F413006

General Info

Members Datasets Scaffolds Average Seq Length
337 195 674 94

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100839215|Ga0068858_1008392151
Length 98
Sequence MHDRPDNGETAADNSAGNPLKHLTPAQFMALGGNAVVYVRPISGAALAGMMTEGDDLDAEGEFHLVVSADGSPLMVGDTEEAVSDWLSERNYGVVSLH

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
54 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
88 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
91 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
92 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
93 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
119 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
120 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
121 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
122 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
123 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
124 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
125 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
153 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
159 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
160 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
161 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
162 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
163 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
164 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
165 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
166 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 2643221629 Devosia sp. Root105 Isolate Unclassified
195 2643221662 Devosia sp. Root413D1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 70.62
Metatranscriptomes 28.78
Isolates 0.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.42
Nodule 0
Rhizoplane 2.08
Rhizosphere 87.24
Stem 0
Stem Tuber 0
Unclassified 6.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100839215 3300005842 Bacteria 897
2 Ga0006777J48905_1076141 3300003308 Bacteria 565
3 Ga0006777J48905_1076891 3300003308 Bacteria 885
4 rootH2_10008486 3300003320 Bacteria 1692
5 rootH2_10110639 3300003320 Bacteria 1443
6 rootL2_10012984 3300003322 Bacteria 1170
7 rootL2_10034926 3300003322 Bacteria 2524
8 Ga0006780_1024959 3300003735 Bacteria 652
9 Ga0058863_11541435 3300004799 Bacteria 525
10 Ga0058861_11602836 3300004800 Bacteria 646
11 Ga0058861_11862872 3300004800 Bacteria 798
12 Ga0058862_12652621 3300004803 Bacteria 628
13 Ga0058862_12801084 3300004803 Bacteria 704
14 Ga0058862_12834345 3300004803 Bacteria 514
15 Ga0070658_10006067 3300005327 Bacteria 9799
16 Ga0070658_10101730 3300005327 Bacteria 2376
17 Ga0070658_10348370 3300005327 Bacteria 1267
18 Ga0070658_10351719 3300005327 Bacteria 1261
19 Ga0070683_101512963 3300005329 Bacteria 645
20 Ga0070660_100003163 3300005339 Bacteria 11310
21 Ga0070660_100049039 3300005339 Bacteria 3245
22 Ga0070660_100547263 3300005339 Bacteria 965
23 Ga0070661_100002122 3300005344 Bacteria 13666
24 Ga0070661_100016225 3300005344 Bacteria 5262
25 Ga0070661_100189419 3300005344 Bacteria 1568
26 Ga0070661_100861366 3300005344 Bacteria 746
27 Ga0070663_100240426 3300005455 Bacteria 1429
28 Ga0070663_100864531 3300005455 Bacteria 779
29 Ga0070662_101595128 3300005457 Bacteria 563
30 Ga0068867_100633827 3300005459 Bacteria 936
31 Ga0068867_101382433 3300005459 Bacteria 652
32 Ga0070679_100091525 3300005530 Bacteria 3029
