F412985

General Info

Members Datasets Scaffolds Average Seq Length
337 214 674 214

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_100051882|Ga0070672_1000518824
Length 237
Sequence MPSSGLPARRSTSPTSDPLSVSFAREGLVFIAIAALVAAGTYALALNRRSWPLWLLAFLLTIIALWVAYFFRDPERTGERGEQVVIAPADGKVVLISEVDEPSFMGGRAQRVSIFMNVFNVHVNRYPASGTVRYVQYNPGKFLNAAVEKSSLENEQMSVGIETARGRILVRQIAGLIARRIVTYSKVGEQVKQGDRMGLIRFGSRVDVFVPLDAKIRVKIGDMPVAGTTVIAELAPR

Samples

Sample ID Description Type Environment
1 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
110 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
111 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
112 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
113 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
115 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
118 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
127 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
138 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
185 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
186 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
187 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
188 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
189 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
190 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
191 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
195 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
196 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
208 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.59
Rhizosphere 98.81
Stem 0
Stem Tuber 0
Unclassified 5.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070672_100051882 3300005543 Bacteria 3200
2 JGI25406J46586_10013621 3300003203 Bacteria 3485
3 Ga0065715_10111607 3300005293 Bacteria 2567
4 Ga0070658_10005269 3300005327 Bacteria 10501
5 Ga0070658_10244501 3300005327 Bacteria 1521
6 Ga0070676_10268730 3300005328 Unclassified 1144
7 Ga0070676_10477513 3300005328 Bacteria 881
8 Ga0070683_100011728 3300005329 Bacteria 7588
9 Ga0070680_100002611 3300005336 Bacteria 13340
10 Ga0070680_100059904 3300005336 Bacteria 3116
11 Ga0070680_100077313 3300005336 Bacteria 2741
12 Ga0070680_100203128 3300005336 Bacteria 1671
13 Ga0070680_100263777 3300005336 Bacteria 1458
14 Ga0070682_100069368 3300005337 Bacteria 2251
15 Ga0070689_100636933 3300005340 Bacteria 926
16 Ga0070692_10058065 3300005345 Bacteria 2031
17 Ga0070692_10107543 3300005345 Unclassified 1538
18 Ga0070668_100070224 3300005347 Bacteria 2726
19 Ga0070668_100188551 3300005347 Bacteria 1688
20 Ga0070673_100054952 3300005364 Bacteria 3135
21 Ga0070659_100078611 3300005366 Bacteria 2632
22 Ga0070667_100506594 3300005367 Bacteria 1107
23 Ga0070709_10008742 3300005434 Bacteria 5571
24 Ga0070709_10116893 3300005434 Bacteria 1801
25 Ga0070709_10240928 3300005434 Bacteria 1299
26 Ga0070713_100001293 3300005436 Bacteria 16012
27 Ga0070713_100025261 3300005436 Bacteria 4642
28 Ga0070713_100195807 3300005436 Bacteria 1823
29 Ga0070713_100393610 3300005436 Bacteria 1293
30 Ga0070710_10280930 3300005437 Bacteria 1080
31 Ga0070701_10050531 3300005438 Bacteria 2153
32 Ga0070711_100034359 3300005439 Bacteria 3382
33 Ga0070711_100638313 3300005439 Unclassified 892
34 Ga0070708_100000250 3300005445 Bacteria 40164
35 Ga0070678_100444427 3300005456 Bacteria 1135
36 Ga0070662_100081542 3300005457 Bacteria 2410
37 Ga0070681_10000687 3300005458 Bacteria 28037
