F413038

General Info

Members Datasets Scaffolds Average Seq Length
337 154 674 248

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10067862|Ga0099795_100678621
Length 269
Sequence MWPALDSSVGSRRLTRQEERMGKLEGKIALVTGGNSGIGLATAKRFASEDAHVFITGRRDGELAAALKEIGKNVTGVQGDVSKLGDIDRLFSQIKREKGRLDIVFANAGVAKYASLGDITEEFYDSIFDINVKGLLFTVQKALPLLPDGASIILNASIVASKGLPSISVYSATKAAVRSFARTWTTDLKHRRIRVNAISPGWIDTPGLSHLLDATEADEQSRAMIKSMVPLGRLGTSDEIAKAVVFLASDDSSYVTGTQLFADGGFAQV

Samples

Sample ID Description Type Environment
1 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
2 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
3 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
62 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
103 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
104 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
107 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
108 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
109 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
146 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
147 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
148 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
151 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
152 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
153 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
154 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0
Isolates 0.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.37
Nodule 0.59
Rhizoplane 1.19
Rhizosphere 94.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099795_10067862 3300007788 Bacteria 1339
2 Ga0055535_1000056 3300003761 Bacteria 128204
3 Ga0055529_1000165 3300003763 Bacteria 91442
4 Ga0070670_100054880 3300005331 Bacteria 3421
5 Ga0070660_100013772 3300005339 Bacteria 5817
6 Ga0070692_10016203 3300005345 Bacteria 3543
7 Ga0070688_100397988 3300005365 Bacteria 1019
8 Ga0070659_100170519 3300005366 Bacteria 1782
9 Ga0070709_10004139 3300005434 Bacteria 7825
10 Ga0070713_100020833 3300005436 Bacteria 5033
11 Ga0070713_100378673 3300005436 Bacteria 1318
12 Ga0070711_100112866 3300005439 Bacteria 1998
13 Ga0070705_100003736 3300005440 Bacteria 7452
14 Ga0070705_100367159 3300005440 Bacteria 1055
15 Ga0070700_100057654 3300005441 Bacteria 2437
16 Ga0070700_100181301 3300005441 Bacteria 1466
17 Ga0070694_100112031 3300005444 Bacteria 1945
18 Ga0070708_100006592 3300005445 Bacteria 9241
19 Ga0070708_100029371 3300005445 Bacteria 4741
20 Ga0070708_100089305 3300005445 Bacteria 2804
21 Ga0070708_100217898 3300005445 Bacteria 1789
22 Ga0070662_100316246 3300005457 Bacteria 1272
23 Ga0070706_100002217 3300005467 Bacteria 19744
24 Ga0070706_100029418 3300005467 Bacteria 5061
25 Ga0070706_100138868 3300005467 Bacteria 2268
26 Ga0070706_100150083 3300005467 Bacteria 2176
27 Ga0070706_100319229 3300005467 Bacteria 1449
28 Ga0070706_100381514 3300005467 Bacteria 1313
29 Ga0070706_100440452 3300005467 Bacteria 1213
30 Ga0070707_100012566 3300005468 Bacteria 7909
31 Ga0070707_100022908 3300005468 Bacteria 5906
32 Ga0070707_100042863 3300005468 Bacteria 4333
33 Ga0070707_100055382 3300005468 Bacteria 3802
34 Ga0070707_100135290 3300005468 Bacteria 2397
35 Ga0070707_100202974 3300005468 Bacteria 1932
36 Ga0070707_100449091 3300005468 Bacteria 1250
37 Ga0070707_100582272 3300005468 Bacteria 1081
38 Ga0070698_100079565 3300005471 Bacteria 3274
39 Ga0070699_100043657 3300005518 Bacteria 3880
40 Ga0070699_100053110 3300005518 Bacteria 3507
41 Ga0070699_100124721 3300005518 Bacteria 2266
42 Ga0070699_100228119 3300005518 Bacteria 1660
43 Ga0070699_100427913 3300005518 Bacteria 1199
44 Ga0070697_100152393 3300005536 Bacteria 1949