33 Ga0070679_101015258 3300005530 Bacteria 774
34 Ga0070684_100091909 3300005535 Bacteria 2700
35 Ga0068853_100028990 3300005539 Bacteria 4660
36 Ga0068853_100060631 3300005539 Bacteria 3270
37 Ga0068853_101162186 3300005539 Bacteria 745
38 Ga0070665_100033488 3300005548 Bacteria 5169
39 Ga0068855_100008122 3300005563 Bacteria 12684
40 Ga0068855_100182751 3300005563 Bacteria 2370
41 Ga0068855_100470330 3300005563 Bacteria 1369
42 Ga0068857_100190342 3300005577 Bacteria 1869
43 Ga0068857_101077776 3300005577 Bacteria 775
44 Ga0068854_100254434 3300005578 Bacteria 1404
45 Ga0068854_100904682 3300005578 Bacteria 776
46 Ga0068854_102203967 3300005578 Bacteria 510
47 Ga0068856_100214127 3300005614 Bacteria 1942
48 Ga0068852_100026115 3300005616 Bacteria 4742
49 Ga0068852_100042772 3300005616 Bacteria 3838
50 Ga0068852_100077902 3300005616 Bacteria 2931
51 Ga0068863_100747296 3300005841 Bacteria 974
52 Ga0068860_101898604 3300005843 Bacteria 617
53 Ga0075365_10683801 3300006038 Unclassified 725
54 Ga0075363_100144121 3300006048 Bacteria 1342
55 Ga0075362_10001153 3300006177 Bacteria 8255
56 Ga0075367_10537502 3300006178 Bacteria 742
57 Ga0075369_10183136 3300006186 Bacteria 964
58 Ga0075366_10047971 3300006195 Bacteria 2531
59 Ga0097621_101032741 3300006237 Bacteria 770
60 Ga0075370_10709328 3300006353 Bacteria 612
61 Ga0105240_10079064 3300009093 Bacteria 4048
62 Ga0105240_10855537 3300009093 Bacteria 981
63 Ga0105240_11593026 3300009093 Bacteria 683
64 Ga0105245_10166705 3300009098 Bacteria 2094
65 Ga0105245_10814631 3300009098 Bacteria 972
66 Ga0105241_10073349 3300009174 Bacteria 2662
67 Ga0105241_10342113 3300009174 Bacteria 1296
68 Ga0105241_10593606 3300009174 Bacteria 1000
69 Ga0105241_11931263 3300009174 Unclassified 579
70 Ga0105237_10000053 3300009545 Bacteria 158890
71 Ga0105237_10197325 3300009545 Bacteria 2012
72 Ga0105238_13040264 3300009551 Unclassified 503
73 Ga0105239_10001462 3300010375 Bacteria 31410
74 Ga0105239_10130807 3300010375 Bacteria 2792
75 Ga0105239_10284706 3300010375 Bacteria 1861
76 Ga0105239_10406818 3300010375 Bacteria 1540
77 Ga0105239_11483681 3300010375 Bacteria 783
78 Ga0105246_11329439 3300011119 Bacteria 667
79 Ga0105246_11720020 3300011119 Unclassified 597
80 Ga0105246_12171596 3300011119 Unclassified 540
81 Ga0154016_133424 3300013045 Unclassified 510
82 Ga0157371_10010810 3300013102 Bacteria 7084
83 Ga0157370_10102034 3300013104 Bacteria 2687
84 Ga0157369_10027429 3300013105 Bacteria 6313
85 Ga0157369_11153691 3300013105 Bacteria 791
86 Ga0157369_11863197 3300013105 Bacteria 611
87 Ga0157374_10027996 3300013296 Bacteria 5089
88 Ga0157374_12867695 3300013296 Unclassified 509
89 Ga0157378_10082545 3300013297 Bacteria 2906
90 Ga0157372_10415099 3300013307 Bacteria 1568
91 Ga0157372_11463347 3300013307 Bacteria 787
92 Ga0157372_11927482 3300013307 Bacteria 679
93 Ga0157376_10476132 3300014969 Bacteria 1223
94 Ga0197907_10027561 3300020069 Bacteria 1235
95 Ga0197907_10293650 3300020069 Bacteria 946
96 Ga0197907_10399477 3300020069 Bacteria 933
97 Ga0197907_10479784 3300020069 Bacteria 822
98 Ga0197907_10668582 3300020069 Bacteria 813
99 Ga0206356_10380503 3300020070 Bacteria 845
100 Ga0206356_10600095 3300020070 Bacteria 1282
101 Ga0206356_11535721 3300020070 Bacteria 684
102 Ga0206349_1142179 3300020075 Bacteria 852
103 Ga0206349_1233508 3300020075 Bacteria 800