38 Ga0070681_10023722 3300005458 Bacteria 6174
39 Ga0070681_10072958 3300005458 Bacteria 3394
40 Ga0070707_100003050 3300005468 Bacteria 15873
41 Ga0070698_100020268 3300005471 Bacteria 6970
42 Ga0070698_100048024 3300005471 Bacteria 4362
43 Ga0070699_100163432 3300005518 Bacteria 1971
44 Ga0070699_100282766 3300005518 Bacteria 1486
45 Ga0070699_100322209 3300005518 Bacteria 1389
46 Ga0070679_100001626 3300005530 Bacteria 20226
47 Ga0070679_100002891 3300005530 Bacteria 15604
48 Ga0070679_100051559 3300005530 Bacteria 4098
49 Ga0070679_100133852 3300005530 Bacteria 2460
50 Ga0070679_100323931 3300005530 Bacteria 1490
51 Ga0070679_100500312 3300005530 Bacteria 1159
52 Ga0070679_100556542 3300005530 Bacteria 1091
53 Ga0070684_100597742 3300005535 Bacteria 1026
54 Ga0070697_100212377 3300005536 Bacteria 1648
55 Ga0070697_100625466 3300005536 Bacteria 947
56 Ga0068853_100717606 3300005539 Bacteria 954
57 Ga0070672_100350416 3300005543 Bacteria 1258
58 Ga0070686_100076546 3300005544 Bacteria 2204
59 Ga0070696_100002385 3300005546 Bacteria 12423
60 Ga0070696_100040298 3300005546 Bacteria 3225
61 Ga0070693_100005986 3300005547 Bacteria 5880
62 Ga0070693_100406904 3300005547 Unclassified 945
63 Ga0070664_100139453 3300005564 Bacteria 2134
64 Ga0068854_100076386 3300005578 Bacteria 2461
65 Ga0068856_100103848 3300005614 Bacteria 2835
66 Ga0068856_100429784 3300005614 Unclassified 1341
67 Ga0068864_100329540 3300005618 Bacteria 1436
68 Ga0068866_10117105 3300005718 Unclassified 1495
69 Ga0081539_10000103 3300005985 Bacteria 197839
70 Ga0070717_10124402 3300006028 Bacteria 2213
71 Ga0070712_100001441 3300006175 Bacteria 14519
72 Ga0097621_100554461 3300006237 Bacteria 1046
73 Ga0068871_100212604 3300006358 Bacteria 1673
74 Ga0075428_101473949 3300006844 Bacteria 713
75 Ga0075431_100045234 3300006847 Bacteria 4539
76 Ga0075433_10040781 3300006852 Bacteria 4020
77 Ga0075434_100029329 3300006871 Bacteria 5411
78 Ga0075434_100054342 3300006871 Bacteria 3979
79 Ga0075434_100125393 3300006871 Bacteria 2585
80 Ga0075434_100173354 3300006871 Bacteria 2177
81 Ga0075434_100210960 3300006871 Bacteria 1962
82 Ga0075429_100073427 3300006880 Bacteria 2980
83 Ga0068865_100212758 3300006881 Bacteria 1507
84 Ga0075436_100223586 3300006914 Unclassified 1336
85 Ga0075436_100279606 3300006914 Unclassified 1193
86 Ga0075435_100519411 3300007076 Bacteria 1030
87 Ga0105240_10169040 3300009093 Bacteria 2591
88 Ga0111539_10037332 3300009094 Bacteria 5867
89 Ga0105245_10788037 3300009098 Bacteria 988
90 Ga0105243_10492652 3300009148 Bacteria 1159
91 Ga0105249_10000078 3300009553 Bacteria 140030
92 Ga0105249_10700114 3300009553 Bacteria 1073
93 Ga0157378_10043375 3300013297 Bacteria 3994
94 Ga0157372_10139878 3300013307 Bacteria 2788
95 Ga0157372_10594291 3300013307 Bacteria 1290
96 Ga0157375_10812150 3300013308 Bacteria 1083
97 Ga0157380_10181030 3300014326 Bacteria 1852
98 Ga0207642_10106238 3300025899 Bacteria 1420
99 Ga0207642_10159286 3300025899 Bacteria 1210
100 Ga0207699_10160748 3300025906 Bacteria 1495
101 Ga0207699_10245417 3300025906 Bacteria 1232
102 Ga0207645_10023915 3300025907 Bacteria 3965
103 Ga0207645_10150254 3300025907 Bacteria 1520
104 Ga0207705_10117751 3300025909 Bacteria 1968
105 Ga0207705_10263090 3300025909 Bacteria 1317
106 Ga0207705_10283496 3300025909 Bacteria 1268
107 Ga0207707_10004550 3300025912 Bacteria 12194
108 Ga0207707_10036042 3300025912 Bacteria 4326