45 Ga0070697_100182148 3300005536 Bacteria 1781
46 Ga0070697_100221748 3300005536 Bacteria 1612
47 Ga0070695_100006214 3300005545 Bacteria 7055
48 Ga0070696_100029853 3300005546 Bacteria 3729
49 Ga0070704_100045453 3300005549 Bacteria 3055
50 Ga0070704_100124130 3300005549 Bacteria 1989
51 Ga0068857_100072217 3300005577 Bacteria 3075
52 Ga0068859_100019588 3300005617 Bacteria 6797
53 Ga0068864_100413591 3300005618 Bacteria 1284
54 Ga0068870_10066190 3300005840 Bacteria 1957
55 Ga0068863_100094234 3300005841 Bacteria 2842
56 Ga0068860_100065072 3300005843 Bacteria 3463
57 Ga0068860_100717387 3300005843 Bacteria 1010
58 Ga0068862_100044934 3300005844 Bacteria 3768
59 Ga0081538_10011313 3300005981 Bacteria 7238
60 Ga0081538_10058991 3300005981 Bacteria 2221
61 Ga0070717_10036019 3300006028 Bacteria 4011
62 Ga0070717_10344148 3300006028 Bacteria 1332
63 Ga0070715_10031125 3300006163 Bacteria 2163
64 Ga0070716_100011415 3300006173 Bacteria 4472
65 Ga0070716_100207181 3300006173 Bacteria 1308
66 Ga0070712_100014570 3300006175 Bacteria 5046
67 Ga0070712_100228707 3300006175 Bacteria 1476
68 Ga0075428_100000032 3300006844 Bacteria 118320
69 Ga0075428_100289069 3300006844 Bacteria 1763
70 Ga0075428_100416797 3300006844 Bacteria 1439
71 Ga0075430_100000002 3300006846 Bacteria 150510
72 Ga0075430_100008629 3300006846 Bacteria 8595
73 Ga0075430_100065381 3300006846 Bacteria 3055
74 Ga0075430_100125915 3300006846 Bacteria 2136
75 Ga0075431_100000009 3300006847 Bacteria 101621
76 Ga0075431_100066836 3300006847 Bacteria 3711
77 Ga0075431_100117021 3300006847 Bacteria 2750
78 Ga0075431_100132032 3300006847 Bacteria 2575
79 Ga0075431_100294754 3300006847 Bacteria 1640
80 Ga0075431_100597414 3300006847 Bacteria 1088
81 Ga0075431_100815201 3300006847 Bacteria 906
82 Ga0075433_10009538 3300006852 Bacteria 7759
83 Ga0075433_10023414 3300006852 Bacteria 5198
84 Ga0075433_10088928 3300006852 Bacteria 2730
85 Ga0075433_10264573 3300006852 Bacteria 1524
86 Ga0075433_10565687 3300006852 Bacteria 999
87 Ga0075434_100001334 3300006871 Bacteria 20666
88 Ga0075434_100044387 3300006871 Bacteria 4409
89 Ga0075434_100063081 3300006871 Bacteria 3689
90 Ga0075434_100094393 3300006871 Bacteria 2996
91 Ga0075434_100258043 3300006871 Bacteria 1762
92 Ga0075434_100521361 3300006871 Bacteria 1209
93 Ga0075429_100000006 3300006880 Bacteria 98571
94 Ga0075429_100032415 3300006880 Bacteria 4542
95 Ga0075429_100061990 3300006880 Bacteria 3258
96 Ga0075429_100142313 3300006880 Bacteria 2100
97 Ga0075436_100038195 3300006914 Bacteria 3314
98 Ga0097620_100019589 3300006931 Bacteria 6797
99 Ga0079104_1008528 3300006946 Bacteria 3576
100 Ga0075435_100002475 3300007076 Bacteria 12279
101 Ga0075435_100032293 3300007076 Bacteria 4133
102 Ga0075435_100063074 3300007076 Bacteria 3009
103 Ga0099794_10185328 3300007265 Bacteria 1063
104 Ga0099795_10061992 3300007788 Bacteria 1390
105 Ga0111539_10108997 3300009094 Bacteria 3250
106 Ga0111539_10148746 3300009094 Bacteria 2742
107 Ga0114129_10000875 3300009147 Bacteria 39178
108 Ga0114129_10071692 3300009147 Bacteria 4831
109 Ga0114129_10084449 3300009147 Bacteria 4408
110 Ga0114129_10144577 3300009147 Bacteria 3258
111 Ga0114129_10370614 3300009147 Bacteria 1893
112 Ga0114129_10518145 3300009147 Bacteria 1555
113 Ga0114129_10588339 3300009147 Bacteria 1443
114 Ga0114129_10629680 3300009147 Bacteria 1387
115 Ga0114129_10651641 3300009147 Bacteria 1359
116 Ga0114129_10753687 3300009147 Bacteria 1246
117 Ga0105243_10034340 3300009148 Bacteria 3925
118 Ga0105241_10000112 3300009174 Bacteria 58201
119 Ga0105241_10145130 3300009174 Bacteria 1936
120 Ga0105242_10066941 3300009176 Bacteria 2968