104 Ga0206349_1353932 3300020075 Bacteria 673
105 Ga0206349_1388410 3300020075 Bacteria 1160
106 Ga0206349_1714620 3300020075 Bacteria 659
107 Ga0206349_1972193 3300020075 Bacteria 508
108 Ga0206355_1008754 3300020076 Bacteria 951
109 Ga0206355_1109787 3300020076 Bacteria 966
110 Ga0206355_1280020 3300020076 Bacteria 752
111 Ga0206355_1280906 3300020076 Unclassified 586
112 Ga0206355_1331973 3300020076 Bacteria 1082
113 Ga0206355_1517782 3300020076 Bacteria 557
114 Ga0206351_10185636 3300020077 Bacteria 1113
115 Ga0206351_10530960 3300020077 Bacteria 1006
116 Ga0206351_10669798 3300020077 Bacteria 904
117 Ga0206351_10805035 3300020077 Bacteria 798
118 Ga0206352_10008952 3300020078 Bacteria 837
119 Ga0206352_10018217 3300020078 Bacteria 1215
120 Ga0206352_10431316 3300020078 Bacteria 592
121 Ga0206352_10534314 3300020078 Bacteria 905
122 Ga0206352_11116070 3300020078 Bacteria 961
123 Ga0206350_10286590 3300020080 Bacteria 932
124 Ga0206350_10585640 3300020080 Bacteria 1260
125 Ga0206350_10947833 3300020080 Bacteria 894
126 Ga0206350_11418779 3300020080 Bacteria 891
127 Ga0206354_10030563 3300020081 Bacteria 1293
128 Ga0206354_10596137 3300020081 Bacteria 1054
129 Ga0206354_11204051 3300020081 Bacteria 580
130 Ga0206353_10299132 3300020082 Bacteria 556
131 Ga0206353_10360251 3300020082 Bacteria 1357
132 Ga0206353_11345734 3300020082 Unclassified 930
133 Ga0206353_11352686 3300020082 Bacteria 800
134 Ga0154015_1291692 3300020610 Bacteria 1036
135 Ga0154015_1398164 3300020610 Bacteria 808
136 Ga0224712_10028989 3300022467 Bacteria 1984
137 Ga0224712_10219212 3300022467 Bacteria 870
138 Ga0224712_10221752 3300022467 Bacteria 866
139 Ga0224712_10250121 3300022467 Bacteria 819
140 Ga0224712_10250848 3300022467 Unclassified 817
141 Ga0207427_102970 3300025231 Bacteria 3958
142 Ga0209233_1002175 3300025261 Bacteria 7347
143 Ga0209051_1024298 3300025303 Bacteria 2495
144 Ga0207647_10246591 3300025904 Bacteria 1025
145 Ga0207705_10336923 3300025909 Bacteria 1161
146 Ga0207654_10285744 3300025911 Bacteria 1117
147 Ga0207695_10052880 3300025913 Bacteria 4252
148 Ga0207671_10000555 3300025914 Bacteria 50279
149 Ga0207671_10369970 3300025914 Bacteria 1138
150 Ga0207657_10001831 3300025919 Bacteria 22955
151 Ga0207657_10099080 3300025919 Bacteria 2421
152 Ga0207657_11046032 3300025919 Bacteria 625
153 Ga0207649_10013180 3300025920 Bacteria 4611
154 Ga0207649_10395317 3300025920 Bacteria 1033
155 Ga0207649_10430612 3300025920 Bacteria 992
156 Ga0207652_10810285 3300025921 Bacteria 831
157 Ga0207690_10273077 3300025932 Bacteria 1314
158 Ga0207709_11431631 3300025935 Bacteria 573
159 Ga0207667_10009811 3300025949 Bacteria 11252
160 Ga0207667_10068236 3300025949 Bacteria 3703
161 Ga0207667_10101417 3300025949 Bacteria 2969
162 Ga0207667_10419043 3300025949 Bacteria 1362
163 Ga0207640_10136672 3300025981 Bacteria 1780
164 Ga0207640_11133643 3300025981 Bacteria 693
165 Ga0207703_10574136 3300026035 Bacteria 1065
166 Ga0207639_10046667 3300026041 Bacteria 3270
167 Ga0207639_11726025 3300026041 Bacteria 586
168 Ga0207678_10255045 3300026067 Bacteria 1503
169 Ga0207678_10741878 3300026067 Bacteria 865
170 Ga0207678_11250089 3300026067 Bacteria 657
171 Ga0207702_10055965 3300026078 Bacteria 3347
172 Ga0207702_10529381 3300026078 Unclassified 1151
173 Ga0207641_10990252 3300026088 Bacteria 837
174 Ga0207648_11419445 3300026089 Bacteria 652
175 Ga0207674_10421488 3300026116 Bacteria 1290