109 Ga0207707_10037253 3300025912 Bacteria 4250
110 Ga0207707_10514012 3300025912 Bacteria 1020
111 Ga0207695_10111230 3300025913 Bacteria 2718
112 Ga0207693_10018955 3300025915 Bacteria 5478
113 Ga0207693_10148411 3300025915 Bacteria 1844
114 Ga0207663_10054069 3300025916 Bacteria 2512
115 Ga0207663_10419018 3300025916 Bacteria 1027
116 Ga0207663_10524845 3300025916 Bacteria 923
117 Ga0207660_10008841 3300025917 Bacteria 6509
118 Ga0207660_10016560 3300025917 Bacteria 4880
119 Ga0207660_10126763 3300025917 Bacteria 1939
120 Ga0207660_10159721 3300025917 Bacteria 1738
121 Ga0207660_10450250 3300025917 Bacteria 1041
122 Ga0207660_10642236 3300025917 Bacteria 865
123 Ga0207662_10031935 3300025918 Bacteria 3062
124 Ga0207657_10400460 3300025919 Bacteria 1079
125 Ga0207649_10394115 3300025920 Bacteria 1035
126 Ga0207652_10003952 3300025921 Bacteria 12122
127 Ga0207652_10084942 3300025921 Unclassified 2773
128 Ga0207652_10114876 3300025921 Bacteria 2391
129 Ga0207652_10470253 3300025921 Bacteria 1133
130 Ga0207700_10007372 3300025928 Bacteria 6719
131 Ga0207700_10079356 3300025928 Bacteria 2556
132 Ga0207664_10247844 3300025929 Bacteria 1553
133 Ga0207690_10138698 3300025932 Bacteria 1789
134 Ga0207704_10069567 3300025938 Unclassified 2225
135 Ga0207665_10331778 3300025939 Bacteria 1144
136 Ga0207691_10330026 3300025940 Bacteria 1307
137 Ga0207661_10019919 3300025944 Bacteria 5008
138 Ga0207712_10001239 3300025961 Bacteria 17630
139 Ga0207668_10098870 3300025972 Bacteria 2163
140 Ga0207677_10563886 3300026023 Unclassified 994
141 Ga0207708_10014494 3300026075 Bacteria 5898
142 Ga0207708_10392673 3300026075 Bacteria 1146
143 Ga0207702_10148193 3300026078 Bacteria 2132
144 Ga0207648_10005905 3300026089 Bacteria 12250
145 Ga0207648_10140902 3300026089 Bacteria 2125
146 Ga0207675_100134614 3300026118 Unclassified 2344
147 Ga0207683_10064963 3300026121 Bacteria 3216
148 Ga0209981_1003510 3300027378 Bacteria 2038
149 Ga0209968_1015236 3300027526 Bacteria 1215
150 Ga0209968_1025375 3300027526 Bacteria 976
151 Ga0209971_1010324 3300027682 Bacteria 2211
152 Ga0209966_1005970 3300027695 Bacteria 2105
153 Ga0209974_10007069 3300027876 Unclassified 3879
154 Ga0268265_10520439 3300028380 Bacteria 1124
155 Ga0265332_10103040 3300031238 Bacteria 1203
156 Ga0307408_100041944 3300031548 Bacteria 3247
157 Ga0265314_10098736 3300031711 Bacteria 1882
158 Ga0307405_10096611 3300031731 Bacteria 1970
159 Ga0307405_10221593 3300031731 Bacteria 1388
160 Ga0307413_10003905 3300031824 Bacteria 6378
161 Ga0307413_10088709 3300031824 Bacteria 2007
162 Ga0307413_10182983 3300031824 Bacteria 1496
163 Ga0307413_10200600 3300031824 Bacteria 1441
164 Ga0307410_10013010 3300031852 Bacteria 4837
165 Ga0307410_10015177 3300031852 Bacteria 4561
166 Ga0307410_10155783 3300031852 Bacteria 1706
167 Ga0307406_10056248 3300031901 Unclassified 2518
168 Ga0307406_10063053 3300031901 Bacteria 2400
169 Ga0307406_10214168 3300031901 Bacteria 1427
170 Ga0307407_10001359 3300031903 Bacteria 8802
171 Ga0307412_10149581 3300031911 Bacteria 1721
172 Ga0307409_100000895 3300031995 Bacteria 13808
173 Ga0307409_100028761 3300031995 Bacteria 3966
174 Ga0307409_100058629 3300031995 Bacteria 2991
175 Ga0307409_100076234 3300031995 Bacteria 2688
176 Ga0307409_100152963 3300031995 Bacteria 2006
177 Ga0307409_101023618 3300031995 Bacteria 845
178 Ga0307416_100001380 3300032002 Bacteria 13136
179 Ga0307416_100012445 3300032002 Bacteria 5732