121 Ga0105248_10279089 3300009177 Bacteria 1881
122 Ga0105248_10734709 3300009177 Bacteria 1114
123 Ga0105249_10514448 3300009553 Bacteria 1244
124 Ga0099796_10013544 3300010159 Bacteria 2332
125 Ga0099796_10043109 3300010159 Bacteria 1536
126 Ga0105246_10280004 3300011119 Bacteria 1337
127 Ga0157369_10004092 3300013105 Bacteria 17272
128 Ga0163163_10117840 3300014325 Bacteria 2687
129 Ga0157380_10142223 3300014326 Bacteria 2063
130 Ga0209258_100071 3300025242 Bacteria 278319
131 Ga0209759_1000797 3300025256 Bacteria 25577
132 Ga0209759_1002157 3300025256 Bacteria 9036
133 Ga0209455_1000030 3300025272 Bacteria 533479
134 Ga0207642_10209635 3300025899 Bacteria 1082
135 Ga0207685_10038222 3300025905 Bacteria 1773
136 Ga0207699_10020253 3300025906 Bacteria 3561
137 Ga0207643_10088877 3300025908 Bacteria 1799
138 Ga0207684_10006185 3300025910 Bacteria 10936
139 Ga0207684_10075430 3300025910 Bacteria 2866
140 Ga0207684_10112588 3300025910 Bacteria 2329
141 Ga0207684_10129814 3300025910 Bacteria 2163
142 Ga0207684_10243758 3300025910 Bacteria 1551
143 Ga0207654_10000028 3300025911 Bacteria 125787
144 Ga0207654_10029366 3300025911 Bacteria 3009
145 Ga0207693_10022138 3300025915 Bacteria 5053
146 Ga0207693_10129916 3300025915 Bacteria 1980
147 Ga0207663_10031405 3300025916 Bacteria 3143
148 Ga0207663_10046683 3300025916 Bacteria 2670
149 Ga0207662_10095799 3300025918 Bacteria 1832
150 Ga0207657_10136971 3300025919 Bacteria 2002
151 Ga0207646_10017968 3300025922 Bacteria 6605
152 Ga0207646_10020663 3300025922 Bacteria 6098
153 Ga0207646_10022677 3300025922 Bacteria 5780
154 Ga0207646_10114025 3300025922 Bacteria 2427
155 Ga0207646_10168144 3300025922 Bacteria 1980
156 Ga0207646_10176157 3300025922 Bacteria 1932
157 Ga0207646_10413399 3300025922 Bacteria 1218
158 Ga0207650_10027128 3300025925 Bacteria 4096
159 Ga0207690_10025307 3300025932 Bacteria 3724
160 Ga0207690_10054474 3300025932 Bacteria 2689
161 Ga0207706_10312797 3300025933 Bacteria 1367
162 Ga0207686_10045203 3300025934 Bacteria 2709
163 Ga0207665_10046892 3300025939 Bacteria 2896
164 Ga0207665_10196931 3300025939 Bacteria 1466
165 Ga0207689_10045892 3300025942 Bacteria 3613
166 Ga0207712_10281453 3300025961 Bacteria 1357
167 Ga0207712_10293558 3300025961 Bacteria 1331
168 Ga0207639_10315419 3300026041 Bacteria 1386
169 Ga0207708_10051588 3300026075 Bacteria 3132
170 Ga0207708_10191022 3300026075 Bacteria 1630
171 Ga0207641_10129604 3300026088 Bacteria 2263
172 Ga0207676_10067863 3300026095 Bacteria 2850
173 Ga0207674_10103129 3300026116 Bacteria 2832
174 Ga0209281_1015817 3300027111 Bacteria 1564
175 Ga0207428_10012367 3300027907 Bacteria 7500
176 Ga0268265_10647796 3300028380 Bacteria 1015
177 Ga0268264_10024768 3300028381 Bacteria 4902
178 Ga0268264_10552308 3300028381 Bacteria 1129
179 Ga0265338_10025645 3300028800 Bacteria 5975
180 Ga0265325_10022236 3300031241 Bacteria 3476
181 Ga0265340_10003964 3300031247 Bacteria 8326
182 Ga0265339_10167222 3300031249 Bacteria 1103
183 Ga0307408_100453047 3300031548 Bacteria 1113
184 Ga0307516_10000803 3300031730 Bacteria 43064
185 Ga0307410_10407412 3300031852 Bacteria 1100
186 Ga0307414_10315217 3300032004 Bacteria 1329
187 Ga0307411_10091286 3300032005 Bacteria 2127
188 Ga0395898_0603846 3300037466 Bacteria 1040
189 Ga0395905_0139283 3300037471 Bacteria 2283
190 Ga0395901_0315685 3300038443 Bacteria 1618
191 Ga0451807_2760673 3300041486 Bacteria 1259
192 Ga0439441_002139 3300042001 Bacteria 2734
193 Ga0439441_018372 3300042001 Bacteria 1264
194 Ga0439435_0049531 3300042436 Bacteria 1199
195 Ga0495651_0285030 3300046462 Bacteria 1114
196 Ga0495605_0001664 3300046474 Bacteria 14288
197 Ga0495639_0012776 3300046475 Bacteria 3623