176 Ga0207698_10022909 3300026142 Bacteria 4354
177 Ga0207698_10060304 3300026142 Bacteria 2950
178 Ga0207698_10110532 3300026142 Bacteria 2302
179 Ga0209974_10061327 3300027876 Bacteria 1273
180 Ga0268266_10000708 3300028379 Bacteria 45085
181 Ga0268264_12349524 3300028381 Bacteria 540
182 Ga0265334_10051381 3300028573 Bacteria 1580
183 Ga0265318_10004228 3300028577 Bacteria 7005
184 Ga0265338_10044683 3300028800 Bacteria 4085
185 Ga0265324_10049225 3300029957 Bacteria 1449
186 Ga0265330_10001277 3300031235 Bacteria 14728
187 Ga0265332_10068602 3300031238 Bacteria 1511
188 Ga0265328_10023931 3300031239 Bacteria 2312
189 Ga0265320_10105765 3300031240 Bacteria 1293
190 Ga0265325_10002526 3300031241 Bacteria 12312
191 Ga0265329_10181731 3300031242 Bacteria 688
192 Ga0265340_10161670 3300031247 Bacteria 1017
193 Ga0265339_10000227 3300031249 Bacteria 45452
194 Ga0265339_10127146 3300031249 Bacteria 1306
195 Ga0265331_10080716 3300031250 Bacteria 1511
196 Ga0265327_10152953 3300031251 Bacteria 1070
197 Ga0265316_10009946 3300031344 Bacteria 8711
198 Ga0265316_10037096 3300031344 Bacteria 3938
199 Ga0265313_10000048 3300031595 Bacteria 112723
200 Ga0307508_10632753 3300031616 Unclassified 674
201 Ga0265314_10047345 3300031711 Bacteria 3027
202 Ga0265314_10188947 3300031711 Bacteria 1227
203 Ga0265342_10018144 3300031712 Bacteria 4564
204 Ga0307413_10273105 3300031824 Bacteria 1267
205 Ga0307406_11880201 3300031901 Bacteria 533
206 Ga0307412_10691063 3300031911 Bacteria 875
207 Ga0307412_10772931 3300031911 Bacteria 831
208 Ga0307409_100282507 3300031995 Bacteria 1535
209 Ga0373945_0565618 3300035116 Bacteria 511
210 Ga0373946_0277206 3300035171 Bacteria 824
211 Ga0395899_0040517 3300037312 Bacteria 3483
212 Ga0395899_0202670 3300037312 Bacteria 1382
213 Ga0395900_0021722 3300037418 Bacteria 6561
214 Ga0395900_0327855 3300037418 Bacteria 1510
215 Ga0395900_0868902 3300037418 Bacteria 826
216 Ga0395898_0096570 3300037466 Bacteria 2838
217 Ga0395898_0108598 3300037466 Bacteria 2660
218 Ga0395905_0579222 3300037471 Bacteria 1024
219 Ga0395905_1866496 3300037471 Unclassified 507
220 Ga0395901_0070978 3300038443 Bacteria 3628
221 Ga0395901_0101696 3300038443 Bacteria 3015
222 Ga0395901_1220561 3300038443 Bacteria 717
223 Ga0436365_0016264 3300039437 Bacteria 713
224 Ga0439436_0181583 3300041404 Bacteria 599
225 Ga0439465_0337844 3300041413 Bacteria 568
226 Ga0439465_0345438 3300041413 Bacteria 561
227 Ga0451791_1940304 3300041451 Bacteria 517
228 Ga0451793_0243278 3300041452 Bacteria 542
229 Ga0451793_0401511 3300041452 Bacteria 693
230 Ga0451800_0581853 3300041459 Unclassified 714
231 Ga0451837_0507411 3300041494 Bacteria 808
232 Ga0439441_012963 3300042001 Bacteria 1439
233 Ga0439434_0187028 3300042435 Bacteria 695
234 Ga0466967_2089196 3300045976 Archaea 563
235 Ga0495686_0059969 3300047472 Bacteria 2366
236 Ga0496102_0723683 3300048905 Bacteria 918
237 Ga0496102_1006789 3300048905 Bacteria 754
238 Ga0496106_0702365 3300048909 Bacteria 806
239 Ga0496118_0203467 3300048921 Bacteria 1170
240 Ga0496121_0174164 3300048924 Bacteria 1560
241 Ga0501314_013367 3300049530 Bacteria 795
242 Ga0501323_029039 3300049539 Bacteria 768
243 Ga0501032_0305738 3300049569 Bacteria 1028
244 Ga0501032_0465452 3300049569 Bacteria 809
245 Ga0501033_0010125 3300049570 Bacteria 7236
246 Ga0501033_0696676 3300049570 Bacteria 691
247 Ga0501034_0009428 3300049571 Bacteria 10218