180 Ga0307416_100141158 3300032002 Bacteria 2190
181 Ga0307416_100274365 3300032002 Bacteria 1658
182 Ga0307416_100441571 3300032002 Unclassified 1351
183 Ga0307416_100513736 3300032002 Bacteria 1265
184 Ga0307414_10026788 3300032004 Bacteria 3715
185 Ga0307411_10000137 3300032005 Bacteria 23268
186 Ga0307411_10137208 3300032005 Bacteria 1798
187 Ga0307411_10182991 3300032005 Bacteria 1592
188 Ga0307411_10345386 3300032005 Bacteria 1211
189 Ga0307411_10374149 3300032005 Bacteria 1169
190 Ga0307411_10505909 3300032005 Bacteria 1022
191 Ga0307411_10855546 3300032005 Bacteria 805
192 Ga0307415_100003726 3300032126 Bacteria 7802
193 Ga0307415_100211684 3300032126 Bacteria 1547
194 Ga0307415_100252365 3300032126 Bacteria 1434
195 Ga0307415_100287566 3300032126 Bacteria 1355
196 Ga0373959_0027343 3300034820 Bacteria 1132
197 Ga0373938_0013183 3300034957 Bacteria 1564
198 Ga0373926_0006290 3300035083 Bacteria 3941
199 Ga0373934_0000285 3300035086 Bacteria 18198
200 Ga0373923_0000402 3300035111 Bacteria 10033
201 Ga0373941_0064078 3300035115 Unclassified 1203
202 Ga0373953_0002343 3300035117 Bacteria 5704
203 Ga0373954_0137208 3300035118 Bacteria 1192
204 Ga0373956_0009088 3300035119 Bacteria 4030
205 Ga0373960_0006707 3300035121 Bacteria 2710
206 Ga0373946_0030108 3300035171 Bacteria 2165
207 Ga0373955_0000461 3300035172 Bacteria 17247
208 Ga0373924_0009776 3300035410 Bacteria 3524
209 Ga0373927_0279680 3300035695 Bacteria 1098
210 Ga0373937_0000537 3300036401 Bacteria 33674
211 Ga0436364_0797459 3300037853 Bacteria 1086
212 Ga0436365_1670418 3300039437 Bacteria 871
213 Ga0439446_0027498 3300042156 Bacteria 1633
214 Ga0439434_0003648 3300042435 Bacteria 4504
215 Ga0466963_0125566 3300044694 Bacteria 1769
216 Ga0466957_0165765 3300044842 Bacteria 1437
217 Ga0451576_0196511 3300045051 Bacteria 2107
218 Ga0451576_0603409 3300045051 Bacteria 1154
219 Ga0451576_0867413 3300045051 Bacteria 947
220 Ga0466958_0216917 3300045836 Bacteria 1220
221 Ga0466967_0404528 3300045976 Bacteria 1329
222 Ga0466967_0883835 3300045976 Bacteria 888
223 Ga0495592_0002141 3300046454 Bacteria 13895
224 Ga0495592_0206164 3300046454 Bacteria 1323
225 Ga0495592_0455946 3300046454 Bacteria 800
226 Ga0495629_0047506 3300046459 Bacteria 3011
227 Ga0495629_0365070 3300046459 Bacteria 984
228 Ga0495651_0000421 3300046462 Bacteria 32807
229 Ga0495651_0136904 3300046462 Bacteria 1780
230 Ga0495653_0022508 3300046463 Bacteria 5099
231 Ga0495582_0039756 3300046473 Bacteria 2589
232 Ga0495639_0032646 3300046475 Bacteria 2323
233 Ga0495639_0162969 3300046475 Bacteria 1080
234 Ga0495662_0025001 3300046476 Bacteria 2883
235 Ga0495664_0129227 3300046477 Bacteria 1529
236 Ga0495594_0129580 3300046499 Bacteria 1428
237 Ga0495608_0000195 3300046511 Bacteria 43065
238 Ga0495608_0017417 3300046511 Bacteria 4968
239 Ga0495628_0000342 3300046516 Bacteria 42337
240 Ga0495628_0013784 3300046516 Bacteria 6792
241 Ga0495630_0009018 3300046517 Bacteria 7168
242 Ga0495630_0035871 3300046517 Bacteria 3706
243 Ga0495652_0003356 3300046529 Bacteria 15839
244 Ga0495652_0031515 3300046529 Bacteria 4643
245 Ga0495652_0052550 3300046529 Bacteria 3475
246 Ga0495665_0001279 3300046531 Bacteria 13420
247 Ga0495665_0046129 3300046531 Bacteria 2315
248 Ga0495665_0072337 3300046531 Bacteria 1816
249 Ga0495586_0012028 3300046535 Bacteria 4597
250 Ga0495587_0000582 3300046536 Bacteria 25139
251 Ga0495587_0089747 3300046536 Bacteria 1776