198 Ga0495585_0000774 3300046492 Bacteria 28226
199 Ga0495597_0002978 3300046542 Bacteria 10254
200 Ga0496102_0183434 3300048905 Bacteria 1972
201 Ga0496106_0213236 3300048909 Bacteria 1539
202 Ga0496115_0201257 3300048918 Bacteria 1645
203 Ga0501031_0321951 3300049568 Bacteria 1001
204 Ga0501033_0010123 3300049570 Bacteria 7237
205 Ga0501033_0160725 3300049570 Bacteria 1617
206 Ga0501036_0018472 3300049572 Bacteria 5843
207 Ga0501036_0072607 3300049572 Bacteria 2909
208 Ga0501036_0534839 3300049572 Bacteria 974
209 Ga0501038_0002535 3300049574 Bacteria 17033
210 Ga0501038_0144016 3300049574 Bacteria 1947
211 Ga0501038_0350666 3300049574 Bacteria 1149
212 Ga0501039_0001655 3300049575 Bacteria 16416
213 Ga0501039_0222994 3300049575 Bacteria 1482
214 Ga0501039_0267197 3300049575 Bacteria 1344
215 Ga0501039_0490296 3300049575 Bacteria 965
216 Ga0501040_0001623 3300049576 Bacteria 14324
217 Ga0501040_0050429 3300049576 Bacteria 2847
218 Ga0501040_0308476 3300049576 Bacteria 1131
219 Ga0501041_0001075 3300049577 Bacteria 14955
220 Ga0501041_0019139 3300049577 Bacteria 4084
221 Ga0501041_0030742 3300049577 Bacteria 3242
222 Ga0501041_0061753 3300049577 Bacteria 2294
223 Ga0501041_0158135 3300049577 Bacteria 1416
224 Ga0501042_0000853 3300049578 Bacteria 16993
225 Ga0501042_0068692 3300049578 Bacteria 2534
226 Ga0501042_0146070 3300049578 Bacteria 1705
227 Ga0501042_0560149 3300049578 Bacteria 831
228 Ga0501046_0004111 3300049580 Bacteria 13261
229 Ga0501046_0038108 3300049580 Bacteria 3860
230 Ga0501046_0064341 3300049580 Bacteria 2863
231 Ga0501048_0000322 3300049582 Bacteria 32900
232 Ga0501048_0045524 3300049582 Bacteria 3134
233 Ga0501048_0062812 3300049582 Bacteria 2628
234 Ga0501068_0140253 3300049584 Bacteria 1515
235 Ga0501068_0314322 3300049584 Bacteria 1004
236 Ga0501070_0157233 3300049586 Bacteria 1875
237 Ga0501071_0000026 3300049587 Bacteria 48260
238 Ga0501071_0247946 3300049587 Bacteria 1344
239 Ga0501071_0317904 3300049587 Bacteria 1182
240 Ga0501072_0003698 3300049588 Bacteria 11538
241 Ga0501072_0005475 3300049588 Bacteria 9664
242 Ga0501072_0015933 3300049588 Bacteria 5763
243 Ga0501072_0105505 3300049588 Bacteria 2241
244 Ga0501074_0037198 3300049590 Bacteria 3529
245 Ga0501074_0090960 3300049590 Bacteria 2185
246 Ga0501075_0000505 3300049591 Bacteria 23476
247 Ga0501075_0005972 3300049591 Bacteria 8338
248 Ga0501075_0018718 3300049591 Bacteria 5017
249 Ga0501075_0061480 3300049591 Bacteria 2830
250 Ga0501075_0335721 3300049591 Bacteria 1152
251 Ga0501075_0347787 3300049591 Bacteria 1130
252 Ga0501076_0000035 3300049592 Bacteria 67198
253 Ga0501076_0016498 3300049592 Bacteria 5599
254 Ga0501076_0038894 3300049592 Bacteria 3734
255 Ga0501076_0130140 3300049592 Bacteria 2041
256 Ga0501076_0133273 3300049592 Bacteria 2016
257 Ga0501076_0284955 3300049592 Bacteria 1353
258 Ga0501076_0309319 3300049592 Bacteria 1296
259 Ga0501077_0015349 3300049593 Bacteria 4822
260 Ga0501079_0007113 3300049741 Bacteria 8444
261 Ga0501079_0034608 3300049741 Bacteria 3888
262 Ga0501079_0075364 3300049741 Bacteria 2609
263 Ga0501079_0101922 3300049741 Bacteria 2226
264 Ga0501079_0507630 3300049741 Bacteria 948
265 Ga0501080_0018883 3300049742 Bacteria 6384
266 Ga0501080_0067988 3300049742 Bacteria 3314
267 Ga0501080_0120289 3300049742 Bacteria 2434
268 Ga0501081_0000011 3300049743 Bacteria 67455
269 Ga0501081_0006608 3300049743 Bacteria 7533
270 Ga0501081_0046516 3300049743 Bacteria 2983
271 Ga0501081_0370477 3300049743 Bacteria 1057
272 Ga0501083_0067454 3300049744 Bacteria 2382
273 Ga0501045_0001077 3300049824 Bacteria 18038
274 Ga0501045_0019238 3300049824 Bacteria 4865