248 Ga0501034_0125004 3300049571 Bacteria 2557
249 Ga0501034_0174592 3300049571 Bacteria 2115
250 Ga0501034_0181043 3300049571 Bacteria 2072
251 Ga0501034_0205253 3300049571 Bacteria 1927
252 Ga0501034_0373245 3300049571 Bacteria 1352
253 Ga0501034_0571309 3300049571 Bacteria 1038
254 Ga0501036_0014563 3300049572 Bacteria 6549
255 Ga0501036_1504545 3300049572 Bacteria 544
256 Ga0501036_1717426 3300049572 Unclassified 506
257 Ga0501037_0239727 3300049573 Bacteria 1271
258 Ga0501037_0413276 3300049573 Bacteria 924
259 Ga0501037_0665083 3300049573 Bacteria 695
260 Ga0501038_0106287 3300049574 Bacteria 2330
261 Ga0501038_0262943 3300049574 Bacteria 1363
262 Ga0501038_0662512 3300049574 Bacteria 785
263 Ga0501043_0168904 3300049579 Bacteria 1707
264 Ga0501043_0188164 3300049579 Bacteria 1606
265 Ga0501046_0783800 3300049580 Bacteria 668
266 Ga0501047_0077356 3300049581 Bacteria 3201
267 Ga0501047_0275280 3300049581 Bacteria 1529
268 Ga0501047_0318213 3300049581 Bacteria 1396
269 Ga0501047_1006336 3300049581 Bacteria 647
270 Ga0501068_0372365 3300049584 Bacteria 919
271 Ga0501070_0014223 3300049586 Bacteria 6697
272 Ga0501070_0143220 3300049586 Bacteria 1973
273 Ga0501071_0451530 3300049587 Bacteria 984
274 Ga0501072_1353957 3300049588 Bacteria 551
275 Ga0501073_0680101 3300049589 Bacteria 710
276 Ga0501074_0052573 3300049590 Bacteria 2940
277 Ga0501080_0178072 3300049742 Bacteria 1958
278 Ga0501035_0049863 3300049822 Bacteria 3752
279 Ga0501035_0060535 3300049822 Bacteria 3370
280 Ga0501035_0207752 3300049822 Bacteria 1676
281 Ga0501044_0472069 3300049823 Bacteria 1158
282 Ga0501044_1562030 3300049823 Unclassified 525
283 nmdc:mga03683_68870_c1 3300050489 Bacteria 1509
284 nmdc:mga03n38_416556_c1 3300050490 Bacteria 742
285 nmdc:mga00v17_163925_c1 3300050491 Bacteria 1432
286 nmdc:mga0yw44_706061_c1 3300050492 Bacteria 685
287 nmdc:mga0k408_435665_c1 3300050493 Bacteria 779
288 nmdc:mga07m45_489341_c1 3300050496 Bacteria 712
289 nmdc:mga0sz30_286358_c1 3300050516 Bacteria 734
290 Ga0500562_020077 3300053108 Bacteria 1734
291 Ga0500597_186317 3300053120 Bacteria 878
292 Ga0500608_305175 3300053122 Bacteria 588
293 Ga0500568_0033292 3300053139 Bacteria 2116
294 Ga0500568_0272737 3300053139 Bacteria 615
295 Ga0500616_0035119 3300053153 Bacteria 2727
296 Ga0500634_0003120 3300053161 Bacteria 7278
297 Ga0500645_206285 3300053730 Bacteria 529
298 Ga0587084_044757 3300059477 Bacteria 764
299 Ga0587073_0055652 3300059492 Bacteria 911
300 Ga0587073_0159247 3300059492 Unclassified 646
301 Ga0587077_005100 3300059493 Bacteria 1774
302 Ga0587077_031659 3300059493 Bacteria 1011
303 Ga0587080_051298 3300059503 Bacteria 780
304 Ga0587082_103335 3300059504 Bacteria 624
305 Ga0587085_168401 3300059506 Bacteria 517
306 Ga0587088_029694 3300059508 Bacteria 969
307 Ga0587088_107871 3300059508 Unclassified 630
308 Ga0587090_065932 3300059510 Bacteria 697
309 Ga0587090_134292 3300059510 Unclassified 548
310 Ga0587094_102543 3300059513 Unclassified 554
311 Ga0587095_023438 3300059514 Bacteria 606
312 Ga0587101_011346 3300059623 Bacteria 1138
313 Ga0587101_106250 3300059623 Bacteria 564
314 Ga0587109_062895 3300059624 Bacteria 786
315 Ga0587115_031712 3300059626 Bacteria 789
316 Ga0587115_041312 3300059626 Bacteria 721
317 Ga0587117_089611 3300059627 Bacteria 572
318 Ga0587128_042956 3300059630 Bacteria 798
319 Ga0587130_017522 3300059631 Bacteria 753