252 Ga0495645_0000894 3300046543 Bacteria 20304
253 Ga0495645_0042309 3300046543 Bacteria 3322
254 Ga0495645_0134820 3300046543 Bacteria 1728
255 Ga0495667_0010105 3300046559 Bacteria 6388
256 Ga0495635_0000299 3300046663 Bacteria 31934
257 Ga0495635_0037552 3300046663 Bacteria 3353
258 Ga0495588_0096957 3300046674 Bacteria 1547
259 Ga0495657_0000331 3300046675 Bacteria 43527
260 Ga0495599_0001572 3300046678 Bacteria 13148
261 Ga0495599_0027313 3300046678 Bacteria 3578
262 Ga0495623_0002311 3300046679 Bacteria 12705
263 Ga0495646_0000370 3300046680 Bacteria 23328
264 Ga0495646_0055661 3300046680 Bacteria 2374
265 Ga0495658_0093012 3300046683 Bacteria 1788
266 Ga0495613_0034265 3300046689 Bacteria 3772
267 Ga0495624_0047953 3300046690 Bacteria 2713
268 Ga0495600_0000095 3300046809 Bacteria 48392
269 Ga0495600_0031349 3300046809 Bacteria 3444
270 Ga0495581_0007665 3300047315 Bacteria 6243
271 Ga0495604_0003945 3300047317 Bacteria 11812
272 Ga0495604_0009668 3300047317 Bacteria 7624
273 Ga0495674_0070274 3300047319 Bacteria 3026
274 Ga0495680_0005323 3300047322 Bacteria 12147
275 Ga0495680_0051509 3300047322 Bacteria 3213
276 Ga0495675_0002772 3300047444 Bacteria 10506
277 Ga0495675_0003477 3300047444 Bacteria 9485
278 Ga0495684_0022027 3300047471 Bacteria 4905
279 Ga0495684_0674224 3300047471 Bacteria 689
280 Ga0495593_0019384 3300047673 Bacteria 3814
281 Ga0495593_0123741 3300047673 Bacteria 1315
282 Ga0495614_0011306 3300048089 Bacteria 3928
283 Ga0496112_0015752 3300048915 Bacteria 7062
284 Ga0496115_0212471 3300048918 Bacteria 1598
285 Ga0501298_034097 3300049521 Bacteria 1011
286 Ga0501031_0341133 3300049568 Bacteria 970
287 Ga0501033_0086503 3300049570 Bacteria 2295
288 Ga0501040_0016576 3300049576 Bacteria 4880
289 Ga0501041_0029935 3300049577 Bacteria 3285
290 Ga0501042_0249627 3300049578 Bacteria 1280
291 Ga0501046_0043318 3300049580 Bacteria 3584
292 Ga0501067_0104156 3300049583 Bacteria 1576
293 Ga0501069_0095958 3300049585 Bacteria 1680
294 Ga0501071_0170064 3300049587 Bacteria 1631
295 Ga0501072_0256969 3300049588 Bacteria 1391
296 Ga0501075_0053023 3300049591 Bacteria 3050
297 Ga0501076_0396294 3300049592 Bacteria 1135
298 Ga0501076_0511295 3300049592 Bacteria 990
299 Ga0501217_025014 3300049661 Bacteria 1433
300 Ga0501233_002840 3300049668 Bacteria 3081
301 Ga0501235_022005 3300049669 Bacteria 1418
302 Ga0501243_021917 3300049675 Bacteria 1057
303 Ga0501249_017449 3300049679 Bacteria 1547
304 Ga0501221_002429 3300049704 Bacteria 3070
305 Ga0501225_0006061 3300049705 Bacteria 3533
306 Ga0501234_001857 3300049707 Bacteria 3335
307 Ga0501080_0129100 3300049742 Bacteria 2340
308 Ga0501081_0017728 3300049743 Bacteria 4719
309 Ga0501081_0177119 3300049743 Bacteria 1541
310 Ga0501265_026515 3300049762 Bacteria 813
311 Ga0501268_003061 3300049765 Bacteria 2261
312 Ga0501270_003383 3300049767 Bacteria 1716
313 Ga0501045_0007916 3300049824 Bacteria 7401
314 nmdc:mga05p37_290745_c1 3300050507 Bacteria 1945
315 nmdc:mga09592_301066_c1 3300050508 Bacteria 1390
316 nmdc:mga0qj67_193320_c1 3300050509 Bacteria 1653
317 nmdc:mga0qj67_2802_c1 3300050509 Bacteria 12505
318 nmdc:mga06r32_12627_c1 3300050510 Bacteria 7630
319 nmdc:mga0n895_114744_c1 3300050512 Bacteria 2712
320 nmdc:mga0n895_242704_c1 3300050512 Bacteria 1828
321 nmdc:mga0n895_325254_c1 3300050512 Bacteria 1558
322 nmdc:mga0n895_580265_c1 3300050512 Bacteria 1125
323 nmdc:mga0rr50_194561_c1 3300050513 Bacteria 1663