275 Ga0501045_0175928 3300049824 Bacteria 1594
276 nmdc:mga05p37_117667_c1 3300050507 Bacteria 3266
277 nmdc:mga05p37_138426_c1 3300050507 Bacteria 2983
278 nmdc:mga05p37_17069_c1 3300050507 Bacteria 8757
279 nmdc:mga05p37_173272_c1 3300050507 Bacteria 2630
280 nmdc:mga05p37_26693_c1 3300050507 Bacteria 7024
281 nmdc:mga05p37_383912_c1 3300050507 Bacteria 1645
282 nmdc:mga05p37_410931_c1 3300050507 Bacteria 1578
283 nmdc:mga05p37_697522_c1 3300050507 Bacteria 1128
284 nmdc:mga09592_159_c1 3300050508 Bacteria 47011
285 nmdc:mga09592_174968_c1 3300050508 Bacteria 1856
286 nmdc:mga09592_21746_c1 3300050508 Bacteria 5289
287 nmdc:mga09592_64815_c1 3300050508 Bacteria 3094
288 nmdc:mga0qj67_2152_c1 3300050509 Bacteria 14004
289 nmdc:mga0qj67_24957_c1 3300050509 Bacteria 4614
290 nmdc:mga0qj67_3810_c1 3300050509 Bacteria 10897
291 nmdc:mga0qj67_94742_c1 3300050509 Bacteria 2402
292 nmdc:mga06r32_183291_c1 3300050510 Bacteria 2080
293 nmdc:mga06r32_227995_c1 3300050510 Bacteria 1851
294 nmdc:mga06r32_361_c1 3300050510 Bacteria 38128
295 nmdc:mga06r32_46440_c1 3300050510 Bacteria 4144
296 nmdc:mga06r32_90900_c1 3300050510 Bacteria 2983
297 nmdc:mga08y16_555999_c1 3300050511 Bacteria 1161
298 nmdc:mga08y16_57051_c1 3300050511 Bacteria 4082
299 nmdc:mga0n895_34503_c1 3300050512 Bacteria 4871
300 nmdc:mga0n895_585665_c1 3300050512 Bacteria 1119
301 nmdc:mga0n895_607153_c1 3300050512 Bacteria 1096
302 nmdc:mga0n895_62397_c1 3300050512 Bacteria 3683
303 nmdc:mga0n895_8963_c1 3300050512 Bacteria 8722
304 nmdc:mga0n895_9197_c1 3300050512 Bacteria 8631
305 nmdc:mga0rr50_349250_c1 3300050513 Bacteria 1244
306 nmdc:mga0rr50_80103_c1 3300050513 Bacteria 2517
307 nmdc:mga08x19_104945_c1 3300050514 Bacteria 1878
308 nmdc:mga08x19_257915_c1 3300050514 Bacteria 1205
309 nmdc:mga0a205_1824_c1 3300050515 Bacteria 18416
310 nmdc:mga0a205_285890_c1 3300050515 Bacteria 1524
311 nmdc:mga0a205_310119_c1 3300050515 Bacteria 1450
312 nmdc:mga0a205_43828_c1 3300050515 Bacteria 4313
313 nmdc:mga0a205_7353_c1 3300050515 Bacteria 9974
314 nmdc:mga0a205_74948_c1 3300050515 Bacteria 3269
315 Ga0500635_0000112 3300053080 Bacteria 49317
316 Ga0500618_000041 3300053125 Bacteria 111404
317 Ga0500559_0024686 3300053136 Bacteria 2558
318 Ga0500616_0001114 3300053153 Bacteria 27738
319 Ga0501084_0000939 3300054114 Bacteria 22536
320 Ga0501084_0010199 3300054114 Bacteria 7769
321 Ga0501084_0015276 3300054114 Bacteria 6367
322 Ga0501084_0058669 3300054114 Bacteria 3220
323 Ga0501084_0285709 3300054114 Bacteria 1393
324 Ga0501082_0006520 3300060353 Bacteria 10120
325 Ga0501082_0034784 3300060353 Bacteria 4343
326 Ga0501082_0043380 3300060353 Bacteria 3878
327 Ga0501082_0198096 3300060353 Bacteria 1747
328 Ga0530510_0000034 3300061734 Bacteria 62610
329 Ga0530510_0000343 3300061734 Bacteria 30058
330 Ga0530510_0001119 3300061734 Bacteria 17836
331 Ga0530510_0013193 3300061734 Bacteria 5811
332 Ga0530510_0155561 3300061734 Bacteria 1689
333 Ga0530510_0257819 3300061734 Bacteria 1300
334 Ga0530510_0271966 3300061734 Bacteria 1264
335 2511130057 2510917021 Bacteria 5705459
336 2587738369 2585428059 Bacteria 8696589
337 2885530099 2885526491 Bacteria 7164189
338 Ga0099795_10067862
339 Ga0055535_1000056
340 Ga0055529_1000165
341 Ga0070670_100054880
342 Ga0070660_100013772
343 Ga0070692_10016203
344 Ga0070688_100397988
345 Ga0070659_100170519
346 Ga0070709_10004139
347 Ga0070713_100020833
348 Ga0070713_100378673
349 Ga0070711_100112866
350 Ga0070705_100003736
351 Ga0070705_100367159
352 Ga0070700_100057654
353 Ga0070700_100181301
354 Ga0070694_100112031
355 Ga0070708_100006592
356 Ga0070708_100029371
357 Ga0070708_100089305
358 Ga0070708_100217898
359 Ga0070662_100316246