320 Ga0587130_054879 3300059631 Bacteria 506
321 Ga0587062_004760 3300059639 Bacteria 1461
322 Ga0587068_157632 3300059641 Unclassified 517
323 Ga0587076_024453 3300059645 Bacteria 1025
324 Ga0587079_077851 3300059647 Unclassified 753
325 Ga0587079_108836 3300059647 Bacteria 671
326 Ga0587107_096926 3300059652 Bacteria 578
327 Ga0587114_034505 3300059655 Bacteria 791
328 Ga0587118_06159 3300059657 Bacteria 860
329 Ga0587119_062428 3300059658 Bacteria 577
330 Ga0587120_019082 3300059659 Bacteria 642
331 Ga0587124_012948 3300059660 Bacteria 776
332 Ga0587124_026662 3300059660 Unclassified 619
333 Ga0587071_036369 3300060344 Bacteria 971
334 Ga0587111_0009546 3300060346 Bacteria 1640
335 Ga0587111_0035074 3300060346 Bacteria 1044
336 2644164157 2643221629 Bacteria 5850260
337 2644348179 2643221662 Bacteria 5851492
338 Ga0068858_100839215
339 Ga0006777J48905_1076141
340 Ga0006777J48905_1076891
341 rootH2_10008486
342 rootH2_10110639
343 rootL2_10012984
344 rootL2_10034926
345 Ga0006780_1024959
346 Ga0058863_11541435
347 Ga0058861_11602836
348 Ga0058861_11862872
349 Ga0058862_12652621
350 Ga0058862_12801084
351 Ga0058862_12834345
352 Ga0070658_10006067
353 Ga0070658_10101730
354 Ga0070658_10348370
355 Ga0070658_10351719
356 Ga0070683_101512963
357 Ga0070660_100003163
358 Ga0070660_100049039
359 Ga0070660_100547263
360 Ga0070661_100002122
361 Ga0070661_100016225
362 Ga0070661_100189419
363 Ga0070661_100861366
364 Ga0070663_100240426
365 Ga0070663_100864531
366 Ga0070662_101595128
367 Ga0068867_100633827
368 Ga0068867_101382433
369 Ga0070679_100091525
370 Ga0070679_101015258
371 Ga0070684_100091909
372 Ga0068853_100028990
373 Ga0068853_100060631
374 Ga0068853_101162186
375 Ga0070665_100033488
376 Ga0068855_100008122
377 Ga0068855_100182751
378 Ga0068855_100470330
379 Ga0068857_100190342
380 Ga0068857_101077776
381 Ga0068854_100254434
382 Ga0068854_100904682
383 Ga0068854_102203967
384 Ga0068856_100214127
385 Ga0068852_100026115
386 Ga0068852_100042772
387 Ga0068852_100077902
388 Ga0068863_100747296
389 Ga0068860_101898604
390 Ga0075365_10683801
391 Ga0075363_100144121
392 Ga0075362_10001153
393 Ga0075367_10537502
394 Ga0075369_10183136
395 Ga0075366_10047971
396 Ga0097621_101032741
397 Ga0075370_10709328
398 Ga0105240_10079064
399 Ga0105240_10855537
400 Ga0105240_11593026
401 Ga0105245_10166705
402 Ga0105245_10814631
403 Ga0105241_10073349
404 Ga0105241_10342113
405 Ga0105241_10593606
406 Ga0105241_11931263
407 Ga0105237_10000053
408 Ga0105237_10197325
409 Ga0105238_13040264
410 Ga0105239_10001462
411 Ga0105239_10130807
412 Ga0105239_10284706
413 Ga0105239_10406818
414 Ga0105239_11483681
415 Ga0105246_11329439
416 Ga0105246_11720020
417 Ga0105246_12171596
418 Ga0154016_133424
419 Ga0157371_10010810
420 Ga0157370_10102034
421 Ga0157369_10027429
422 Ga0157369_11153691
423 Ga0157369_11863197
424 Ga0157374_10027996
425 Ga0157374_12867695
426 Ga0157378_10082545
427 Ga0157372_10415099
428 Ga0157372_11463347
429 Ga0157372_11927482
430 Ga0157376_10476132
431 Ga0197907_10027561
432 Ga0197907_10293650
433 Ga0197907_10399477
434 Ga0197907_10479784
435 Ga0197907_10668582
436 Ga0206356_10380503
437 Ga0206356_10600095
438 Ga0206356_11535721
439 Ga0206349_1142179
440 Ga0206349_1233508
441 Ga0206349_1353932
442 Ga0206349_1388410
443 Ga0206349_1714620
444 Ga0206349_1972193
445 Ga0206355_1008754
446 Ga0206355_1109787
447 Ga0206355_1280020