324 nmdc:mga0rr50_236744_c1 3300050513 Unclassified 1512
325 nmdc:mga08x19_261053_c1 3300050514 Unclassified 1197
326 nmdc:mga0a205_124734_c1 3300050515 Bacteria 2475
327 Ga0495601_0046924 3300053077 Bacteria 2719
328 Ga0495612_0000509 3300053078 Bacteria 15594
329 Ga0495595_0033025 3300053084 Bacteria 2333
330 Ga0495619_0087054 3300053085 Bacteria 2112
331 Ga0495619_0184963 3300053085 Bacteria 1442
332 Ga0501084_0089895 3300054114 Bacteria 2578
333 Ga0501084_0387975 3300054114 Bacteria 1180
334 Ga0590071_008423 3300059421 Bacteria 2429
335 Ga0590074_018494 3300059423 Bacteria 1192
336 Ga0590077_013608 3300059426 Bacteria 1692
337 Ga0501082_0069177 3300060353 Bacteria 3039
338 Ga0070672_100051882
339 JGI25406J46586_10013621
340 Ga0065715_10111607
341 Ga0070658_10005269
342 Ga0070658_10244501
343 Ga0070676_10268730
344 Ga0070676_10477513
345 Ga0070683_100011728
346 Ga0070680_100002611
347 Ga0070680_100059904
348 Ga0070680_100077313
349 Ga0070680_100203128
350 Ga0070680_100263777
351 Ga0070682_100069368
352 Ga0070689_100636933
353 Ga0070692_10058065
354 Ga0070692_10107543
355 Ga0070668_100070224
356 Ga0070668_100188551
357 Ga0070673_100054952
358 Ga0070659_100078611
359 Ga0070667_100506594
360 Ga0070709_10008742
361 Ga0070709_10116893
362 Ga0070709_10240928
363 Ga0070713_100001293
364 Ga0070713_100025261
365 Ga0070713_100195807
366 Ga0070713_100393610
367 Ga0070710_10280930
368 Ga0070701_10050531
369 Ga0070711_100034359
370 Ga0070711_100638313
371 Ga0070708_100000250
372 Ga0070678_100444427
373 Ga0070662_100081542
374 Ga0070681_10000687
375 Ga0070681_10023722
376 Ga0070681_10072958
377 Ga0070707_100003050
378 Ga0070698_100020268
379 Ga0070698_100048024
380 Ga0070699_100163432
381 Ga0070699_100282766
382 Ga0070699_100322209
383 Ga0070679_100001626
384 Ga0070679_100002891
385 Ga0070679_100051559
386 Ga0070679_100133852
387 Ga0070679_100323931
388 Ga0070679_100500312
389 Ga0070679_100556542
390 Ga0070684_100597742
391 Ga0070697_100212377
392 Ga0070697_100625466
393 Ga0068853_100717606
394 Ga0070672_100350416
395 Ga0070686_100076546
396 Ga0070696_100002385
397 Ga0070696_100040298
398 Ga0070693_100005986
399 Ga0070693_100406904
400 Ga0070664_100139453
401 Ga0068854_100076386
402 Ga0068856_100103848
403 Ga0068856_100429784
404 Ga0068864_100329540
405 Ga0068866_10117105
406 Ga0081539_10000103
407 Ga0070717_10124402
408 Ga0070712_100001441
409 Ga0097621_100554461
410 Ga0068871_100212604
411 Ga0075428_101473949
412 Ga0075431_100045234
413 Ga0075433_10040781
414 Ga0075434_100029329
415 Ga0075434_100054342
416 Ga0075434_100125393
417 Ga0075434_100173354
418 Ga0075434_100210960
419 Ga0075429_100073427
420 Ga0068865_100212758
421 Ga0075436_100223586
422 Ga0075436_100279606
423 Ga0075435_100519411
424 Ga0105240_10169040
425 Ga0111539_10037332
426 Ga0105245_10788037
427 Ga0105243_10492652
428 Ga0105249_10000078
429 Ga0105249_10700114
430 Ga0157378_10043375
431 Ga0157372_10139878
432 Ga0157372_10594291
433 Ga0157375_10812150
434 Ga0157380_10181030
435 Ga0207642_10106238
436 Ga0207642_10159286
437 Ga0207699_10160748
438 Ga0207699_10245417
439 Ga0207645_10023915
440 Ga0207645_10150254
441 Ga0207705_10117751
442 Ga0207705_10263090
443 Ga0207705_10283496
444 Ga0207707_10004550
445 Ga0207707_10036042
446 Ga0207707_10037253
447 Ga0207707_10514012
448 Ga0207695_10111230
449 Ga0207693_10018955
450 Ga0207693_10148411
451 Ga0207663_10054069
452 Ga0207663_10419018
453 Ga0207663_10524845