360 Ga0070706_100002217
361 Ga0070706_100029418
362 Ga0070706_100138868
363 Ga0070706_100150083
364 Ga0070706_100319229
365 Ga0070706_100381514
366 Ga0070706_100440452
367 Ga0070707_100012566
368 Ga0070707_100022908
369 Ga0070707_100042863
370 Ga0070707_100055382
371 Ga0070707_100135290
372 Ga0070707_100202974
373 Ga0070707_100449091
374 Ga0070707_100582272
375 Ga0070698_100079565
376 Ga0070699_100043657
377 Ga0070699_100053110
378 Ga0070699_100124721
379 Ga0070699_100228119
380 Ga0070699_100427913
381 Ga0070697_100152393
382 Ga0070697_100182148
383 Ga0070697_100221748
384 Ga0070695_100006214
385 Ga0070696_100029853
386 Ga0070704_100045453
387 Ga0070704_100124130
388 Ga0068857_100072217
389 Ga0068859_100019588
390 Ga0068864_100413591
391 Ga0068870_10066190
392 Ga0068863_100094234
393 Ga0068860_100065072
394 Ga0068860_100717387
395 Ga0068862_100044934
396 Ga0081538_10011313
397 Ga0081538_10058991
398 Ga0070717_10036019
399 Ga0070717_10344148
400 Ga0070715_10031125
401 Ga0070716_100011415
402 Ga0070716_100207181
403 Ga0070712_100014570
404 Ga0070712_100228707
405 Ga0075428_100000032
406 Ga0075428_100289069
407 Ga0075428_100416797
408 Ga0075430_100000002
409 Ga0075430_100008629
410 Ga0075430_100065381
411 Ga0075430_100125915
412 Ga0075431_100000009
413 Ga0075431_100066836
414 Ga0075431_100117021
415 Ga0075431_100132032
416 Ga0075431_100294754
417 Ga0075431_100597414
418 Ga0075431_100815201
419 Ga0075433_10009538
420 Ga0075433_10023414
421 Ga0075433_10088928
422 Ga0075433_10264573
423 Ga0075433_10565687
424 Ga0075434_100001334
425 Ga0075434_100044387
426 Ga0075434_100063081
427 Ga0075434_100094393
428 Ga0075434_100258043
429 Ga0075434_100521361
430 Ga0075429_100000006
431 Ga0075429_100032415
432 Ga0075429_100061990
433 Ga0075429_100142313
434 Ga0075436_100038195
435 Ga0097620_100019589
436 Ga0079104_1008528
437 Ga0075435_100002475
438 Ga0075435_100032293
439 Ga0075435_100063074
440 Ga0099794_10185328
441 Ga0099795_10061992
442 Ga0111539_10108997
443 Ga0111539_10148746
444 Ga0114129_10000875
445 Ga0114129_10071692
446 Ga0114129_10084449
447 Ga0114129_10144577
448 Ga0114129_10370614
449 Ga0114129_10518145
450 Ga0114129_10588339
451 Ga0114129_10629680
452 Ga0114129_10651641
453 Ga0114129_10753687
454 Ga0105243_10034340
455 Ga0105241_10000112
456 Ga0105241_10145130
457 Ga0105242_10066941
458 Ga0105248_10279089
459 Ga0105248_10734709
460 Ga0105249_10514448
461 Ga0099796_10013544
462 Ga0099796_10043109
463 Ga0105246_10280004
464 Ga0157369_10004092
465 Ga0163163_10117840
466 Ga0157380_10142223
467 Ga0209258_100071
468 Ga0209759_1000797
469 Ga0209759_1002157
470 Ga0209455_1000030
471 Ga0207642_10209635
472 Ga0207685_10038222
473 Ga0207699_10020253
474 Ga0207643_10088877
475 Ga0207684_10006185
476 Ga0207684_10075430
477 Ga0207684_10112588
478 Ga0207684_10129814
479 Ga0207684_10243758
480 Ga0207654_10000028
481 Ga0207654_10029366
482 Ga0207693_10022138
483 Ga0207693_10129916
484 Ga0207663_10031405
485 Ga0207663_10046683
486 Ga0207662_10095799
487 Ga0207657_10136971
488 Ga0207646_10017968
489 Ga0207646_10020663
490 Ga0207646_10022677
491 Ga0207646_10114025
492 Ga0207646_10168144
493 Ga0207646_10176157
494 Ga0207646_10413399
495 Ga0207650_10027128
496 Ga0207690_10025307
497 Ga0207690_10054474
498 Ga0207706_10312797
499 Ga0207686_10045203
500 Ga0207665_10046892
501 Ga0207665_10196931
502 Ga0207689_10045892
503 Ga0207712_10281453
504 Ga0207712_10293558
505 Ga0207639_10315419
506 Ga0207708_10051588
507 Ga0207708_10191022
508 Ga0207641_10129604
509 Ga0207676_10067863
510 Ga0207674_10103129
511 Ga0209281_1015817
512 Ga0207428_10012367
513 Ga0268265_10647796
514 Ga0268264_10024768
515 Ga0268264_10552308
516 Ga0265338_10025645