448 Ga0206355_1280906
449 Ga0206355_1331973
450 Ga0206355_1517782
451 Ga0206351_10185636
452 Ga0206351_10530960
453 Ga0206351_10669798
454 Ga0206351_10805035
455 Ga0206352_10008952
456 Ga0206352_10018217
457 Ga0206352_10431316
458 Ga0206352_10534314
459 Ga0206352_11116070
460 Ga0206350_10286590
461 Ga0206350_10585640
462 Ga0206350_10947833
463 Ga0206350_11418779
464 Ga0206354_10030563
465 Ga0206354_10596137
466 Ga0206354_11204051
467 Ga0206353_10299132
468 Ga0206353_10360251
469 Ga0206353_11345734
470 Ga0206353_11352686
471 Ga0154015_1291692
472 Ga0154015_1398164
473 Ga0224712_10028989
474 Ga0224712_10219212
475 Ga0224712_10221752
476 Ga0224712_10250121
477 Ga0224712_10250848
478 Ga0207427_102970
479 Ga0209233_1002175
480 Ga0209051_1024298
481 Ga0207647_10246591
482 Ga0207705_10336923
483 Ga0207654_10285744
484 Ga0207695_10052880
485 Ga0207671_10000555
486 Ga0207671_10369970
487 Ga0207657_10001831
488 Ga0207657_10099080
489 Ga0207657_11046032
490 Ga0207649_10013180
491 Ga0207649_10395317
492 Ga0207649_10430612
493 Ga0207652_10810285
494 Ga0207690_10273077
495 Ga0207709_11431631
496 Ga0207667_10009811
497 Ga0207667_10068236
498 Ga0207667_10101417
499 Ga0207667_10419043
500 Ga0207640_10136672
501 Ga0207640_11133643
502 Ga0207703_10574136
503 Ga0207639_10046667
504 Ga0207639_11726025
505 Ga0207678_10255045
506 Ga0207678_10741878
507 Ga0207678_11250089
508 Ga0207702_10055965
509 Ga0207702_10529381
510 Ga0207641_10990252
511 Ga0207648_11419445
512 Ga0207674_10421488
513 Ga0207698_10022909
514 Ga0207698_10060304
515 Ga0207698_10110532
516 Ga0209974_10061327
517 Ga0268266_10000708
518 Ga0268264_12349524
519 Ga0265334_10051381
520 Ga0265318_10004228
521 Ga0265338_10044683
522 Ga0265324_10049225
523 Ga0265330_10001277
524 Ga0265332_10068602
525 Ga0265328_10023931
526 Ga0265320_10105765
527 Ga0265325_10002526
528 Ga0265329_10181731
529 Ga0265340_10161670
530 Ga0265339_10000227
531 Ga0265339_10127146
532 Ga0265331_10080716
533 Ga0265327_10152953
534 Ga0265316_10009946
535 Ga0265316_10037096
536 Ga0265313_10000048
537 Ga0307508_10632753
538 Ga0265314_10047345
539 Ga0265314_10188947
540 Ga0265342_10018144
541 Ga0307413_10273105
542 Ga0307406_11880201
543 Ga0307412_10691063
544 Ga0307412_10772931
545 Ga0307409_100282507
546 Ga0373945_0565618
547 Ga0373946_0277206
548 Ga0395899_0040517
549 Ga0395899_0202670
550 Ga0395900_0021722
551 Ga0395900_0327855
552 Ga0395900_0868902
553 Ga0395898_0096570
554 Ga0395898_0108598
555 Ga0395905_0579222
556 Ga0395905_1866496
557 Ga0395901_0070978
558 Ga0395901_0101696
559 Ga0395901_1220561
560 Ga0436365_0016264
561 Ga0439436_0181583
562 Ga0439465_0337844
563 Ga0439465_0345438
564 Ga0451791_1940304
565 Ga0451793_0243278
566 Ga0451793_0401511
567 Ga0451800_0581853
568 Ga0451837_0507411
569 Ga0439441_012963
570 Ga0439434_0187028
571 Ga0466967_2089196
572 Ga0495686_0059969
573 Ga0496102_0723683
574 Ga0496102_1006789
575 Ga0496106_0702365
576 Ga0496118_0203467
577 Ga0496121_0174164
578 Ga0501314_013367
579 Ga0501323_029039
580 Ga0501032_0305738
581 Ga0501032_0465452
582 Ga0501033_0010125
583 Ga0501033_0696676
584 Ga0501034_0009428
585 Ga0501034_0125004
586 Ga0501034_0174592
587 Ga0501034_0181043
588 Ga0501034_0205253
589 Ga0501034_0373245
590 Ga0501034_0571309
591 Ga0501036_0014563
592 Ga0501036_1504545
593 Ga0501036_1717426
594 Ga0501037_0239727
595 Ga0501037_0413276
596 Ga0501037_0665083
597 Ga0501038_0106287