454 Ga0207660_10008841
455 Ga0207660_10016560
456 Ga0207660_10126763
457 Ga0207660_10159721
458 Ga0207660_10450250
459 Ga0207660_10642236
460 Ga0207662_10031935
461 Ga0207657_10400460
462 Ga0207649_10394115
463 Ga0207652_10003952
464 Ga0207652_10084942
465 Ga0207652_10114876
466 Ga0207652_10470253
467 Ga0207700_10007372
468 Ga0207700_10079356
469 Ga0207664_10247844
470 Ga0207690_10138698
471 Ga0207704_10069567
472 Ga0207665_10331778
473 Ga0207691_10330026
474 Ga0207661_10019919
475 Ga0207712_10001239
476 Ga0207668_10098870
477 Ga0207677_10563886
478 Ga0207708_10014494
479 Ga0207708_10392673
480 Ga0207702_10148193
481 Ga0207648_10005905
482 Ga0207648_10140902
483 Ga0207675_100134614
484 Ga0207683_10064963
485 Ga0209981_1003510
486 Ga0209968_1015236
487 Ga0209968_1025375
488 Ga0209971_1010324
489 Ga0209966_1005970
490 Ga0209974_10007069
491 Ga0268265_10520439
492 Ga0265332_10103040
493 Ga0307408_100041944
494 Ga0265314_10098736
495 Ga0307405_10096611
496 Ga0307405_10221593
497 Ga0307413_10003905
498 Ga0307413_10088709
499 Ga0307413_10182983
500 Ga0307413_10200600
501 Ga0307410_10013010
502 Ga0307410_10015177
503 Ga0307410_10155783
504 Ga0307406_10056248
505 Ga0307406_10063053
506 Ga0307406_10214168
507 Ga0307407_10001359
508 Ga0307412_10149581
509 Ga0307409_100000895
510 Ga0307409_100028761
511 Ga0307409_100058629
512 Ga0307409_100076234
513 Ga0307409_100152963
514 Ga0307409_101023618
515 Ga0307416_100001380
516 Ga0307416_100012445
517 Ga0307416_100141158
518 Ga0307416_100274365
519 Ga0307416_100441571
520 Ga0307416_100513736
521 Ga0307414_10026788
522 Ga0307411_10000137
523 Ga0307411_10137208
524 Ga0307411_10182991
525 Ga0307411_10345386
526 Ga0307411_10374149
527 Ga0307411_10505909
528 Ga0307411_10855546
529 Ga0307415_100003726
530 Ga0307415_100211684
531 Ga0307415_100252365
532 Ga0307415_100287566
533 Ga0373959_0027343
534 Ga0373938_0013183
535 Ga0373926_0006290
536 Ga0373934_0000285
537 Ga0373923_0000402
538 Ga0373941_0064078
539 Ga0373953_0002343
540 Ga0373954_0137208
541 Ga0373956_0009088
542 Ga0373960_0006707
543 Ga0373946_0030108
544 Ga0373955_0000461
545 Ga0373924_0009776
546 Ga0373927_0279680
547 Ga0373937_0000537
548 Ga0436364_0797459
549 Ga0436365_1670418
550 Ga0439446_0027498
551 Ga0439434_0003648
552 Ga0466963_0125566
553 Ga0466957_0165765
554 Ga0451576_0196511
555 Ga0451576_0603409
556 Ga0451576_0867413
557 Ga0466958_0216917
558 Ga0466967_0404528
559 Ga0466967_0883835
560 Ga0495592_0002141
561 Ga0495592_0206164
562 Ga0495592_0455946
563 Ga0495629_0047506
564 Ga0495629_0365070
565 Ga0495651_0000421
566 Ga0495651_0136904
567 Ga0495653_0022508
568 Ga0495582_0039756
569 Ga0495639_0032646
570 Ga0495639_0162969
571 Ga0495662_0025001
572 Ga0495664_0129227
573 Ga0495594_0129580
574 Ga0495608_0000195
575 Ga0495608_0017417
576 Ga0495628_0000342
577 Ga0495628_0013784
578 Ga0495630_0009018
579 Ga0495630_0035871
580 Ga0495652_0003356
581 Ga0495652_0031515
582 Ga0495652_0052550
583 Ga0495665_0001279
584 Ga0495665_0046129
585 Ga0495665_0072337
586 Ga0495586_0012028
587 Ga0495587_0000582
588 Ga0495587_0089747
589 Ga0495645_0000894
590 Ga0495645_0042309
591 Ga0495645_0134820
592 Ga0495667_0010105
593 Ga0495635_0000299
594 Ga0495635_0037552
595 Ga0495588_0096957
596 Ga0495657_0000331
597 Ga0495599_0001572
598 Ga0495599_0027313
599 Ga0495623_0002311
600 Ga0495646_0000370
601 Ga0495646_0055661
602 Ga0495658_0093012
603 Ga0495613_0034265
604 Ga0495624_0047953
605 Ga0495600_0000095