517 Ga0265325_10022236
518 Ga0265340_10003964
519 Ga0265339_10167222
520 Ga0307408_100453047
521 Ga0307516_10000803
522 Ga0307410_10407412
523 Ga0307414_10315217
524 Ga0307411_10091286
525 Ga0395898_0603846
526 Ga0395905_0139283
527 Ga0395901_0315685
528 Ga0451807_2760673
529 Ga0439441_002139
530 Ga0439441_018372
531 Ga0439435_0049531
532 Ga0495651_0285030
533 Ga0495605_0001664
534 Ga0495639_0012776
535 Ga0495585_0000774
536 Ga0495597_0002978
537 Ga0496102_0183434
538 Ga0496106_0213236
539 Ga0496115_0201257
540 Ga0501031_0321951
541 Ga0501033_0010123
542 Ga0501033_0160725
543 Ga0501036_0018472
544 Ga0501036_0072607
545 Ga0501036_0534839
546 Ga0501038_0002535
547 Ga0501038_0144016
548 Ga0501038_0350666
549 Ga0501039_0001655
550 Ga0501039_0222994
551 Ga0501039_0267197
552 Ga0501039_0490296
553 Ga0501040_0001623
554 Ga0501040_0050429
555 Ga0501040_0308476
556 Ga0501041_0001075
557 Ga0501041_0019139
558 Ga0501041_0030742
559 Ga0501041_0061753
560 Ga0501041_0158135
561 Ga0501042_0000853
562 Ga0501042_0068692
563 Ga0501042_0146070
564 Ga0501042_0560149
565 Ga0501046_0004111
566 Ga0501046_0038108
567 Ga0501046_0064341
568 Ga0501048_0000322
569 Ga0501048_0045524
570 Ga0501048_0062812
571 Ga0501068_0140253
572 Ga0501068_0314322
573 Ga0501070_0157233
574 Ga0501071_0000026
575 Ga0501071_0247946
576 Ga0501071_0317904
577 Ga0501072_0003698
578 Ga0501072_0005475
579 Ga0501072_0015933
580 Ga0501072_0105505
581 Ga0501074_0037198
582 Ga0501074_0090960
583 Ga0501075_0000505
584 Ga0501075_0005972
585 Ga0501075_0018718
586 Ga0501075_0061480
587 Ga0501075_0335721
588 Ga0501075_0347787
589 Ga0501076_0000035
590 Ga0501076_0016498
591 Ga0501076_0038894
592 Ga0501076_0130140
593 Ga0501076_0133273
594 Ga0501076_0284955
595 Ga0501076_0309319
596 Ga0501077_0015349
597 Ga0501079_0007113
598 Ga0501079_0034608
599 Ga0501079_0075364
600 Ga0501079_0101922
601 Ga0501079_0507630
602 Ga0501080_0018883
603 Ga0501080_0067988
604 Ga0501080_0120289
605 Ga0501081_0000011
606 Ga0501081_0006608
607 Ga0501081_0046516
608 Ga0501081_0370477
609 Ga0501083_0067454
610 Ga0501045_0001077
611 Ga0501045_0019238
612 Ga0501045_0175928
613 nmdc:mga05p37_117667_c1
614 nmdc:mga05p37_138426_c1
615 nmdc:mga05p37_17069_c1
616 nmdc:mga05p37_173272_c1
617 nmdc:mga05p37_26693_c1
618 nmdc:mga05p37_383912_c1
619 nmdc:mga05p37_410931_c1
620 nmdc:mga05p37_697522_c1
621 nmdc:mga09592_159_c1
622 nmdc:mga09592_174968_c1
623 nmdc:mga09592_21746_c1
624 nmdc:mga09592_64815_c1
625 nmdc:mga0qj67_2152_c1
626 nmdc:mga0qj67_24957_c1
627 nmdc:mga0qj67_3810_c1
628 nmdc:mga0qj67_94742_c1
629 nmdc:mga06r32_183291_c1
630 nmdc:mga06r32_227995_c1
631 nmdc:mga06r32_361_c1
632 nmdc:mga06r32_46440_c1
633 nmdc:mga06r32_90900_c1
634 nmdc:mga08y16_555999_c1
635 nmdc:mga08y16_57051_c1
636 nmdc:mga0n895_34503_c1
637 nmdc:mga0n895_585665_c1
638 nmdc:mga0n895_607153_c1
639 nmdc:mga0n895_62397_c1
640 nmdc:mga0n895_8963_c1
641 nmdc:mga0n895_9197_c1
642 nmdc:mga0rr50_349250_c1
643 nmdc:mga0rr50_80103_c1
644 nmdc:mga08x19_104945_c1
645 nmdc:mga08x19_257915_c1
646 nmdc:mga0a205_1824_c1
647 nmdc:mga0a205_285890_c1
648 nmdc:mga0a205_310119_c1
649 nmdc:mga0a205_43828_c1
650 nmdc:mga0a205_7353_c1
651 nmdc:mga0a205_74948_c1
652 Ga0500635_0000112
653 Ga0500618_000041
654 Ga0500559_0024686
655 Ga0500616_0001114
656 Ga0501084_0000939
657 Ga0501084_0010199
658 Ga0501084_0015276
659 Ga0501084_0058669
660 Ga0501084_0285709
661 Ga0501082_0006520
662 Ga0501082_0034784
663 Ga0501082_0043380
664 Ga0501082_0198096
665 Ga0530510_0000034
666 Ga0530510_0000343
667 Ga0530510_0001119
668 Ga0530510_0013193
669 Ga0530510_0155561
670 Ga0530510_0257819
671 Ga0530510_0271966
672 2511130057
673 2587738369
674 2885530099