598 Ga0501038_0262943
599 Ga0501038_0662512
600 Ga0501043_0168904
601 Ga0501043_0188164
602 Ga0501046_0783800
603 Ga0501047_0077356
604 Ga0501047_0275280
605 Ga0501047_0318213
606 Ga0501047_1006336
607 Ga0501068_0372365
608 Ga0501070_0014223
609 Ga0501070_0143220
610 Ga0501071_0451530
611 Ga0501072_1353957
612 Ga0501073_0680101
613 Ga0501074_0052573
614 Ga0501080_0178072
615 Ga0501035_0049863
616 Ga0501035_0060535
617 Ga0501035_0207752
618 Ga0501044_0472069
619 Ga0501044_1562030
620 nmdc:mga03683_68870_c1
621 nmdc:mga03n38_416556_c1
622 nmdc:mga00v17_163925_c1
623 nmdc:mga0yw44_706061_c1
624 nmdc:mga0k408_435665_c1
625 nmdc:mga07m45_489341_c1
626 nmdc:mga0sz30_286358_c1
627 Ga0500562_020077
628 Ga0500597_186317
629 Ga0500608_305175
630 Ga0500568_0033292
631 Ga0500568_0272737
632 Ga0500616_0035119
633 Ga0500634_0003120
634 Ga0500645_206285
635 Ga0587084_044757
636 Ga0587073_0055652
637 Ga0587073_0159247
638 Ga0587077_005100
639 Ga0587077_031659
640 Ga0587080_051298
641 Ga0587082_103335
642 Ga0587085_168401
643 Ga0587088_029694
644 Ga0587088_107871
645 Ga0587090_065932
646 Ga0587090_134292
647 Ga0587094_102543
648 Ga0587095_023438
649 Ga0587101_011346
650 Ga0587101_106250
651 Ga0587109_062895
652 Ga0587115_031712
653 Ga0587115_041312
654 Ga0587117_089611
655 Ga0587128_042956
656 Ga0587130_017522
657 Ga0587130_054879
658 Ga0587062_004760
659 Ga0587068_157632
660 Ga0587076_024453
661 Ga0587079_077851
662 Ga0587079_108836
663 Ga0587107_096926
664 Ga0587114_034505
665 Ga0587118_06159
666 Ga0587119_062428
667 Ga0587120_019082
668 Ga0587124_012948
669 Ga0587124_026662
670 Ga0587071_036369
671 Ga0587111_0009546
672 Ga0587111_0035074
673 2644164157
674 2644348179

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06620

DUF1150

Protein of unknown function (DUF1150)

23

98

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lr4-assembly1.cif.gz_D complex of fab 2/1.12 with domain 3 of p. berghei hap2 0.8537 53 67
8d7h-assembly1.cif.gz_E cryo-em structure of human clcf1 in complex with crlf1 and cntfr alpha 0.8245 52 68
6j4e-assembly1.cif.gz_B crystal structure of the atwrky1 domain 0.7912 53 68
3fkf-assembly1.cif.gz_D thiol-disulfide oxidoreductase from bacteroides fragilis nctc 9343 0.6833 53 80
7pub-assembly1.cif.gz_DK late assembly intermediate of the trypanosoma brucei mitoribosomal small subunit 0.6702 29 78
ID Description Score Start End Superfamily
af_Q5W6B9_399_497_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9146 53 67 2.60.40.10
af_Q17738_300_563_3.15.20.10 Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 2;Bactericidal permeability-increasing protein; domain 2 0.8544 53 67 3.15.20.10
af_Q05BV3_65_305_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8316 54 69 2.120.10.30
af_A4I9C6_163_404_3.90.1720.10 Alpha Beta;Alpha-Beta Complex;endopeptidase fold (from Nostoc punctiforme);endopeptidase domain like (from Nostoc punctiforme) 0.8226 53 68 3.90.1720.10
af_P77277_6_132_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7727 26 67 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A142BA08-F1-model_v4 Uncharacterized protein 0.9198 51 79
AF-A0A843HYV1-F1-model_v4 Uncharacterized protein 0.9087 27 85
AF-A0A2M7HSM2-F1-model_v4 Uncharacterized protein 0.8312 50 81
AF-A0A358ARU4-F1-model_v4 Peptidoglycan binding-like domain-containing protein 0.8138 26 79
AF-A0A6I7P8A5-F1-model_v4 DUF1150 family protein 0.8124 25 89

Map