606 Ga0495600_0031349
607 Ga0495581_0007665
608 Ga0495604_0003945
609 Ga0495604_0009668
610 Ga0495674_0070274
611 Ga0495680_0005323
612 Ga0495680_0051509
613 Ga0495675_0002772
614 Ga0495675_0003477
615 Ga0495684_0022027
616 Ga0495684_0674224
617 Ga0495593_0019384
618 Ga0495593_0123741
619 Ga0495614_0011306
620 Ga0496112_0015752
621 Ga0496115_0212471
622 Ga0501298_034097
623 Ga0501031_0341133
624 Ga0501033_0086503
625 Ga0501040_0016576
626 Ga0501041_0029935
627 Ga0501042_0249627
628 Ga0501046_0043318
629 Ga0501067_0104156
630 Ga0501069_0095958
631 Ga0501071_0170064
632 Ga0501072_0256969
633 Ga0501075_0053023
634 Ga0501076_0396294
635 Ga0501076_0511295
636 Ga0501217_025014
637 Ga0501233_002840
638 Ga0501235_022005
639 Ga0501243_021917
640 Ga0501249_017449
641 Ga0501221_002429
642 Ga0501225_0006061
643 Ga0501234_001857
644 Ga0501080_0129100
645 Ga0501081_0017728
646 Ga0501081_0177119
647 Ga0501265_026515
648 Ga0501268_003061
649 Ga0501270_003383
650 Ga0501045_0007916
651 nmdc:mga05p37_290745_c1
652 nmdc:mga09592_301066_c1
653 nmdc:mga0qj67_193320_c1
654 nmdc:mga0qj67_2802_c1
655 nmdc:mga06r32_12627_c1
656 nmdc:mga0n895_114744_c1
657 nmdc:mga0n895_242704_c1
658 nmdc:mga0n895_325254_c1
659 nmdc:mga0n895_580265_c1
660 nmdc:mga0rr50_194561_c1
661 nmdc:mga0rr50_236744_c1
662 nmdc:mga08x19_261053_c1
663 nmdc:mga0a205_124734_c1
664 Ga0495601_0046924
665 Ga0495612_0000509
666 Ga0495595_0033025
667 Ga0495619_0087054
668 Ga0495619_0184963
669 Ga0501084_0089895
670 Ga0501084_0387975
671 Ga0590071_008423
672 Ga0590074_018494
673 Ga0590077_013608
674 Ga0501082_0069177

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02666

PS_Dcarbxylase

Phosphatidylserine decarboxylase

63

232

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dfy-assembly2.cif.gz_N crystal structure of apo dipeptide epimerase from thermotoga maritima 0.6467 109 156
8ox8-assembly1.cif.gz_A "cryo-em structure of atp8b1-cdc50a in e2p autoinhibited ""open"" conformation" 0.5959 86 154
3jva-assembly1.cif.gz_C crystal structure of dipeptide epimerase from enterococcus faecalis v583 0.5887 108 168
4z1y-assembly1.cif.gz_A thermostable enolase from chloroflexus aurantiacus with substrate 2-phosphoglycerate 0.5647 108 154
4z1y-assembly1.cif.gz_B thermostable enolase from chloroflexus aurantiacus with substrate 2-phosphoglycerate 0.5524 108 155
ID Description Score Start End Superfamily
af_P9WHQ5_55_228_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9543 50 212 2.70.70.10
af_Q99N03_56_152_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.9249 9 49 1.20.140.150
af_P9WHQ5_55_228_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8906 50 212 2.70.70.10
af_Q9UTB5_356_515_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8771 91 208 2.70.70.10
af_Q58227_16_200_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8486 45 212 2.70.70.10
ID Description Score Start End GO Terms
AF-A0A3D5QZE4-F1-model_v4 Phosphatidylserine decarboxylase family protein 0.9889 99 216 GO:0004609
GO:0005886
GO:0008654
AF-A0A3C1M6Q6-F1-model_v4 deleted 0.987 107 216
AF-A0A7Z9S1G0-F1-model_v4 Phosphatidylserine decarboxylase family protein (EC 4.1.1.65) 0.9851 104 218 GO:0004609
GO:0005886
GO:0008654
AF-A0A1V3WNV3-F1-model_v4 Phosphatidylserine decarboxylase family protein 0.9828 105 216 GO:0004609
GO:0005886
GO:0008654
AF-A0A3D5QZE4-F1-model_v4 Phosphatidylserine decarboxylase family protein 0.9807 99 216 GO:0004609
GO:0005886
GO:0008654

Map