695_10202545
446 Ga0207693_10577756
447 Ga0207660_10090197
448 Ga0207660_10183878
449 Ga0207660_10420233
450 Ga0207657_10002409
451 Ga0207657_10003083
452 Ga0207657_10024689
453 Ga0207657_10176555
454 Ga0207649_10018071
455 Ga0207649_10028651
456 Ga0207649_10384667
457 Ga0207652_10008595
458 Ga0207652_10030667
459 Ga0207652_10032438
460 Ga0207652_10186821
461 Ga0207694_10242064
462 Ga0207700_10146498
463 Ga0207664_10008730
464 Ga0207664_10032828
465 Ga0207664_10186898
466 Ga0207664_10592158
467 Ga0207690_10762655
468 Ga0207669_10074057
469 Ga0207665_10527523
470 Ga0207661_10005839
471 Ga0207661_10291575
472 Ga0207667_10042931
473 Ga0207667_10101896
474 Ga0207667_10674846
475 Ga0207667_11098730
476 Ga0207639_10884651
477 Ga0207702_10197891
478 Ga0265337_1042978
479 Ga0265326_10022974
480 Ga0265319_1005524
481 Ga0265334_10000542
482 Ga0265334_10149352
483 Ga0265318_10000276
484 Ga0265318_10005723
485 Ga0265323_10118262
486 Ga0265322_10030949
487 Ga0265336_10066990
488 Ga0265338_10009647
489 Ga0265338_10018336
490 Ga0265338_10027890
491 Ga0265338_10028087
492 Ga0265330_10000888
493 Ga0265328_10001224
494 Ga0265320_10029021
495 Ga0265320_10140211
496 Ga0265325_10001745
497 Ga0265329_10004524
498 Ga0265329_10011225
499 Ga0265340_10001237
500 Ga0265340_10056758
501 Ga0265339_10042865
502 Ga0265331_10000959
503 Ga0265331_10021613
504 Ga0265327_10012224
505 Ga0265316_10002153
506 Ga0265316_10053879
507 Ga0265313_10002758
508 Ga0265314_10018788
509 Ga0265314_10027632
510 Ga0265314_10154685
511 Ga0265342_10011564
512 Ga0265342_10017711
513 Ga0307413_10197956
514 Ga0307406_10025783
515 Ga0307407_10078949
516 Ga0307412_10083774
517 Ga0307416_100888632
518 Ga0307414_10451331
519 Ga0307415_100122426
520 Ga0373945_0010063
521 Ga0395899_0059485
522 Ga0395900_0058305
523 Ga0395900_0134639
524 Ga0395900_0233099
525 Ga0395900_0681266
526 Ga0395898_0109744
527 Ga0395898_0276185
528 Ga0395898_0305521
529 Ga0395898_1092677
530 Ga0395901_0073900
531 Ga0395901_0118984
532 Ga0395901_0350423
533 Ga0395901_0400271
534 Ga0395901_0429128
535 Ga0395901_0634174
536 Ga0395901_0702936
537 Ga0436360_0718639
538 Ga0436362_0405266
539 Ga0466969_0037552
540 Ga0466972_0189051
541 Ga0466972_0325509
542 Ga0466965_0032145
543 Ga0466966_0004058
544 Ga0466966_0048641
545 Ga0466961_0018390
546 Ga0466961_0030679
547 Ga0466961_0062709
548 Ga0466961_0317976
549 Ga0466963_0000914
550 Ga0466963_0001298
551 Ga0466963_0002207
552 Ga0466963_0004328
553 Ga0466963_0011980
554 Ga0466963_0015949
555 Ga0466963_0066982
556 Ga0466963_0108439
557 Ga0466963_0228472
558 Ga0466963_0537282
559 Ga0466964_0005774
560 Ga0466964_0036992
561 Ga0466964_0096768
562 Ga0466964_0109368
563 Ga0466964_0366316
564 Ga0466971_0000350
565 Ga0466971_0014706
566 Ga0466971_0024658
567 Ga0466971_0129357
568 Ga0466971_0131832
569 Ga0466968_0019491
570 Ga0466968_0043342
571 Ga0466968_0059894
572 Ga0466968_0062574
573 Ga0466968_0207190
574 Ga0466957_0000833
575 Ga0466957_0011590
576 Ga0466957_0028805
577 Ga0466957_0036936
578 Ga0466957_0674242
579 Ga0466957_0856254
580 Ga0466959_0029171
581 Ga0466959_0031766
582 Ga0466959_0037865
583 Ga0466959_0059877
584 Ga0466959_0190873
585 Ga0466958_0000492
586 Ga0466958_0001960
587 Ga0466958_0002049
588 Ga0466958_0008430
589 Ga0466958_0008552
590 Ga0466967_0000295
591 Ga0466967_0001317
592 Ga0466967_0013679
593 Ga0466967_0020088
594 Ga0466967_0024031
595 Ga0466967_0027275
596 Ga0466967_0037168
597 Ga0466967_0038971
598 Ga0466967_0055514
599 Ga0466967_0062227
600 Ga0466967_0064570
601 Ga0466967_0096251
602 Ga0466967_0121367
603 Ga0466967_0154953
604 Ga0466967_0169281
605 Ga0466967_0190148
606 Ga0466967_0594899
607 Ga0466967_0694535
608 Ga0495592_0010091
609 Ga0495592_0215187
610 Ga0495603_0077899
611 Ga0495641_0027243
612 Ga0495653_0074644
613 Ga0495582_0412087
614 Ga0495594_0128756
615 Ga0495594_0307425
616 Ga0495608_0142368
617 Ga0495630_0082353
618 Ga0495630_0233560
619 Ga0495644_0045851
620 Ga0495652_0167817
621 Ga0495652_0232754
622 Ga0495645_0233382
623 Ga0495667_0445239
624 Ga0495634_0101906
625 Ga0495635_0205360
626 Ga0495635_0426421
627 Ga0495657_0026167
628 Ga0495657_0201628
629 Ga0495680_0028988
630 Ga0495593_0059106
631 Ga0495602_0671267
632 Ga0496100_0151207
633 Ga0496101_0861837
634 Ga0496102_1020609
635 Ga0496102_1348610
636 Ga0496103_0073821
637 Ga0496104_0051381
638 Ga0496104_0608659
639 Ga0496110_1025063
640 Ga0496112_0068713
641 Ga0496112_0177714
642 Ga0496112_0368284
643 Ga0496112_0506870
644 Ga0496113_0062910
645 Ga0496114_0046771
646 Ga0496115_0012935
647 Ga0501047_0260713
648 Ga0501067_0054278
649 Ga0501067_0073346
650 Ga0501069_0112310
651 Ga0501069_0166387
652 Ga0501070_0029937
653 Ga0501070_0139995
654 Ga0501072_0002846
655 Ga0501074_0013217
656 Ga0501074_0062380
657 Ga0501079_0361312
658 Ga0501080_0109498
659 Ga0501080_0133536
660 nmdc:mga03683_104439_c1
661 Ga0495601_0049963
662 Ga0495619_0017777
663 Ga0495619_0025934
664 Ga0495619_0439343
665 Ga0495619_0509869
666 Ga0501084_0248632
667 Ga0466962_0004216
668 Ga0466962_0005858
669 Ga0466962_0021829
670 Ga0466962_0023407
671 Ga0466962_0026806
672 Ga0466962_0031080
673 Ga0466962_0205102
674 Ga0530510_0267478

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

76

142

0.98

PF04545

Sigma70_r4

Sigma-70, region 4

175

224

0.98

PF08281

Sigma70_r4_2

Sigma-70, region 4

169

222

0.96

Map