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

27

216

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

33

267

0.95

PF08659

KR

KR domain

28

199

0.92

PF23441

21

269

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e3z-assembly1.cif.gz_B crystal structure of a oxidoreductase from rhizobium etli cfn 42 0.9652 4 248
4e3z-assembly1.cif.gz_A crystal structure of a oxidoreductase from rhizobium etli cfn 42 0.9648 2 248
8bci-assembly1.cif.gz_B crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 0.9604 1 248
4iqg-assembly1.cif.gz_B crystal structure of bpro0239 oxidoreductase from polaromonas sp. js666 in nadp bound form 0.9599 3 248
8bci-assembly2.cif.gz_C crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 0.9589 3 248
ID Description Score Start End Superfamily
af_Q5BLE6_285_550_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9573 3 247 3.40.50.720
4jigA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9514 2 248 3.40.50.720
4iinB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9483 3 244 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9471 2 247 3.40.50.720
4mowD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9469 2 247 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0B8PNC9-F1-model_v4 Putative oxidoreductase 0.9781 2 133
AF-A0A7Z0PWL6-F1-model_v4 SDR family oxidoreductase 0.9777 2 143 GO:0016616
GO:0030497
AF-A0A4U9UDC6-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase FabG (EC 1.1.1.100) 0.977 1 136 GO:0004316
AF-A0A327UK89-F1-model_v4 Short subunit dehydrogenase 0.9765 2 123 GO:0016614
AF-A0A3M5BZ70-F1-model_v4 Oxidoreductase, short chain dehydrogenase/reductase family 0.9758 1 140

Map